F362262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 148 | 251 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005547|Ga0070693_100189937|Ga0070693_1001899372 |
| Length | 124 |
| Sequence | MTKRYCLTLDLKNDPELIAEYKQYHAAGNAWPEITKSIRDAGILDMEIYLLGTRMFMIMEVNEHFSFEAKSKVDRLNSKVQEWEKLMLKFQQPLPESAPGEKWLLMEKIFKLQVSAEIAELQQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 38 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 67 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 68 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 102 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 103 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 104 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 105 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 106 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 107 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 108 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 113 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 117 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 118 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 119 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 120 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 121 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 138 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 139 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 140 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 141 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 142 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 97.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058860_10544046 | 3300004801 | Bacteria | 866 |
| 2 | Ga0065712_10254284 | 3300005290 | Unclassified | 952 |
| 3 | Ga0070690_100210514 | 3300005330 | Bacteria | 1357 |
| 4 | Ga0068869_100010564 | 3300005334 | Bacteria | 6027 |
| 5 | Ga0070680_100000243 | 3300005336 | Bacteria | 36079 |
| 6 | Ga0070682_100000482 | 3300005337 | Bacteria | 25028 |
| 7 | Ga0070660_100310354 | 3300005339 | Bacteria | 1294 |
| 8 | Ga0070691_10003442 | 3300005341 | Bacteria | 7116 |
| 9 | Ga0070669_101518746 | 3300005353 | Unclassified | 582 |
| 10 | Ga0070659_100464336 | 3300005366 | Bacteria | 1075 |
| 11 | Ga0070667_100820032 | 3300005367 | Unclassified | 864 |
| 12 | Ga0070709_10371305 | 3300005434 | Unclassified | 1061 |
| 13 | Ga0070709_10739535 | 3300005434 | Bacteria | 768 |
| 14 | Ga0070709_10772872 | 3300005434 | Unclassified | 752 |
| 15 | Ga0070709_10862200 | 3300005434 | Bacteria | 714 |
| 16 | Ga0070714_100009855 | 3300005435 | Bacteria | 7531 |
| 17 | Ga0070714_100377732 | 3300005435 | Bacteria | 1335 |
| 18 | Ga0070714_102064895 | 3300005435 | Unclassified | 556 |
| 19 | Ga0070713_100003320 | 3300005436 | Bacteria | 10613 |
| 20 | Ga0070713_100283896 | 3300005436 | Bacteria | 1519 |
| 21 | Ga0070713_101028831 | 3300005436 | Unclassified | 795 |
| 22 | Ga0070700_100922736 | 3300005441 | Unclassified | 712 |
| 23 | Ga0070662_100289909 | 3300005457 | Bacteria | 1327 |
| 24 | Ga0070681_10002165 | 3300005458 | Bacteria | 17876 |
| 25 | Ga0070681_10005958 | 3300005458 | Bacteria | 11801 |
| 26 | Ga0070681_11219223 | 3300005458 | Unclassified | 674 |
| 27 | Ga0070699_100092440 | 3300005518 | Unclassified | 2646 |
| 28 | Ga0070679_100000549 | 3300005530 | Bacteria | 31843 |
| 29 | Ga0070679_100093409 | 3300005530 | Bacteria | 2996 |
| 30 | Ga0070695_100274433 | 3300005545 | Bacteria | 1236 |
| 31 | Ga0070695_100714635 | 3300005545 | Unclassified | 796 |
| 32 | Ga0070693_100189937 | 3300005547 | Bacteria | 1328 |
| 33 | Ga0070693_100773639 | 3300005547 | Bacteria | 709 |
| 34 | Ga0068855_100025873 | 3300005563 | Bacteria | 7018 |
| 35 | Ga0068855_101000874 | 3300005563 | Bacteria | 878 |
| 36 | Ga0068854_100049886 | 3300005578 | Bacteria | 2992 |
| 37 | Ga0068856_100000956 | 3300005614 | Bacteria | 30876 |
| 38 | Ga0068856_100288347 | 3300005614 | Bacteria | 1658 |
| 39 | Ga0068859_100065946 | 3300005617 | Unclassified | 3655 |
| 40 | Ga0068851_10727756 | 3300005834 | Bacteria | 612 |
| 41 | Ga0068863_100079202 | 3300005841 | Unclassified | 3112 |
| 42 | Ga0068863_100116025 | 3300005841 | Bacteria | 2552 |
| 43 | Ga0068858_100001952 | 3300005842 | Bacteria | 21029 |
| 44 | Ga0068860_100045316 | 3300005843 | Unclassified | 4194 |
| 45 | Ga0068862_100509630 | 3300005844 | Bacteria | 1143 |
| 46 | Ga0070717_10043049 | 3300006028 | Unclassified | 3684 |
| 47 | Ga0070717_10102696 | 3300006028 | Bacteria | 2429 |
| 48 | Ga0070715_10387723 | 3300006163 | Unclassified | 773 |
