F362262

General Info

Members Datasets Scaffolds Average Seq Length
251 148 251 114

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100189937|Ga0070693_1001899372
Length 124
Sequence MTKRYCLTLDLKNDPELIAEYKQYHAAGNAWPEITKSIRDAGILDMEIYLLGTRMFMIMEVNEHFSFEAKSKVDRLNSKVQEWEKLMLKFQQPLPESAPGEKWLLMEKIFKLQVSAEIAELQQR

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
139 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
140 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
141 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_10544046 3300004801 Bacteria 866
2 Ga0065712_10254284 3300005290 Unclassified 952
3 Ga0070690_100210514 3300005330 Bacteria 1357
4 Ga0068869_100010564 3300005334 Bacteria 6027
5 Ga0070680_100000243 3300005336 Bacteria 36079
6 Ga0070682_100000482 3300005337 Bacteria 25028
7 Ga0070660_100310354 3300005339 Bacteria 1294
8 Ga0070691_10003442 3300005341 Bacteria 7116
9 Ga0070669_101518746 3300005353 Unclassified 582
10 Ga0070659_100464336 3300005366 Bacteria 1075
11 Ga0070667_100820032 3300005367 Unclassified 864
12 Ga0070709_10371305 3300005434 Unclassified 1061
13 Ga0070709_10739535 3300005434 Bacteria 768
14 Ga0070709_10772872 3300005434 Unclassified 752
15 Ga0070709_10862200 3300005434 Bacteria 714
16 Ga0070714_100009855 3300005435 Bacteria 7531
17 Ga0070714_100377732 3300005435 Bacteria 1335
18 Ga0070714_102064895 3300005435 Unclassified 556
19 Ga0070713_100003320 3300005436 Bacteria 10613
20 Ga0070713_100283896 3300005436 Bacteria 1519
21 Ga0070713_101028831 3300005436 Unclassified 795
22 Ga0070700_100922736 3300005441 Unclassified 712
23 Ga0070662_100289909 3300005457 Bacteria 1327
24 Ga0070681_10002165 3300005458 Bacteria 17876
25 Ga0070681_10005958 3300005458 Bacteria 11801
26 Ga0070681_11219223 3300005458 Unclassified 674
27 Ga0070699_100092440 3300005518 Unclassified 2646
28 Ga0070679_100000549 3300005530 Bacteria 31843
29 Ga0070679_100093409 3300005530 Bacteria 2996
30 Ga0070695_100274433 3300005545 Bacteria 1236
31 Ga0070695_100714635 3300005545 Unclassified 796
32 Ga0070693_100189937 3300005547 Bacteria 1328
33 Ga0070693_100773639 3300005547 Bacteria 709
34 Ga0068855_100025873 3300005563 Bacteria 7018
35 Ga0068855_101000874 3300005563 Bacteria 878
36 Ga0068854_100049886 3300005578 Bacteria 2992
37 Ga0068856_100000956 3300005614 Bacteria 30876
38 Ga0068856_100288347 3300005614 Bacteria 1658
39 Ga0068859_100065946 3300005617 Unclassified 3655
40 Ga0068851_10727756 3300005834 Bacteria 612
41 Ga0068863_100079202 3300005841 Unclassified 3112
42 Ga0068863_100116025 3300005841 Bacteria 2552
43 Ga0068858_100001952 3300005842 Bacteria 21029
44 Ga0068860_100045316 3300005843 Unclassified 4194
45 Ga0068862_100509630 3300005844 Bacteria 1143
46 Ga0070717_10043049 3300006028 Unclassified 3684
47 Ga0070717_10102696 3300006028 Bacteria 2429
48 Ga0070715_10387723 3300006163 Unclassified 773
49 Ga0070715_10427742 3300006163 Bacteria 742
50 Ga0070716_100015357 3300006173 Bacteria 3933
51 Ga0070716_100250397 3300006173 Bacteria 1206
52 Ga0070716_100924093 3300006173 Unclassified 685
53 Ga0070712_101985994 3300006175 Bacteria 509
54 Ga0097621_100323149 3300006237 Unclassified 1367
55 Ga0097621_100864175 3300006237 Unclassified 841
56 Ga0068871_100193536 3300006358 Bacteria 1753
57 Ga0068871_100601972 3300006358 Bacteria 1000
58 Ga0068871_101307152 3300006358 Unclassified 682
59 Ga0075433_10001321 3300006852 Bacteria 18136
60 Ga0075433_10935529 3300006852 Unclassified 756
61 Ga0075434_100002762 3300006871 Bacteria 15529
62 Ga0068865_100205897 3300006881 Unclassified 1530
63 Ga0075436_100002924 3300006914 Bacteria 11713
64 Ga0075436_100254713 3300006914 Bacteria 1251