| 49 | Ga0070715_10427742 | 3300006163 | Bacteria | 742 |
| 50 | Ga0070716_100015357 | 3300006173 | Bacteria | 3933 |
| 51 | Ga0070716_100250397 | 3300006173 | Bacteria | 1206 |
| 52 | Ga0070716_100924093 | 3300006173 | Unclassified | 685 |
| 53 | Ga0070712_101985994 | 3300006175 | Bacteria | 509 |
| 54 | Ga0097621_100323149 | 3300006237 | Unclassified | 1367 |
| 55 | Ga0097621_100864175 | 3300006237 | Unclassified | 841 |
| 56 | Ga0068871_100193536 | 3300006358 | Bacteria | 1753 |
| 57 | Ga0068871_100601972 | 3300006358 | Bacteria | 1000 |
| 58 | Ga0068871_101307152 | 3300006358 | Unclassified | 682 |
| 59 | Ga0075433_10001321 | 3300006852 | Bacteria | 18136 |
| 60 | Ga0075433_10935529 | 3300006852 | Unclassified | 756 |
| 61 | Ga0075434_100002762 | 3300006871 | Bacteria | 15529 |
| 62 | Ga0068865_100205897 | 3300006881 | Unclassified | 1530 |
| 63 | Ga0075436_100002924 | 3300006914 | Bacteria | 11713 |
| 64 | Ga0075436_100254713 | 3300006914 | Bacteria | 1251 |
| 65 | Ga0075436_100283051 | 3300006914 | Unclassified | 1186 |
| 66 | Ga0075436_100466795 | 3300006914 | Unclassified | 920 |
| 67 | Ga0097620_100065947 | 3300006931 | Unclassified | 3655 |
| 68 | Ga0075435_100003372 | 3300007076 | Bacteria | 10833 |
| 69 | Ga0075435_101074932 | 3300007076 | Bacteria | 703 |
| 70 | Ga0099794_10003714 | 3300007265 | Bacteria | 5875 |
| 71 | Ga0099794_10004952 | 3300007265 | Bacteria | 5296 |
| 72 | Ga0099794_10006361 | 3300007265 | Bacteria | 4778 |
| 73 | Ga0099794_10011288 | 3300007265 | Unclassified | 3819 |
| 74 | Ga0105240_10002660 | 3300009093 | Bacteria | 28423 |
| 75 | Ga0105240_10016211 | 3300009093 | Bacteria | 10097 |
| 76 | Ga0105240_10258943 | 3300009093 | Bacteria | 2008 |
| 77 | Ga0105240_11558383 | 3300009093 | Unclassified | 692 |
| 78 | Ga0105245_10975838 | 3300009098 | Unclassified | 891 |
| 79 | Ga0105247_10355818 | 3300009101 | Bacteria | 1031 |
| 80 | Ga0114129_10500894 | 3300009147 | Unclassified | 1586 |
| 81 | Ga0105241_10000668 | 3300009174 | Bacteria | 25809 |
| 82 | Ga0105241_10048328 | 3300009174 | Bacteria | 3237 |
| 83 | Ga0105241_10698065 | 3300009174 | Unclassified | 926 |
| 84 | Ga0105241_10861477 | 3300009174 | Unclassified | 839 |
| 85 | Ga0105248_11201920 | 3300009177 | Bacteria | 857 |
| 86 | Ga0105248_11597656 | 3300009177 | Unclassified | 739 |
| 87 | Ga0105237_10020087 | 3300009545 | Bacteria | 6896 |
| 88 | Ga0105237_10144217 | 3300009545 | Bacteria | 2376 |
| 89 | Ga0105237_10655865 | 3300009545 | Unclassified | 1056 |
| 90 | Ga0105237_10862485 | 3300009545 | Bacteria | 912 |
| 91 | Ga0105239_10165772 | 3300010375 | Unclassified | 2470 |
| 92 | Ga0105246_12585540 | 3300011119 | Unclassified | 501 |
| 93 | Ga0157373_10127792 | 3300013100 | Bacteria | 1787 |
| 94 | Ga0157371_10771459 | 3300013102 | Bacteria | 723 |
| 95 | Ga0157370_10000831 | 3300013104 | Bacteria | 39105 |
| 96 | Ga0157369_10273278 | 3300013105 | Bacteria | 1761 |
| 97 | Ga0157374_10000703 | 3300013296 | Bacteria | 29400 |
| 98 | Ga0157374_10350958 | 3300013296 | Bacteria | 1466 |
| 99 | Ga0157374_10387077 | 3300013296 | Bacteria | 1393 |
| 100 | Ga0157378_10041720 | 3300013297 | Unclassified | 4071 |
| 101 | Ga0157378_10118999 | 3300013297 | Unclassified | 2432 |
| 102 | Ga0157378_10186098 | 3300013297 | Bacteria | 1956 |
| 103 | Ga0157378_12575759 | 3300013297 | Unclassified | 561 |
| 104 | Ga0163162_10760191 | 3300013306 | Unclassified | 1088 |
| 105 | Ga0157372_10013328 | 3300013307 | Bacteria | 8776 |
| 106 | Ga0157372_10024969 | 3300013307 | Bacteria | 6495 |
| 107 | Ga0157372_10164746 | 3300013307 | Bacteria | 2563 |
| 108 | Ga0157372_10422714 | 3300013307 | Bacteria | 1553 |
| 109 | Ga0157372_10901387 | 3300013307 | Unclassified | 1026 |
| 110 | Ga0157372_11001510 | 3300013307 | Unclassified | 968 |
| 111 | Ga0157375_10008044 | 3300013308 | Bacteria | 9231 |
| 112 | Ga0157375_10145597 | 3300013308 | Bacteria | 2500 |
| 113 | Ga0157375_10335605 | 3300013308 | Bacteria | 1677 |
| 114 | Ga0157377_10302308 | 3300014745 | Bacteria | 1056 |
| 115 | Ga0157379_10209395 | 3300014968 | Bacteria | 1765 |
| 116 | Ga0157379_10578101 | 3300014968 | Bacteria | 1047 |
| 117 | Ga0157376_10037113 | 3300014969 | Bacteria | 3952 |
| 118 | Ga0157376_10524138 | 3300014969 | Unclassified | 1168 |
| 119 | Ga0182005_1092343 | 3300015265 | Unclassified | 842 |
| 120 | Ga0213873_10077927 | 3300021358 | Bacteria | 923 |
| 121 | Ga0213874_10028473 | 3300021377 | Bacteria | 1596 |
| 122 | Ga0213876_10260191 | 3300021384 | Unclassified | 922 |
| 123 | Ga0207647_10046869 | 3300025904 | Bacteria | 2691 |