65 Ga0075436_100283051 3300006914 Unclassified 1186
66 Ga0075436_100466795 3300006914 Unclassified 920
67 Ga0097620_100065947 3300006931 Unclassified 3655
68 Ga0075435_100003372 3300007076 Bacteria 10833
69 Ga0075435_101074932 3300007076 Bacteria 703
70 Ga0099794_10003714 3300007265 Bacteria 5875
71 Ga0099794_10004952 3300007265 Bacteria 5296
72 Ga0099794_10006361 3300007265 Bacteria 4778
73 Ga0099794_10011288 3300007265 Unclassified 3819
74 Ga0105240_10002660 3300009093 Bacteria 28423
75 Ga0105240_10016211 3300009093 Bacteria 10097
76 Ga0105240_10258943 3300009093 Bacteria 2008
77 Ga0105240_11558383 3300009093 Unclassified 692
78 Ga0105245_10975838 3300009098 Unclassified 891
79 Ga0105247_10355818 3300009101 Bacteria 1031
80 Ga0114129_10500894 3300009147 Unclassified 1586
81 Ga0105241_10000668 3300009174 Bacteria 25809
82 Ga0105241_10048328 3300009174 Bacteria 3237
83 Ga0105241_10698065 3300009174 Unclassified 926
84 Ga0105241_10861477 3300009174 Unclassified 839
85 Ga0105248_11201920 3300009177 Bacteria 857
86 Ga0105248_11597656 3300009177 Unclassified 739
87 Ga0105237_10020087 3300009545 Bacteria 6896
88 Ga0105237_10144217 3300009545 Bacteria 2376
89 Ga0105237_10655865 3300009545 Unclassified 1056
90 Ga0105237_10862485 3300009545 Bacteria 912
91 Ga0105239_10165772 3300010375 Unclassified 2470
92 Ga0105246_12585540 3300011119 Unclassified 501
93 Ga0157373_10127792 3300013100 Bacteria 1787
94 Ga0157371_10771459 3300013102 Bacteria 723
95 Ga0157370_10000831 3300013104 Bacteria 39105
96 Ga0157369_10273278 3300013105 Bacteria 1761
97 Ga0157374_10000703 3300013296 Bacteria 29400
98 Ga0157374_10350958 3300013296 Bacteria 1466
99 Ga0157374_10387077 3300013296 Bacteria 1393
100 Ga0157378_10041720 3300013297 Unclassified 4071
101 Ga0157378_10118999 3300013297 Unclassified 2432
102 Ga0157378_10186098 3300013297 Bacteria 1956
103 Ga0157378_12575759 3300013297 Unclassified 561
104 Ga0163162_10760191 3300013306 Unclassified 1088
105 Ga0157372_10013328 3300013307 Bacteria 8776
106 Ga0157372_10024969 3300013307 Bacteria 6495
107 Ga0157372_10164746 3300013307 Bacteria 2563
108 Ga0157372_10422714 3300013307 Bacteria 1553
109 Ga0157372_10901387 3300013307 Unclassified 1026
110 Ga0157372_11001510 3300013307 Unclassified 968
111 Ga0157375_10008044 3300013308 Bacteria 9231
112 Ga0157375_10145597 3300013308 Bacteria 2500
113 Ga0157375_10335605 3300013308 Bacteria 1677
114 Ga0157377_10302308 3300014745 Bacteria 1056
115 Ga0157379_10209395 3300014968 Bacteria 1765
116 Ga0157379_10578101 3300014968 Bacteria 1047
117 Ga0157376_10037113 3300014969 Bacteria 3952
118 Ga0157376_10524138 3300014969 Unclassified 1168
119 Ga0182005_1092343 3300015265 Unclassified 842
120 Ga0213873_10077927 3300021358 Bacteria 923
121 Ga0213874_10028473 3300021377 Bacteria 1596
122 Ga0213876_10260191 3300021384 Unclassified 922
123 Ga0207647_10046869 3300025904 Bacteria 2691
124 Ga0207685_10650265 3300025905 Unclassified 570
125 Ga0207699_10403818 3300025906 Bacteria 973
126 Ga0207699_10438828 3300025906 Bacteria 935
127 Ga0207699_10564218 3300025906 Bacteria 827
128 Ga0207699_10710545 3300025906 Bacteria 736
129 Ga0207654_10000168 3300025911 Bacteria 41625
130 Ga0207654_10088838 3300025911 Bacteria 1879
131 Ga0207654_10179618 3300025911 Bacteria 1380
132 Ga0207654_10614172 3300025911 Bacteria 777
133 Ga0207707_10000117 3300025912 Bacteria 80929
134 Ga0207707_10002300 3300025912 Bacteria 17227
135 Ga0207707_10935754 3300025912 Bacteria 715
136 Ga0207695_10006345 3300025913 Bacteria 15383
137 Ga0207695_10009628 3300025913 Bacteria 11922
138 Ga0207695_10013999 3300025913 Bacteria 9526