| 124 | Ga0207685_10650265 | 3300025905 | Unclassified | 570 |
| 125 | Ga0207699_10403818 | 3300025906 | Bacteria | 973 |
| 126 | Ga0207699_10438828 | 3300025906 | Bacteria | 935 |
| 127 | Ga0207699_10564218 | 3300025906 | Bacteria | 827 |
| 128 | Ga0207699_10710545 | 3300025906 | Bacteria | 736 |
| 129 | Ga0207654_10000168 | 3300025911 | Bacteria | 41625 |
| 130 | Ga0207654_10088838 | 3300025911 | Bacteria | 1879 |
| 131 | Ga0207654_10179618 | 3300025911 | Bacteria | 1380 |
| 132 | Ga0207654_10614172 | 3300025911 | Bacteria | 777 |
| 133 | Ga0207707_10000117 | 3300025912 | Bacteria | 80929 |
| 134 | Ga0207707_10002300 | 3300025912 | Bacteria | 17227 |
| 135 | Ga0207707_10935754 | 3300025912 | Bacteria | 715 |
| 136 | Ga0207695_10006345 | 3300025913 | Bacteria | 15383 |
| 137 | Ga0207695_10009628 | 3300025913 | Bacteria | 11922 |
| 138 | Ga0207695_10013999 | 3300025913 | Bacteria | 9526 |
| 139 | Ga0207695_10112914 | 3300025913 | Unclassified | 2694 |
| 140 | Ga0207671_10190952 | 3300025914 | Bacteria | 1597 |
| 141 | Ga0207671_10527392 | 3300025914 | Bacteria | 942 |
| 142 | Ga0207671_10651845 | 3300025914 | Unclassified | 838 |
| 143 | Ga0207660_10001028 | 3300025917 | Bacteria | 18473 |
| 144 | Ga0207657_10290195 | 3300025919 | Bacteria | 1297 |
| 145 | Ga0207652_10000280 | 3300025921 | Bacteria | 53021 |
| 146 | Ga0207652_10489196 | 3300025921 | Bacteria | 1108 |
| 147 | Ga0207681_11417008 | 3300025923 | Unclassified | 583 |
| 148 | Ga0207694_10724385 | 3300025924 | Unclassified | 839 |
| 149 | Ga0207687_10298661 | 3300025927 | Bacteria | 1297 |
| 150 | Ga0207700_10012468 | 3300025928 | Bacteria | 5484 |
| 151 | Ga0207700_10297316 | 3300025928 | Bacteria | 1393 |
| 152 | Ga0207700_10584030 | 3300025928 | Bacteria | 994 |
| 153 | Ga0207700_10931831 | 3300025928 | Bacteria | 777 |
| 154 | Ga0207700_11086475 | 3300025928 | Bacteria | 715 |
| 155 | Ga0207700_11727377 | 3300025928 | Unclassified | 551 |
| 156 | Ga0207664_10014923 | 3300025929 | Bacteria | 5624 |
| 157 | Ga0207664_10063332 | 3300025929 | Bacteria | 2955 |
| 158 | Ga0207664_10203485 | 3300025929 | Bacteria | 1710 |
| 159 | Ga0207664_11765651 | 3300025929 | Bacteria | 541 |
| 160 | Ga0207664_11997749 | 3300025929 | Bacteria | 503 |
| 161 | Ga0207690_11403504 | 3300025932 | Bacteria | 584 |
| 162 | Ga0207704_10199511 | 3300025938 | Unclassified | 1463 |
| 163 | Ga0207665_10002739 | 3300025939 | Bacteria | 11819 |
| 164 | Ga0207665_10057695 | 3300025939 | Bacteria | 2623 |
| 165 | Ga0207665_10486965 | 3300025939 | Bacteria | 951 |
| 166 | Ga0207665_10850642 | 3300025939 | Unclassified | 722 |
| 167 | Ga0207711_10663622 | 3300025941 | Unclassified | 973 |
| 168 | Ga0207689_10001777 | 3300025942 | Bacteria | 20357 |
| 169 | Ga0207661_11406395 | 3300025944 | Bacteria | 640 |
| 170 | Ga0207667_10127242 | 3300025949 | Unclassified | 2624 |
| 171 | Ga0207667_10148623 | 3300025949 | Bacteria | 2412 |
| 172 | Ga0207667_11414061 | 3300025949 | Unclassified | 669 |
| 173 | Ga0207640_10205590 | 3300025981 | Bacteria | 1496 |
| 174 | Ga0207703_10001169 | 3300026035 | Bacteria | 24781 |
| 175 | Ga0207703_10052823 | 3300026035 | Unclassified | 3302 |
| 176 | Ga0207703_11041497 | 3300026035 | Unclassified | 785 |
| 177 | Ga0207639_10034207 | 3300026041 | Bacteria | 3754 |
| 178 | Ga0207702_10007807 | 3300026078 | Bacteria | 9080 |
| 179 | Ga0207702_10031428 | 3300026078 | Bacteria | 4425 |
| 180 | Ga0207702_10091997 | 3300026078 | Bacteria | 2657 |
| 181 | Ga0207702_10397205 | 3300026078 | Bacteria | 1329 |
| 182 | Ga0207641_10109936 | 3300026088 | Bacteria | 2442 |
| 183 | Ga0207675_101591754 | 3300026118 | Unclassified | 674 |
| 184 | Ga0209588_1001630 | 3300027671 | Bacteria | 5900 |
| 185 | Ga0209588_1008043 | 3300027671 | Unclassified | 3121 |
| 186 | Ga0209588_1089146 | 3300027671 | Bacteria | 994 |
| 187 | Ga0268265_10055510 | 3300028380 | Unclassified | 3010 |
| 188 | Ga0268264_10012259 | 3300028381 | Bacteria | 7051 |
| 189 | Ga0265338_10085555 | 3300028800 | Bacteria | 2628 |
| 190 | Ga0316576_10316096 | 3300031727 | Bacteria | 1165 |
| 191 | Ga0307410_10598045 | 3300031852 | Unclassified | 920 |
| 192 | Ga0316583_10000120 | 3300032133 | Bacteria | 18362 |
| 193 | Ga0316585_10011122 | 3300032137 | Bacteria | 2649 |
| 194 | Ga0373934_0037225 | 3300035086 | Bacteria | 1916 |
| 195 | Ga0373923_0162378 | 3300035111 | Bacteria | 1020 |
| 196 | Ga0373936_0148957 | 3300035113 | Unclassified | 1014 |
| 197 | Ga0373943_0026942 | 3300035170 | Bacteria | 2697 |
| 198 | Ga0373946_0028481 | 3300035171 | Bacteria | 2216 |
| 199 | Ga0373955_0041324 | 3300035172 | Bacteria | 2471 |
| 200 | Ga0373927_0079985 | 3300035695 | Unclassified | 2118 |
| 201 | Ga0373927_0123979 | 3300035695 | Bacteria | 1686 |
| 202 | Ga0373927_0213184 | 3300035695 | Bacteria | 1269 |
| 203 | Ga0373947_0036434 | 3300035725 | Bacteria | 2917 |
| 204 | Ga0373937_0102338 | 3300036401 | Unclassified | 2659 |
| 205 | Ga0373937_1062153 | 3300036401 | Unclassified | 759 |
| 206 | Ga0316582_0063383 | 3300036647 | Bacteria | 2375 |
| 207 | Ga0373925_0000126 | 3300037068 | Bacteria | 82922 |
| 208 | Ga0373925_0013327 | 3300037068 | Bacteria | 5949 |
| 209 | Ga0373925_0163326 | 3300037068 | Bacteria | 1755 |
| 210 | Ga0373925_0449617 | 3300037068 | Unclassified | 1055 |
| 211 | Ga0436365_0900246 | 3300039437 | Unclassified | 1237 |
| 212 | Ga0436363_1376765 | 3300039450 | Bacteria | 8238 |
| 213 | Ga0436362_0649279 | 3300039453 | Bacteria | 1052 |
| 214 | Ga0466966_0664870 | 3300044684 | Bacteria | 628 |
| 215 | Ga0466963_0007096 | 3300044694 | Bacteria | 6673 |
| 216 | Ga0466964_0056781 | 3300044706 | Bacteria | 1619 |
| 217 | Ga0453684_0211139 | 3300044712 | Bacteria | 2256 |
| 218 | Ga0453684_0258312 | 3300044712 | Bacteria | 1997 |
| 219 | Ga0466957_0066204 | 3300044842 | Bacteria | 2227 |
| 220 | Ga0451576_0701619 | 3300045051 | Unclassified | 1063 |
| 221 | Ga0466967_2119570 | 3300045976 | Bacteria | 558 |
| 222 | Ga0495590_0097101 | 3300046457 | Unclassified | 1045 |
| 223 | Ga0495653_0720976 | 3300046463 | Unclassified | 604 |
| 224 | Ga0495580_0000247 | 3300046472 | Bacteria | 42646 |
| 225 | Ga0495580_0002141 | 3300046472 | Bacteria | 17324 |
| 226 | Ga0495582_0479403 | 3300046473 | Bacteria | 719 |
| 227 | Ga0495630_0295252 | 3300046517 | Bacteria | 1238 |
| 228 | Ga0495666_0222569 | 3300046526 | Bacteria | 864 |
| 229 | Ga0495665_0021300 | 3300046531 | Bacteria | 3482 |
| 230 | Ga0495645_0766973 | 3300046543 | Unclassified | 581 |
| 231 | Ga0495675_0065357 | 3300047444 | Bacteria | 2301 |
| 232 | Ga0495686_0001753 | 3300047472 | Bacteria | 22261 |
| 233 | Ga0495602_0039600 | 3300048088 | Bacteria | 4338 |
| 234 | Ga0496112_0064440 | 3300048915 | Unclassified | 3616 |
| 235 | Ga0501217_110363 | 3300049661 | Unclassified | 790 |
| 236 | Ga0501242_060881 | 3300049674 | Unclassified | 574 |
| 237 | Ga0501259_001539 | 3300049688 | Bacteria | 3836 |
| 238 | Ga0501268_053592 | 3300049765 | Unclassified | 785 |
| 239 | nmdc:mga05p37_398261_c1 | 3300050507 | Unclassified | 1608 |
| 240 | nmdc:mga0n895_2918_c1 | 3300050512 | Bacteria | 13551 |
| 241 | nmdc:mga0rr50_3866_c1 | 3300050513 | Bacteria | 8710 |
| 242 | nmdc:mga0rr50_970849_c1 | 3300050513 | Bacteria | 724 |
| 243 | nmdc:mga08x19_437084_c1 | 3300050514 | Unclassified | 920 |
| 244 | nmdc:mga08x19_51518_c1 | 3300050514 | Unclassified | 2645 |
| 245 | nmdc:mga08x19_61403_c1 | 3300050514 | Bacteria | 2435 |
| 246 | nmdc:mga08x19_698392_c1 | 3300050514 | Bacteria | 720 |
| 247 | nmdc:mga08x19_812_c1 | 3300050514 | Bacteria | 19830 |
| 248 | nmdc:mga08x19_87103_c1 | 3300050514 | Bacteria | 2057 |
| 249 | nmdc:mga0a205_6408_c1 | 3300050515 | Bacteria | 10634 |
| 250 | Ga0495601_0644520 | 3300053077 | Unclassified | 678 |
| 251 | Ga0466962_0012484 | 3300061719 | Bacteria | 4084 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026035 | Ga0207703_10052823 | Ga0207703_100528232 | 107 |
| 2 | 3300005336 | Ga0070680_100000243 | Ga0070680_1000002438 | 109 |
| 3 | 3300005337 | Ga0070682_100000482 | Ga0070682_1000004829 | 109 |
| 4 | 3300005339 | Ga0070660_100310354 | Ga0070660_1003103542 | 109 |
| 5 | 3300005341 | Ga0070691_10003442 | Ga0070691_100034427 | 109 |
| 6 | 3300005366 | Ga0070659_100464336 | Ga0070659_1004643362 | 109 |
| 7 | 3300005434 | Ga0070709_10371305 | Ga0070709_103713052 | 109 |
| 8 | 3300005434 | Ga0070709_10739535 | Ga0070709_107395351 | 109 |
| 9 | 3300005434 | Ga0070709_10772872 | Ga0070709_107728722 | 109 |
| 10 | 3300005434 | Ga0070709_10862200 | Ga0070709_108622001 | 109 |
| 11 | 3300005435 | Ga0070714_100009855 | Ga0070714_1000098554 | 109 |
| 12 | 3300005435 | Ga0070714_100377732 | Ga0070714_1003777322 | 109 |
| 13 | 3300005435 | Ga0070714_102064895 | Ga0070714_1020648951 | 109 |
| 14 | 3300005436 | Ga0070713_100003320 | Ga0070713_1000033203 | 109 |
| 15 | 3300005436 | Ga0070713_100283896 | Ga0070713_1002838962 | 109 |
| 16 | 3300005436 | Ga0070713_101028831 | Ga0070713_1010288312 | 109 |
| 17 | 3300005441 | Ga0070700_100922736 | Ga0070700_1009227361 | 109 |
| 18 | 3300005458 | Ga0070681_10002165 | Ga0070681_1000216512 | 109 |
| 19 | 3300005458 | Ga0070681_10005958 | Ga0070681_100059588 | 109 |