139 Ga0207695_10112914 3300025913 Unclassified 2694
140 Ga0207671_10190952 3300025914 Bacteria 1597
141 Ga0207671_10527392 3300025914 Bacteria 942
142 Ga0207671_10651845 3300025914 Unclassified 838
143 Ga0207660_10001028 3300025917 Bacteria 18473
144 Ga0207657_10290195 3300025919 Bacteria 1297
145 Ga0207652_10000280 3300025921 Bacteria 53021
146 Ga0207652_10489196 3300025921 Bacteria 1108
147 Ga0207681_11417008 3300025923 Unclassified 583
148 Ga0207694_10724385 3300025924 Unclassified 839
149 Ga0207687_10298661 3300025927 Bacteria 1297
150 Ga0207700_10012468 3300025928 Bacteria 5484
151 Ga0207700_10297316 3300025928 Bacteria 1393
152 Ga0207700_10584030 3300025928 Bacteria 994
153 Ga0207700_10931831 3300025928 Bacteria 777
154 Ga0207700_11086475 3300025928 Bacteria 715
155 Ga0207700_11727377 3300025928 Unclassified 551
156 Ga0207664_10014923 3300025929 Bacteria 5624
157 Ga0207664_10063332 3300025929 Bacteria 2955
158 Ga0207664_10203485 3300025929 Bacteria 1710
159 Ga0207664_11765651 3300025929 Bacteria 541
160 Ga0207664_11997749 3300025929 Bacteria 503
161 Ga0207690_11403504 3300025932 Bacteria 584
162 Ga0207704_10199511 3300025938 Unclassified 1463
163 Ga0207665_10002739 3300025939 Bacteria 11819
164 Ga0207665_10057695 3300025939 Bacteria 2623
165 Ga0207665_10486965 3300025939 Bacteria 951
166 Ga0207665_10850642 3300025939 Unclassified 722
167 Ga0207711_10663622 3300025941 Unclassified 973
168 Ga0207689_10001777 3300025942 Bacteria 20357
169 Ga0207661_11406395 3300025944 Bacteria 640
170 Ga0207667_10127242 3300025949 Unclassified 2624
171 Ga0207667_10148623 3300025949 Bacteria 2412
172 Ga0207667_11414061 3300025949 Unclassified 669
173 Ga0207640_10205590 3300025981 Bacteria 1496
174 Ga0207703_10001169 3300026035 Bacteria 24781
175 Ga0207703_10052823 3300026035 Unclassified 3302
176 Ga0207703_11041497 3300026035 Unclassified 785
177 Ga0207639_10034207 3300026041 Bacteria 3754
178 Ga0207702_10007807 3300026078 Bacteria 9080
179 Ga0207702_10031428 3300026078 Bacteria 4425
180 Ga0207702_10091997 3300026078 Bacteria 2657
181 Ga0207702_10397205 3300026078 Bacteria 1329
182 Ga0207641_10109936 3300026088 Bacteria 2442
183 Ga0207675_101591754 3300026118 Unclassified 674
184 Ga0209588_1001630 3300027671 Bacteria 5900
185 Ga0209588_1008043 3300027671 Unclassified 3121
186 Ga0209588_1089146 3300027671 Bacteria 994
187 Ga0268265_10055510 3300028380 Unclassified 3010
188 Ga0268264_10012259 3300028381 Bacteria 7051
189 Ga0265338_10085555 3300028800 Bacteria 2628
190 Ga0316576_10316096 3300031727 Bacteria 1165
191 Ga0307410_10598045 3300031852 Unclassified 920
192 Ga0316583_10000120 3300032133 Bacteria 18362
193 Ga0316585_10011122 3300032137 Bacteria 2649
194 Ga0373934_0037225 3300035086 Bacteria 1916
195 Ga0373923_0162378 3300035111 Bacteria 1020
196 Ga0373936_0148957 3300035113 Unclassified 1014
197 Ga0373943_0026942 3300035170 Bacteria 2697
198 Ga0373946_0028481 3300035171 Bacteria 2216
199 Ga0373955_0041324 3300035172 Bacteria 2471
200 Ga0373927_0079985 3300035695 Unclassified 2118
201 Ga0373927_0123979 3300035695 Bacteria 1686
202 Ga0373927_0213184 3300035695 Bacteria 1269
203 Ga0373947_0036434 3300035725 Bacteria 2917
204 Ga0373937_0102338 3300036401 Unclassified 2659
205 Ga0373937_1062153 3300036401 Unclassified 759
206 Ga0316582_0063383 3300036647 Bacteria 2375
207 Ga0373925_0000126 3300037068 Bacteria 82922
208 Ga0373925_0013327 3300037068 Bacteria 5949
209 Ga0373925_0163326 3300037068 Bacteria 1755
210 Ga0373925_0449617 3300037068 Unclassified 1055
211 Ga0436365_0900246 3300039437 Unclassified 1237
212 Ga0436363_1376765 3300039450 Bacteria 8238
213 Ga0436362_0649279 3300039453 Bacteria 1052