| 20 | 3300005458 | Ga0070681_11219223 | Ga0070681_112192231 | 109 |
| 21 | 3300005518 | Ga0070699_100092440 | Ga0070699_1000924403 | 109 |
| 22 | 3300005530 | Ga0070679_100000549 | Ga0070679_1000005498 | 109 |
| 23 | 3300005530 | Ga0070679_100093409 | Ga0070679_1000934093 | 109 |
| 24 | 3300005545 | Ga0070695_100274433 | Ga0070695_1002744331 | 109 |
| 25 | 3300005547 | Ga0070693_100773639 | Ga0070693_1007736391 | 109 |
| 26 | 3300005563 | Ga0068855_100025873 | Ga0068855_1000258738 | 109 |
| 27 | 3300005578 | Ga0068854_100049886 | Ga0068854_1000498862 | 109 |
| 28 | 3300005614 | Ga0068856_100000956 | Ga0068856_10000095623 | 109 |
| 29 | 3300005614 | Ga0068856_100288347 | Ga0068856_1002883473 | 109 |
| 30 | 3300005834 | Ga0068851_10727756 | Ga0068851_107277561 | 109 |
| 31 | 3300006028 | Ga0070717_10043049 | Ga0070717_100430492 | 109 |
| 32 | 3300006028 | Ga0070717_10102696 | Ga0070717_101026961 | 109 |
| 33 | 3300006163 | Ga0070715_10387723 | Ga0070715_103877232 | 109 |
| 34 | 3300006163 | Ga0070715_10427742 | Ga0070715_104277421 | 109 |
| 35 | 3300006173 | Ga0070716_100015357 | Ga0070716_1000153571 | 109 |
| 36 | 3300006173 | Ga0070716_100250397 | Ga0070716_1002503972 | 109 |
| 37 | 3300006173 | Ga0070716_100924093 | Ga0070716_1009240932 | 109 |
| 38 | 3300006175 | Ga0070712_101985994 | Ga0070712_1019859942 | 109 |
| 39 | 3300006358 | Ga0068871_100601972 | Ga0068871_1006019722 | 109 |
| 40 | 3300006358 | Ga0068871_101307152 | Ga0068871_1013071522 | 109 |
| 41 | 3300006852 | Ga0075433_10001321 | Ga0075433_1000132111 | 109 |
| 42 | 3300006871 | Ga0075434_100002762 | Ga0075434_1000027625 | 109 |
| 43 | 3300006914 | Ga0075436_100002924 | Ga0075436_1000029246 | 109 |
| 44 | 3300006914 | Ga0075436_100254713 | Ga0075436_1002547132 | 109 |
| 45 | 3300006914 | Ga0075436_100283051 | Ga0075436_1002830512 | 109 |
| 46 | 3300006914 | Ga0075436_100466795 | Ga0075436_1004667951 | 109 |
| 47 | 3300007076 | Ga0075435_100003372 | Ga0075435_1000033727 | 109 |
| 48 | 3300007076 | Ga0075435_101074932 | Ga0075435_1010749322 | 109 |
| 49 | 3300007265 | Ga0099794_10003714 | Ga0099794_100037144 | 109 |
| 50 | 3300007265 | Ga0099794_10004952 | Ga0099794_100049525 | 109 |
| 51 | 3300007265 | Ga0099794_10006361 | Ga0099794_100063615 | 109 |
| 52 | 3300007265 | Ga0099794_10011288 | Ga0099794_100112882 | 109 |
| 53 | 3300009093 | Ga0105240_10002660 | Ga0105240_1000266014 | 109 |
| 54 | 3300009093 | Ga0105240_10016211 | Ga0105240_100162113 | 109 |
| 55 | 3300009093 | Ga0105240_10258943 | Ga0105240_102589432 | 109 |
| 56 | 3300009147 | Ga0114129_10500894 | Ga0114129_105008942 | 109 |
| 57 | 3300009174 | Ga0105241_10000668 | Ga0105241_100006688 | 109 |
| 58 | 3300009174 | Ga0105241_10048328 | Ga0105241_100483282 | 109 |
| 59 | 3300009174 | Ga0105241_10861477 | Ga0105241_108614771 | 109 |
| 60 | 3300009545 | Ga0105237_10144217 | Ga0105237_101442173 | 109 |
| 61 | 3300009545 | Ga0105237_10862485 | Ga0105237_108624852 | 109 |
| 62 | 3300011119 | Ga0105246_12585540 | Ga0105246_125855401 | 109 |
| 63 | 3300013100 | Ga0157373_10127792 | Ga0157373_101277922 | 109 |
| 64 | 3300013102 | Ga0157371_10771459 | Ga0157371_107714592 | 109 |
| 65 | 3300013104 | Ga0157370_10000831 | Ga0157370_1000083112 | 109 |
| 66 | 3300013105 | Ga0157369_10273278 | Ga0157369_102732783 | 109 |
| 67 | 3300013296 | Ga0157374_10350958 | Ga0157374_103509582 | 109 |
| 68 | 3300013307 | Ga0157372_10013328 | Ga0157372_100133287 | 109 |
| 69 | 3300013307 | Ga0157372_10024969 | Ga0157372_100249694 | 109 |
| 70 | 3300013307 | Ga0157372_10164746 | Ga0157372_101647462 | 109 |
| 71 | 3300013307 | Ga0157372_10901387 | Ga0157372_109013872 | 109 |
| 72 | 3300013308 | Ga0157375_10145597 | Ga0157375_101455972 | 109 |
| 73 | 3300014969 | Ga0157376_10524138 | Ga0157376_105241382 | 109 |
| 74 | 3300015265 | Ga0182005_1092343 | Ga0182005_10923431 | 109 |
| 75 | 3300021358 | Ga0213873_10077927 | Ga0213873_100779272 | 109 |
| 76 | 3300021377 | Ga0213874_10028473 | Ga0213874_100284732 | 109 |
| 77 | 3300021384 | Ga0213876_10260191 | Ga0213876_102601911 | 109 |
| 78 | 3300025905 | Ga0207685_10650265 | Ga0207685_106502651 | 109 |
| 79 | 3300025906 | Ga0207699_10403818 | Ga0207699_104038182 | 109 |
| 80 | 3300025906 | Ga0207699_10438828 | Ga0207699_104388282 | 109 |
| 81 | 3300025906 | Ga0207699_10564218 | Ga0207699_105642182 | 109 |
| 82 | 3300025906 | Ga0207699_10710545 | Ga0207699_107105452 | 109 |
| 83 | 3300025911 | Ga0207654_10000168 | Ga0207654_100001689 | 109 |
| 84 | 3300025911 | Ga0207654_10088838 | Ga0207654_100888382 | 109 |