214 Ga0466966_0664870 3300044684 Bacteria 628
215 Ga0466963_0007096 3300044694 Bacteria 6673
216 Ga0466964_0056781 3300044706 Bacteria 1619
217 Ga0453684_0211139 3300044712 Bacteria 2256
218 Ga0453684_0258312 3300044712 Bacteria 1997
219 Ga0466957_0066204 3300044842 Bacteria 2227
220 Ga0451576_0701619 3300045051 Unclassified 1063
221 Ga0466967_2119570 3300045976 Bacteria 558
222 Ga0495590_0097101 3300046457 Unclassified 1045
223 Ga0495653_0720976 3300046463 Unclassified 604
224 Ga0495580_0000247 3300046472 Bacteria 42646
225 Ga0495580_0002141 3300046472 Bacteria 17324
226 Ga0495582_0479403 3300046473 Bacteria 719
227 Ga0495630_0295252 3300046517 Bacteria 1238
228 Ga0495666_0222569 3300046526 Bacteria 864
229 Ga0495665_0021300 3300046531 Bacteria 3482
230 Ga0495645_0766973 3300046543 Unclassified 581
231 Ga0495675_0065357 3300047444 Bacteria 2301
232 Ga0495686_0001753 3300047472 Bacteria 22261
233 Ga0495602_0039600 3300048088 Bacteria 4338
234 Ga0496112_0064440 3300048915 Unclassified 3616
235 Ga0501217_110363 3300049661 Unclassified 790
236 Ga0501242_060881 3300049674 Unclassified 574
237 Ga0501259_001539 3300049688 Bacteria 3836
238 Ga0501268_053592 3300049765 Unclassified 785
239 nmdc:mga05p37_398261_c1 3300050507 Unclassified 1608
240 nmdc:mga0n895_2918_c1 3300050512 Bacteria 13551
241 nmdc:mga0rr50_3866_c1 3300050513 Bacteria 8710
242 nmdc:mga0rr50_970849_c1 3300050513 Bacteria 724
243 nmdc:mga08x19_437084_c1 3300050514 Unclassified 920
244 nmdc:mga08x19_51518_c1 3300050514 Unclassified 2645
245 nmdc:mga08x19_61403_c1 3300050514 Bacteria 2435
246 nmdc:mga08x19_698392_c1 3300050514 Bacteria 720
247 nmdc:mga08x19_812_c1 3300050514 Bacteria 19830
248 nmdc:mga08x19_87103_c1 3300050514 Bacteria 2057
249 nmdc:mga0a205_6408_c1 3300050515 Bacteria 10634
250 Ga0495601_0644520 3300053077 Unclassified 678
251 Ga0466962_0012484 3300061719 Bacteria 4084

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026035 Ga0207703_10052823 Ga0207703_100528232 107
2 3300005336 Ga0070680_100000243 Ga0070680_1000002438 109
3 3300005337 Ga0070682_100000482 Ga0070682_1000004829 109
4 3300005339 Ga0070660_100310354 Ga0070660_1003103542 109
5 3300005341 Ga0070691_10003442 Ga0070691_100034427 109
6 3300005366 Ga0070659_100464336 Ga0070659_1004643362 109
7 3300005434 Ga0070709_10371305 Ga0070709_103713052 109
8 3300005434 Ga0070709_10739535 Ga0070709_107395351 109
9 3300005434 Ga0070709_10772872 Ga0070709_107728722 109
10 3300005434 Ga0070709_10862200 Ga0070709_108622001 109
11 3300005435 Ga0070714_100009855 Ga0070714_1000098554 109
12 3300005435 Ga0070714_100377732 Ga0070714_1003777322 109
13 3300005435 Ga0070714_102064895 Ga0070714_1020648951 109
14 3300005436 Ga0070713_100003320 Ga0070713_1000033203 109
15 3300005436 Ga0070713_100283896 Ga0070713_1002838962 109
16 3300005436 Ga0070713_101028831 Ga0070713_1010288312 109
17 3300005441 Ga0070700_100922736 Ga0070700_1009227361 109
18 3300005458 Ga0070681_10002165 Ga0070681_1000216512 109
19 3300005458 Ga0070681_10005958 Ga0070681_100059588 109
20 3300005458 Ga0070681_11219223 Ga0070681_112192231 109
21 3300005518 Ga0070699_100092440 Ga0070699_1000924403 109
22 3300005530 Ga0070679_100000549 Ga0070679_1000005498 109
23 3300005530 Ga0070679_100093409 Ga0070679_1000934093 109
24 3300005545 Ga0070695_100274433 Ga0070695_1002744331 109
25 3300005547 Ga0070693_100773639 Ga0070693_1007736391 109
26 3300005563 Ga0068855_100025873 Ga0068855_1000258738 109
27 3300005578 Ga0068854_100049886 Ga0068854_1000498862 109
28 3300005614 Ga0068856_100000956 Ga0068856_10000095623 109
29 3300005614 Ga0068856_100288347 Ga0068856_1002883473 109