| 85 | 3300025911 | Ga0207654_10179618 | Ga0207654_101796183 | 109 |
| 86 | 3300025911 | Ga0207654_10614172 | Ga0207654_106141721 | 109 |
| 87 | 3300025912 | Ga0207707_10000117 | Ga0207707_1000011741 | 109 |
| 88 | 3300025912 | Ga0207707_10002300 | Ga0207707_1000230013 | 109 |
| 89 | 3300025912 | Ga0207707_10935754 | Ga0207707_109357542 | 109 |
| 90 | 3300025913 | Ga0207695_10006345 | Ga0207695_100063457 | 109 |
| 91 | 3300025913 | Ga0207695_10009628 | Ga0207695_100096288 | 109 |
| 92 | 3300025913 | Ga0207695_10013999 | Ga0207695_100139992 | 109 |
| 93 | 3300025913 | Ga0207695_10112914 | Ga0207695_101129142 | 109 |
| 94 | 3300025914 | Ga0207671_10190952 | Ga0207671_101909522 | 109 |
| 95 | 3300025914 | Ga0207671_10527392 | Ga0207671_105273922 | 109 |
| 96 | 3300025917 | Ga0207660_10001028 | Ga0207660_100010288 | 109 |
| 97 | 3300025919 | Ga0207657_10290195 | Ga0207657_102901952 | 109 |
| 98 | 3300025921 | Ga0207652_10000280 | Ga0207652_1000028031 | 109 |
| 99 | 3300025921 | Ga0207652_10489196 | Ga0207652_104891962 | 109 |
| 100 | 3300025924 | Ga0207694_10724385 | Ga0207694_107243852 | 109 |
| 101 | 3300025928 | Ga0207700_10012468 | Ga0207700_100124684 | 109 |
| 102 | 3300025928 | Ga0207700_10297316 | Ga0207700_102973162 | 109 |
| 103 | 3300025928 | Ga0207700_10584030 | Ga0207700_105840302 | 109 |
| 104 | 3300025928 | Ga0207700_10931831 | Ga0207700_109318312 | 109 |
| 105 | 3300025928 | Ga0207700_11086475 | Ga0207700_110864752 | 109 |
| 106 | 3300025928 | Ga0207700_11727377 | Ga0207700_117273772 | 109 |
| 107 | 3300025929 | Ga0207664_10014923 | Ga0207664_100149233 | 109 |
| 108 | 3300025929 | Ga0207664_10063332 | Ga0207664_100633322 | 109 |
| 109 | 3300025929 | Ga0207664_10203485 | Ga0207664_102034851 | 109 |
| 110 | 3300025929 | Ga0207664_11765651 | Ga0207664_117656512 | 109 |
| 111 | 3300025929 | Ga0207664_11997749 | Ga0207664_119977492 | 109 |
| 112 | 3300025932 | Ga0207690_11403504 | Ga0207690_114035041 | 109 |
| 113 | 3300025939 | Ga0207665_10002739 | Ga0207665_100027393 | 109 |
| 114 | 3300025939 | Ga0207665_10057695 | Ga0207665_100576952 | 109 |
| 115 | 3300025939 | Ga0207665_10486965 | Ga0207665_104869652 | 109 |
| 116 | 3300025939 | Ga0207665_10850642 | Ga0207665_108506422 | 109 |
| 117 | 3300025944 | Ga0207661_11406395 | Ga0207661_114063951 | 109 |
| 118 | 3300025949 | Ga0207667_10127242 | Ga0207667_101272424 | 109 |
| 119 | 3300025949 | Ga0207667_10148623 | Ga0207667_101486233 | 109 |
| 120 | 3300025981 | Ga0207640_10205590 | Ga0207640_102055902 | 109 |
| 121 | 3300026041 | Ga0207639_10034207 | Ga0207639_100342074 | 109 |
| 122 | 3300026078 | Ga0207702_10007807 | Ga0207702_100078075 | 109 |
| 123 | 3300026078 | Ga0207702_10031428 | Ga0207702_100314284 | 109 |
| 124 | 3300026078 | Ga0207702_10091997 | Ga0207702_100919972 | 109 |
| 125 | 3300026078 | Ga0207702_10397205 | Ga0207702_103972052 | 109 |
| 126 | 3300027671 | Ga0209588_1001630 | Ga0209588_10016302 | 109 |
| 127 | 3300027671 | Ga0209588_1008043 | Ga0209588_10080432 | 109 |
| 128 | 3300027671 | Ga0209588_1089146 | Ga0209588_10891462 | 109 |
| 129 | 3300028800 | Ga0265338_10085555 | Ga0265338_100855552 | 109 |
| 130 | 3300031852 | Ga0307410_10598045 | Ga0307410_105980451 | 109 |
| 131 | 3300032133 | Ga0316583_10000120 | Ga0316583_100001202 | 109 |
| 132 | 3300035086 | Ga0373934_0037225 | Ga0373934_0037225_1232_1573 | 109 |
| 133 | 3300035111 | Ga0373923_0162378 | Ga0373923_0162378_415_753 | 109 |
| 134 | 3300035113 | Ga0373936_0148957 | Ga0373936_0148957_236_577 | 109 |
| 135 | 3300035170 | Ga0373943_0026942 | Ga0373943_0026942_1014_1406 | 109 |
| 136 | 3300035171 | Ga0373946_0028481 | Ga0373946_0028481_1198_1536 | 109 |
| 137 | 3300035172 | Ga0373955_0041324 | Ga0373955_0041324_349_690 | 109 |
| 138 | 3300035695 | Ga0373927_0079985 | Ga0373927_0079985_1058_1396 | 109 |
| 139 | 3300035695 | Ga0373927_0123979 | Ga0373927_0123979_754_1092 | 109 |
| 140 | 3300035695 | Ga0373927_0213184 | Ga0373927_0213184_879_1217 | 109 |
| 141 | 3300035725 | Ga0373947_0036434 | Ga0373947_0036434_415_753 | 109 |
| 142 | 3300036401 | Ga0373937_0102338 | Ga0373937_0102338_1977_2318 | 109 |
| 143 | 3300036401 | Ga0373937_1062153 | Ga0373937_1062153_349_687 | 109 |
| 144 | 3300037068 | Ga0373925_0000126 | Ga0373925_0000126_1592_1930 | 109 |
| 145 | 3300037068 | Ga0373925_0013327 | Ga0373925_0013327_4938_5279 | 109 |
| 146 | 3300037068 | Ga0373925_0163326 | Ga0373925_0163326_1146_1484 | 109 |
| 147 | 3300037068 | Ga0373925_0449617 | Ga0373925_0449617_407_745 | 109 |
| 148 | 3300039437 | Ga0436365_0900246 | Ga0436365_0900246_807_1214 | 109 |