30 3300005834 Ga0068851_10727756 Ga0068851_107277561 109
31 3300006028 Ga0070717_10043049 Ga0070717_100430492 109
32 3300006028 Ga0070717_10102696 Ga0070717_101026961 109
33 3300006163 Ga0070715_10387723 Ga0070715_103877232 109
34 3300006163 Ga0070715_10427742 Ga0070715_104277421 109
35 3300006173 Ga0070716_100015357 Ga0070716_1000153571 109
36 3300006173 Ga0070716_100250397 Ga0070716_1002503972 109
37 3300006173 Ga0070716_100924093 Ga0070716_1009240932 109
38 3300006175 Ga0070712_101985994 Ga0070712_1019859942 109
39 3300006358 Ga0068871_100601972 Ga0068871_1006019722 109
40 3300006358 Ga0068871_101307152 Ga0068871_1013071522 109
41 3300006852 Ga0075433_10001321 Ga0075433_1000132111 109
42 3300006871 Ga0075434_100002762 Ga0075434_1000027625 109
43 3300006914 Ga0075436_100002924 Ga0075436_1000029246 109
44 3300006914 Ga0075436_100254713 Ga0075436_1002547132 109
45 3300006914 Ga0075436_100283051 Ga0075436_1002830512 109
46 3300006914 Ga0075436_100466795 Ga0075436_1004667951 109
47 3300007076 Ga0075435_100003372 Ga0075435_1000033727 109
48 3300007076 Ga0075435_101074932 Ga0075435_1010749322 109
49 3300007265 Ga0099794_10003714 Ga0099794_100037144 109
50 3300007265 Ga0099794_10004952 Ga0099794_100049525 109
51 3300007265 Ga0099794_10006361 Ga0099794_100063615 109
52 3300007265 Ga0099794_10011288 Ga0099794_100112882 109
53 3300009093 Ga0105240_10002660 Ga0105240_1000266014 109
54 3300009093 Ga0105240_10016211 Ga0105240_100162113 109
55 3300009093 Ga0105240_10258943 Ga0105240_102589432 109
56 3300009147 Ga0114129_10500894 Ga0114129_105008942 109
57 3300009174 Ga0105241_10000668 Ga0105241_100006688 109
58 3300009174 Ga0105241_10048328 Ga0105241_100483282 109
59 3300009174 Ga0105241_10861477 Ga0105241_108614771 109
60 3300009545 Ga0105237_10144217 Ga0105237_101442173 109
61 3300009545 Ga0105237_10862485 Ga0105237_108624852 109
62 3300011119 Ga0105246_12585540 Ga0105246_125855401 109
63 3300013100 Ga0157373_10127792 Ga0157373_101277922 109
64 3300013102 Ga0157371_10771459 Ga0157371_107714592 109
65 3300013104 Ga0157370_10000831 Ga0157370_1000083112 109
66 3300013105 Ga0157369_10273278 Ga0157369_102732783 109
67 3300013296 Ga0157374_10350958 Ga0157374_103509582 109
68 3300013307 Ga0157372_10013328 Ga0157372_100133287 109
69 3300013307 Ga0157372_10024969 Ga0157372_100249694 109
70 3300013307 Ga0157372_10164746 Ga0157372_101647462 109
71 3300013307 Ga0157372_10901387 Ga0157372_109013872 109
72 3300013308 Ga0157375_10145597 Ga0157375_101455972 109
73 3300014969 Ga0157376_10524138 Ga0157376_105241382 109
74 3300015265 Ga0182005_1092343 Ga0182005_10923431 109
75 3300021358 Ga0213873_10077927 Ga0213873_100779272 109
76 3300021377 Ga0213874_10028473 Ga0213874_100284732 109
77 3300021384 Ga0213876_10260191 Ga0213876_102601911 109
78 3300025905 Ga0207685_10650265 Ga0207685_106502651 109
79 3300025906 Ga0207699_10403818 Ga0207699_104038182 109
80 3300025906 Ga0207699_10438828 Ga0207699_104388282 109
81 3300025906 Ga0207699_10564218 Ga0207699_105642182 109
82 3300025906 Ga0207699_10710545 Ga0207699_107105452 109
83 3300025911 Ga0207654_10000168 Ga0207654_100001689 109
84 3300025911 Ga0207654_10088838 Ga0207654_100888382 109
85 3300025911 Ga0207654_10179618 Ga0207654_101796183 109
86 3300025911 Ga0207654_10614172 Ga0207654_106141721 109
87 3300025912 Ga0207707_10000117 Ga0207707_1000011741 109
88 3300025912 Ga0207707_10002300 Ga0207707_1000230013 109
89 3300025912 Ga0207707_10935754 Ga0207707_109357542 109
90 3300025913 Ga0207695_10006345 Ga0207695_100063457 109
91 3300025913 Ga0207695_10009628 Ga0207695_100096288 109
92 3300025913 Ga0207695_10013999 Ga0207695_100139992 109
93 3300025913 Ga0207695_10112914 Ga0207695_101129142 109
94 3300025914 Ga0207671_10190952 Ga0207671_101909522 109
95 3300025914 Ga0207671_10527392 Ga0207671_105273922 109
96 3300025917 Ga0207660_10001028 Ga0207660_100010288 109
97 3300025919 Ga0207657_10290195 Ga0207657_102901952 109
98 3300025921 Ga0207652_10000280 Ga0207652_1000028031 109
99 3300025921 Ga0207652_10489196 Ga0207652_104891962 109
100 3300025924 Ga0207694_10724385 Ga0207694_107243852 109
101 3300025928 Ga0207700_10012468 Ga0207700_100124684 109
102 3300025928 Ga0207700_10297316 Ga0207700_102973162 109
103 3300025928 Ga0207700_10584030 Ga0207700_105840302 109
104 3300025928 Ga0207700_10931831 Ga0207700_109318312 109
105 3300025928 Ga0207700_11086475 Ga0207700_110864752 109
106 3300025928 Ga0207700_11727377 Ga0207700_117273772 109
107 3300025929 Ga0207664_10014923 Ga0207664_100149233 109
108 3300025929 Ga0207664_10063332 Ga0207664_100633322 109
109 3300025929 Ga0207664_10203485 Ga0207664_102034851 109
110 3300025929 Ga0207664_11765651 Ga0207664_117656512 109
111 3300025929 Ga0207664_11997749 Ga0207664_119977492 109
112 3300025932 Ga0207690_11403504 Ga0207690_114035041 109
113 3300025939 Ga0207665_10002739 Ga0207665_100027393 109
114 3300025939 Ga0207665_10057695 Ga0207665_100576952 109
115 3300025939 Ga0207665_10486965 Ga0207665_104869652 109
116 3300025939 Ga0207665_10850642 Ga0207665_108506422 109
117 3300025944 Ga0207661_11406395 Ga0207661_114063951 109
118 3300025949 Ga0207667_10127242 Ga0207667_101272424 109
119 3300025949 Ga0207667_10148623 Ga0207667_101486233 109
120 3300025981 Ga0207640_10205590 Ga0207640_102055902 109
121 3300026041 Ga0207639_10034207 Ga0207639_100342074 109
122 3300026078 Ga0207702_10007807 Ga0207702_100078075 109
123 3300026078 Ga0207702_10031428 Ga0207702_100314284 109
124 3300026078 Ga0207702_10091997 Ga0207702_100919972 109
125 3300026078 Ga0207702_10397205 Ga0207702_103972052 109
126 3300027671 Ga0209588_1001630 Ga0209588_10016302 109
127 3300027671 Ga0209588_1008043 Ga0209588_10080432 109
128 3300027671 Ga0209588_1089146 Ga0209588_10891462 109
129 3300028800 Ga0265338_10085555 Ga0265338_100855552 109
130 3300031852 Ga0307410_10598045 Ga0307410_105980451 109
131 3300032133 Ga0316583_10000120 Ga0316583_100001202 109
132 3300035086 Ga0373934_0037225 Ga0373934_0037225_1232_1573 109
133 3300035111 Ga0373923_0162378 Ga0373923_0162378_415_753 109
134 3300035113 Ga0373936_0148957 Ga0373936_0148957_236_577 109
135 3300035170 Ga0373943_0026942 Ga0373943_0026942_1014_1406 109
136 3300035171 Ga0373946_0028481 Ga0373946_0028481_1198_1536 109
137 3300035172 Ga0373955_0041324 Ga0373955_0041324_349_690 109
138 3300035695 Ga0373927_0079985 Ga0373927_0079985_1058_1396 109
139 3300035695 Ga0373927_0123979 Ga0373927_0123979_754_1092 109
140 3300035695 Ga0373927_0213184 Ga0373927_0213184_879_1217 109
141 3300035725 Ga0373947_0036434 Ga0373947_0036434_415_753 109
142 3300036401 Ga0373937_0102338 Ga0373937_0102338_1977_2318 109
143 3300036401 Ga0373937_1062153 Ga0373937_1062153_349_687 109
144 3300037068 Ga0373925_0000126 Ga0373925_0000126_1592_1930 109
145 3300037068 Ga0373925_0013327 Ga0373925_0013327_4938_5279 109
146 3300037068 Ga0373925_0163326 Ga0373925_0163326_1146_1484 109
147 3300037068 Ga0373925_0449617 Ga0373925_0449617_407_745 109
148 3300039437 Ga0436365_0900246 Ga0436365_0900246_807_1214 109
149 3300039450 Ga0436363_1376765 Ga0436363_1376765_6845_7183 109
150 3300039453 Ga0436362_0649279 Ga0436362_0649279_534_872 109
151 3300044684 Ga0466966_0664870 Ga0466966_0664870_141_479 109
152 3300044694 Ga0466963_0007096 Ga0466963_0007096_3058_3399 109
153 3300044706 Ga0466964_0056781 Ga0466964_0056781_763_1104 109