| 149 | 3300039450 | Ga0436363_1376765 | Ga0436363_1376765_6845_7183 | 109 |
| 150 | 3300039453 | Ga0436362_0649279 | Ga0436362_0649279_534_872 | 109 |
| 151 | 3300044684 | Ga0466966_0664870 | Ga0466966_0664870_141_479 | 109 |
| 152 | 3300044694 | Ga0466963_0007096 | Ga0466963_0007096_3058_3399 | 109 |
| 153 | 3300044706 | Ga0466964_0056781 | Ga0466964_0056781_763_1104 | 109 |
| 154 | 3300044712 | Ga0453684_0258312 | Ga0453684_0258312_1171_1512 | 109 |
| 155 | 3300044842 | Ga0466957_0066204 | Ga0466957_0066204_638_979 | 109 |
| 156 | 3300045051 | Ga0451576_0701619 | Ga0451576_0701619_242_574 | 109 |
| 157 | 3300045976 | Ga0466967_2119570 | Ga0466967_2119570_61_399 | 109 |
| 158 | 3300046457 | Ga0495590_0097101 | Ga0495590_0097101_695_1033 | 109 |
| 159 | 3300046463 | Ga0495653_0720976 | Ga0495653_0720976_44_385 | 109 |
| 160 | 3300046472 | Ga0495580_0000247 | Ga0495580_0000247_41340_41678 | 109 |
| 161 | 3300046472 | Ga0495580_0002141 | Ga0495580_0002141_10568_10906 | 109 |
| 162 | 3300046473 | Ga0495582_0479403 | Ga0495582_0479403_59_397 | 109 |
| 163 | 3300046517 | Ga0495630_0295252 | Ga0495630_0295252_801_1139 | 109 |
| 164 | 3300046526 | Ga0495666_0222569 | Ga0495666_0222569_61_399 | 109 |
| 165 | 3300046531 | Ga0495665_0021300 | Ga0495665_0021300_1200_1538 | 109 |
| 166 | 3300046543 | Ga0495645_0766973 | Ga0495645_0766973_138_479 | 109 |
| 167 | 3300047444 | Ga0495675_0065357 | Ga0495675_0065357_459_800 | 109 |
| 168 | 3300047472 | Ga0495686_0001753 | Ga0495686_0001753_7514_7870 | 109 |
| 169 | 3300048088 | Ga0495602_0039600 | Ga0495602_0039600_577_918 | 109 |
| 170 | 3300049661 | Ga0501217_110363 | Ga0501217_110363_117_449 | 109 |
| 171 | 3300049674 | Ga0501242_060881 | Ga0501242_060881_202_534 | 109 |
| 172 | 3300049688 | Ga0501259_001539 | Ga0501259_001539_2337_2669 | 109 |
| 173 | 3300049765 | Ga0501268_053592 | Ga0501268_053592_76_408 | 109 |
| 174 | 3300050507 | nmdc:mga05p37_398261_c1 | nmdc:mga05p37_398261_c1_937_1275 | 109 |
| 175 | 3300050512 | nmdc:mga0n895_2918_c1 | nmdc:mga0n895_2918_c1_2431_2769 | 109 |
| 176 | 3300050513 | nmdc:mga0rr50_3866_c1 | nmdc:mga0rr50_3866_c1_1361_1699 | 109 |
| 177 | 3300050513 | nmdc:mga0rr50_970849_c1 | nmdc:mga0rr50_970849_c1_292_630 | 109 |
| 178 | 3300050514 | nmdc:mga08x19_437084_c1 | nmdc:mga08x19_437084_c1_141_473 | 109 |
| 179 | 3300050514 | nmdc:mga08x19_51518_c1 | nmdc:mga08x19_51518_c1_1021_1359 | 109 |
| 180 | 3300050514 | nmdc:mga08x19_61403_c1 | nmdc:mga08x19_61403_c1_1713_2054 | 109 |
| 181 | 3300050514 | nmdc:mga08x19_698392_c1 | nmdc:mga08x19_698392_c1_93_434 | 109 |
| 182 | 3300050514 | nmdc:mga08x19_812_c1 | nmdc:mga08x19_812_c1_5691_6029 | 109 |
| 183 | 3300050514 | nmdc:mga08x19_87103_c1 | nmdc:mga08x19_87103_c1_421_759 | 109 |
| 184 | 3300050515 | nmdc:mga0a205_6408_c1 | nmdc:mga0a205_6408_c1_793_1131 | 109 |
| 185 | 3300053077 | Ga0495601_0644520 | Ga0495601_0644520_167_508 | 109 |
| 186 | 3300061719 | Ga0466962_0012484 | Ga0466962_0012484_988_1329 | 109 |
| 187 | 3300004801 | Ga0058860_10544046 | Ga0058860_105440462 | 111 |
| 188 | 3300005290 | Ga0065712_10254284 | Ga0065712_102542842 | 111 |
| 189 | 3300005330 | Ga0070690_100210514 | Ga0070690_1002105142 | 111 |
| 190 | 3300005334 | Ga0068869_100010564 | Ga0068869_1000105643 | 111 |
| 191 | 3300005353 | Ga0070669_101518746 | Ga0070669_1015187461 | 111 |
| 192 | 3300005367 | Ga0070667_100820032 | Ga0070667_1008200321 | 111 |
| 193 | 3300005457 | Ga0070662_100289909 | Ga0070662_1002899092 | 111 |
| 194 | 3300005545 | Ga0070695_100714635 | Ga0070695_1007146351 | 111 |
| 195 | 3300005547 | Ga0070693_100189937 | Ga0070693_1001899372 | 111 |
| 196 | 3300005563 | Ga0068855_101000874 | Ga0068855_1010008742 | 111 |
| 197 | 3300005617 | Ga0068859_100065946 | Ga0068859_1000659462 | 111 |
| 198 | 3300005841 | Ga0068863_100079202 | Ga0068863_1000792023 | 111 |
| 199 | 3300005841 | Ga0068863_100116025 | Ga0068863_1001160252 | 111 |
| 200 | 3300005842 | Ga0068858_100001952 | Ga0068858_10000195212 | 111 |
| 201 | 3300005843 | Ga0068860_100045316 | Ga0068860_1000453162 | 111 |
| 202 | 3300005844 | Ga0068862_100509630 | Ga0068862_1005096302 | 111 |
| 203 | 3300006237 | Ga0097621_100323149 | Ga0097621_1003231492 | 111 |
| 204 | 3300006237 | Ga0097621_100864175 | Ga0097621_1008641752 | 111 |
| 205 | 3300006358 | Ga0068871_100193536 | Ga0068871_1001935362 | 111 |
| 206 | 3300006852 | Ga0075433_10935529 | Ga0075433_109355291 | 111 |
| 207 | 3300006881 | Ga0068865_100205897 | Ga0068865_1002058972 | 111 |
| 208 | 3300006931 | Ga0097620_100065947 | Ga0097620_1000659472 | 111 |