154 3300044712 Ga0453684_0258312 Ga0453684_0258312_1171_1512 109
155 3300044842 Ga0466957_0066204 Ga0466957_0066204_638_979 109
156 3300045051 Ga0451576_0701619 Ga0451576_0701619_242_574 109
157 3300045976 Ga0466967_2119570 Ga0466967_2119570_61_399 109
158 3300046457 Ga0495590_0097101 Ga0495590_0097101_695_1033 109
159 3300046463 Ga0495653_0720976 Ga0495653_0720976_44_385 109
160 3300046472 Ga0495580_0000247 Ga0495580_0000247_41340_41678 109
161 3300046472 Ga0495580_0002141 Ga0495580_0002141_10568_10906 109
162 3300046473 Ga0495582_0479403 Ga0495582_0479403_59_397 109
163 3300046517 Ga0495630_0295252 Ga0495630_0295252_801_1139 109
164 3300046526 Ga0495666_0222569 Ga0495666_0222569_61_399 109
165 3300046531 Ga0495665_0021300 Ga0495665_0021300_1200_1538 109
166 3300046543 Ga0495645_0766973 Ga0495645_0766973_138_479 109
167 3300047444 Ga0495675_0065357 Ga0495675_0065357_459_800 109
168 3300047472 Ga0495686_0001753 Ga0495686_0001753_7514_7870 109
169 3300048088 Ga0495602_0039600 Ga0495602_0039600_577_918 109
170 3300049661 Ga0501217_110363 Ga0501217_110363_117_449 109
171 3300049674 Ga0501242_060881 Ga0501242_060881_202_534 109
172 3300049688 Ga0501259_001539 Ga0501259_001539_2337_2669 109
173 3300049765 Ga0501268_053592 Ga0501268_053592_76_408 109
174 3300050507 nmdc:mga05p37_398261_c1 nmdc:mga05p37_398261_c1_937_1275 109
175 3300050512 nmdc:mga0n895_2918_c1 nmdc:mga0n895_2918_c1_2431_2769 109
176 3300050513 nmdc:mga0rr50_3866_c1 nmdc:mga0rr50_3866_c1_1361_1699 109
177 3300050513 nmdc:mga0rr50_970849_c1 nmdc:mga0rr50_970849_c1_292_630 109
178 3300050514 nmdc:mga08x19_437084_c1 nmdc:mga08x19_437084_c1_141_473 109
179 3300050514 nmdc:mga08x19_51518_c1 nmdc:mga08x19_51518_c1_1021_1359 109
180 3300050514 nmdc:mga08x19_61403_c1 nmdc:mga08x19_61403_c1_1713_2054 109
181 3300050514 nmdc:mga08x19_698392_c1 nmdc:mga08x19_698392_c1_93_434 109
182 3300050514 nmdc:mga08x19_812_c1 nmdc:mga08x19_812_c1_5691_6029 109
183 3300050514 nmdc:mga08x19_87103_c1 nmdc:mga08x19_87103_c1_421_759 109
184 3300050515 nmdc:mga0a205_6408_c1 nmdc:mga0a205_6408_c1_793_1131 109
185 3300053077 Ga0495601_0644520 Ga0495601_0644520_167_508 109
186 3300061719 Ga0466962_0012484 Ga0466962_0012484_988_1329 109
187 3300004801 Ga0058860_10544046 Ga0058860_105440462 111
188 3300005290 Ga0065712_10254284 Ga0065712_102542842 111
189 3300005330 Ga0070690_100210514 Ga0070690_1002105142 111
190 3300005334 Ga0068869_100010564 Ga0068869_1000105643 111
191 3300005353 Ga0070669_101518746 Ga0070669_1015187461 111
192 3300005367 Ga0070667_100820032 Ga0070667_1008200321 111
193 3300005457 Ga0070662_100289909 Ga0070662_1002899092 111
194 3300005545 Ga0070695_100714635 Ga0070695_1007146351 111
195 3300005547 Ga0070693_100189937 Ga0070693_1001899372 111
196 3300005563 Ga0068855_101000874 Ga0068855_1010008742 111
197 3300005617 Ga0068859_100065946 Ga0068859_1000659462 111
198 3300005841 Ga0068863_100079202 Ga0068863_1000792023 111
199 3300005841 Ga0068863_100116025 Ga0068863_1001160252 111
200 3300005842 Ga0068858_100001952 Ga0068858_10000195212 111
201 3300005843 Ga0068860_100045316 Ga0068860_1000453162 111
202 3300005844 Ga0068862_100509630 Ga0068862_1005096302 111
203 3300006237 Ga0097621_100323149 Ga0097621_1003231492 111
204 3300006237 Ga0097621_100864175 Ga0097621_1008641752 111
205 3300006358 Ga0068871_100193536 Ga0068871_1001935362 111
206 3300006852 Ga0075433_10935529 Ga0075433_109355291 111
207 3300006881 Ga0068865_100205897 Ga0068865_1002058972 111
208 3300006931 Ga0097620_100065947 Ga0097620_1000659472 111
209 3300009093 Ga0105240_11558383 Ga0105240_115583832 111
210 3300009098 Ga0105245_10975838 Ga0105245_109758382 111
211 3300009101 Ga0105247_10355818 Ga0105247_103558181 111
212 3300009174 Ga0105241_10698065 Ga0105241_106980651 111
213 3300009177 Ga0105248_11201920 Ga0105248_112019202 111
214 3300009177 Ga0105248_11597656 Ga0105248_115976562 111
215 3300009545 Ga0105237_10020087 Ga0105237_100200872 111
216 3300009545 Ga0105237_10655865 Ga0105237_106558652 111
217 3300010375 Ga0105239_10165772 Ga0105239_101657723 111
218 3300013296 Ga0157374_10000703 Ga0157374_1000070315 111
219 3300013296 Ga0157374_10387077 Ga0157374_103870772 111
220 3300013297 Ga0157378_10041720 Ga0157378_100417203 111
221 3300013297 Ga0157378_10118999 Ga0157378_101189992 111
222 3300013297 Ga0157378_10186098 Ga0157378_101860982 111
223 3300013297 Ga0157378_12575759 Ga0157378_125757591 111
224 3300013306 Ga0163162_10760191 Ga0163162_107601912 111
225 3300013307 Ga0157372_10422714 Ga0157372_104227142 111
226 3300013307 Ga0157372_11001510 Ga0157372_110015102 111
227 3300013308 Ga0157375_10008044 Ga0157375_100080443 111
228 3300013308 Ga0157375_10335605 Ga0157375_103356053 111
229 3300014745 Ga0157377_10302308 Ga0157377_103023081 111
230 3300014968 Ga0157379_10209395 Ga0157379_102093952 111
231 3300014968 Ga0157379_10578101 Ga0157379_105781012 111
232 3300014969 Ga0157376_10037113 Ga0157376_100371132 111
233 3300025904 Ga0207647_10046869 Ga0207647_100468693 111
234 3300025914 Ga0207671_10651845 Ga0207671_106518451 111
235 3300025923 Ga0207681_11417008 Ga0207681_114170081 111
236 3300025927 Ga0207687_10298661 Ga0207687_102986611 111
237 3300025938 Ga0207704_10199511 Ga0207704_101995112 111
238 3300025941 Ga0207711_10663622 Ga0207711_106636221 111
239 3300025942 Ga0207689_10001777 Ga0207689_1000177714 111
240 3300025949 Ga0207667_11414061 Ga0207667_114140612 111
241 3300026035 Ga0207703_10001169 Ga0207703_1000116911 111
242 3300026035 Ga0207703_11041497 Ga0207703_110414971 111
243 3300026088 Ga0207641_10109936 Ga0207641_101099363 111
244 3300026118 Ga0207675_101591754 Ga0207675_1015917542 111
245 3300028380 Ga0268265_10055510 Ga0268265_100555101 111
246 3300028381 Ga0268264_10012259 Ga0268264_100122596 111
247 3300031727 Ga0316576_10316096 Ga0316576_103160962 111
248 3300032137 Ga0316585_10011122 Ga0316585_100111222 111
249 3300036647 Ga0316582_0063383 Ga0316582_0063383_1300_1677 111
250 3300044712 Ga0453684_0211139 Ga0453684_0211139_1266_1637 111
251 3300048915 Ga0496112_0064440 Ga0496112_0064440_717_1052 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

4

112

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.9001 2 111
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8845 2 111
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8201 1 111
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8135 1 111
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.806 1 111
ID Description Score Start End Superfamily
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8847 2 97 3.30.70.100
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8124 2 97 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8102 1 105 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8028 1 105 3.30.70.100
af_F4JMH8_41_126_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7275 42 61 2.60.40.790
ID Description Score Start End GO Terms
AF-F4C913-F1-model_v4 L-rhamnose mutarotase 1 1 111 GO:0016857
AF-A0A2W0AJ85-F1-model_v4 L-fucose mutarotase 0.9969 2 111 GO:0016857
AF-A0A2V9ZDP5-F1-model_v4 L-fucose mutarotase 0.9967 2 111 GO:0016857
AF-A0A3L9ZP68-F1-model_v4 deleted 0.9952 2 111
AF-A0A3N1JTV7-F1-model_v4 deleted 0.995 1 111

Feature Viewer

pLDDT pTM Quality
94.96 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map