| 209 | 3300009093 | Ga0105240_11558383 | Ga0105240_115583832 | 111 |
| 210 | 3300009098 | Ga0105245_10975838 | Ga0105245_109758382 | 111 |
| 211 | 3300009101 | Ga0105247_10355818 | Ga0105247_103558181 | 111 |
| 212 | 3300009174 | Ga0105241_10698065 | Ga0105241_106980651 | 111 |
| 213 | 3300009177 | Ga0105248_11201920 | Ga0105248_112019202 | 111 |
| 214 | 3300009177 | Ga0105248_11597656 | Ga0105248_115976562 | 111 |
| 215 | 3300009545 | Ga0105237_10020087 | Ga0105237_100200872 | 111 |
| 216 | 3300009545 | Ga0105237_10655865 | Ga0105237_106558652 | 111 |
| 217 | 3300010375 | Ga0105239_10165772 | Ga0105239_101657723 | 111 |
| 218 | 3300013296 | Ga0157374_10000703 | Ga0157374_1000070315 | 111 |
| 219 | 3300013296 | Ga0157374_10387077 | Ga0157374_103870772 | 111 |
| 220 | 3300013297 | Ga0157378_10041720 | Ga0157378_100417203 | 111 |
| 221 | 3300013297 | Ga0157378_10118999 | Ga0157378_101189992 | 111 |
| 222 | 3300013297 | Ga0157378_10186098 | Ga0157378_101860982 | 111 |
| 223 | 3300013297 | Ga0157378_12575759 | Ga0157378_125757591 | 111 |
| 224 | 3300013306 | Ga0163162_10760191 | Ga0163162_107601912 | 111 |
| 225 | 3300013307 | Ga0157372_10422714 | Ga0157372_104227142 | 111 |
| 226 | 3300013307 | Ga0157372_11001510 | Ga0157372_110015102 | 111 |
| 227 | 3300013308 | Ga0157375_10008044 | Ga0157375_100080443 | 111 |
| 228 | 3300013308 | Ga0157375_10335605 | Ga0157375_103356053 | 111 |
| 229 | 3300014745 | Ga0157377_10302308 | Ga0157377_103023081 | 111 |
| 230 | 3300014968 | Ga0157379_10209395 | Ga0157379_102093952 | 111 |
| 231 | 3300014968 | Ga0157379_10578101 | Ga0157379_105781012 | 111 |
| 232 | 3300014969 | Ga0157376_10037113 | Ga0157376_100371132 | 111 |
| 233 | 3300025904 | Ga0207647_10046869 | Ga0207647_100468693 | 111 |
| 234 | 3300025914 | Ga0207671_10651845 | Ga0207671_106518451 | 111 |
| 235 | 3300025923 | Ga0207681_11417008 | Ga0207681_114170081 | 111 |
| 236 | 3300025927 | Ga0207687_10298661 | Ga0207687_102986611 | 111 |
| 237 | 3300025938 | Ga0207704_10199511 | Ga0207704_101995112 | 111 |
| 238 | 3300025941 | Ga0207711_10663622 | Ga0207711_106636221 | 111 |
| 239 | 3300025942 | Ga0207689_10001777 | Ga0207689_1000177714 | 111 |
| 240 | 3300025949 | Ga0207667_11414061 | Ga0207667_114140612 | 111 |
| 241 | 3300026035 | Ga0207703_10001169 | Ga0207703_1000116911 | 111 |
| 242 | 3300026035 | Ga0207703_11041497 | Ga0207703_110414971 | 111 |
| 243 | 3300026088 | Ga0207641_10109936 | Ga0207641_101099363 | 111 |
| 244 | 3300026118 | Ga0207675_101591754 | Ga0207675_1015917542 | 111 |
| 245 | 3300028380 | Ga0268265_10055510 | Ga0268265_100555101 | 111 |
| 246 | 3300028381 | Ga0268264_10012259 | Ga0268264_100122596 | 111 |
| 247 | 3300031727 | Ga0316576_10316096 | Ga0316576_103160962 | 111 |
| 248 | 3300032137 | Ga0316585_10011122 | Ga0316585_100111222 | 111 |
| 249 | 3300036647 | Ga0316582_0063383 | Ga0316582_0063383_1300_1677 | 111 |
| 250 | 3300044712 | Ga0453684_0211139 | Ga0453684_0211139_1266_1637 | 111 |
| 251 | 3300048915 | Ga0496112_0064440 | Ga0496112_0064440_717_1052 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7byw-assembly1.cif.gz_B | crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) | 0.9001 | 2 | 111 |
| 7byw-assembly1.cif.gz_B | crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) | 0.8845 | 2 | 111 |
| 1x8d-assembly2.cif.gz_D | crystal structure of e. coli yiil protein containing l-rhamnose | 0.8201 | 1 | 111 |
| 6hhn-assembly1.cif.gz_A-2 | crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila | 0.8135 | 1 | 111 |
| 1x8d-assembly2.cif.gz_D | crystal structure of e. coli yiil protein containing l-rhamnose | 0.806 | 1 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q556R9_3_105_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8847 | 2 | 97 | 3.30.70.100 |
| af_Q556R9_3_105_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8124 | 2 | 97 | 3.30.70.100 |
| 1x8dD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8102 | 1 | 105 | 3.30.70.100 |
| 1x8dD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8028 | 1 | 105 | 3.30.70.100 |
| af_F4JMH8_41_126_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7275 | 42 | 61 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F4C913-F1-model_v4 | L-rhamnose mutarotase | 1 | 1 | 111 |
GO:0016857
|
| AF-A0A2W0AJ85-F1-model_v4 | L-fucose mutarotase | 0.9969 | 2 | 111 |
GO:0016857
|
| AF-A0A2V9ZDP5-F1-model_v4 | L-fucose mutarotase | 0.9967 | 2 | 111 |
GO:0016857
|
| AF-A0A3L9ZP68-F1-model_v4 | deleted | 0.9952 | 2 | 111 |
|
| AF-A0A3N1JTV7-F1-model_v4 | deleted | 0.995 | 1 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar