F362175

General Info

Members Datasets Scaffolds Average Seq Length
251 140 502 245

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100241099|Ga0070682_1002410992
Length 258
Sequence MCFDADSLPPITPIAGAAVSHEDLVLEAPDGNRFAAFDAVPEDHIGTGVIVLPDVRGLYRFYEELALRFAERGVRAVAIDYFGRTAGVEKRPDDWDYAPHVAQTRYKTLQADIGAAAHRLRTPEGGDCRAVFTVGFCFGGSNSWLAATGGHGLSGAVGFYGRPGPRNDEPGPLDRAPDMQGTPILGLMGGADPGIPAADVAGFEAALADADVENEFVIYEGAPHSFFDRKYEEFQEASEDAWLRTLGFIAHHGGQDPR

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
62 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.21
Metatranscriptomes 2.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.77
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100241099 3300005337 Bacteria 1298
2 Ga0058863_11647530 3300004799 Unclassified 865
3 Ga0070683_100068423 3300005329 Bacteria 3309
4 Ga0070683_100101969 3300005329 Bacteria 2703
5 Ga0070683_100184684 3300005329 Bacteria 1979
6 Ga0070680_100175422 3300005336 Bacteria 1804
7 Ga0070703_10013589 3300005406 Bacteria 2313
8 Ga0070709_10005625 3300005434 Bacteria 6786
9 Ga0070714_100032375 3300005435 Bacteria 4363
10 Ga0070714_100073065 3300005435 Bacteria 2971
11 Ga0070714_100125069 3300005435 Bacteria 2292
12 Ga0070714_100229691 3300005435 Bacteria 1709
13 Ga0070714_100373632 3300005435 Bacteria 1343
14 Ga0070714_100373897 3300005435 Unclassified 1342
15 Ga0070713_100004927 3300005436 Bacteria 9062
16 Ga0070710_10003691 3300005437 Bacteria 7237
17 Ga0070705_100031147 3300005440 Bacteria 2951
18 Ga0070708_100000028 3300005445 Bacteria 96912
19 Ga0070708_100001330 3300005445 Bacteria 18895
20 Ga0070708_100020689 3300005445 Bacteria 5554
21 Ga0070708_100043875 3300005445 Bacteria 3930
22 Ga0070708_100205973 3300005445 Unclassified 1843
23 Ga0070708_100365251 3300005445 Bacteria 1360
24 Ga0070681_10025393 3300005458 Bacteria 5959
25 Ga0070706_100000077 3300005467 Bacteria 113837
26 Ga0070706_100000161 3300005467 Bacteria 85173
27 Ga0070706_100000832 3300005467 Bacteria 34166
28 Ga0070706_100145672 3300005467 Bacteria 2211
29 Ga0070707_100000062 3300005468 Bacteria 96912
30 Ga0070707_100000425 3300005468 Bacteria 41767
31 Ga0070707_100000700 3300005468 Bacteria 33356
32 Ga0070707_100017470 3300005468 Bacteria 6744
33 Ga0070707_100117865 3300005468 Bacteria 2577
34 Ga0070707_100127086 3300005468 Bacteria 2477
35 Ga0070707_100177810 3300005468 Bacteria 2074
36 Ga0070707_100249427 3300005468 Unclassified 1727
37 Ga0070707_100504326 3300005468 Unclassified 1172
38 Ga0070698_100009141 3300005471 Bacteria 10635
39 Ga0070698_100026993 3300005471 Bacteria 5971
40 Ga0070698_100037343 3300005471 Bacteria 5009
41 Ga0070698_100084493 3300005471 Bacteria 3162
42 Ga0070698_100219447 3300005471 Bacteria 1835
43 Ga0070698_100572320 3300005471 Bacteria 1069
44 Ga0070699_100000070 3300005518 Bacteria 96912
45 Ga0070699_100000320 3300005518 Bacteria 46461
46 Ga0070699_100000781 3300005518 Bacteria 29362
47 Ga0070699_100007006 3300005518 Bacteria 9797
48 Ga0070699_100152495 3300005518 Bacteria 2044
49 Ga0070699_100204944 3300005518 Bacteria 1754
50 Ga0070679_100019018 3300005530 Bacteria 6672
51 Ga0070679_100134262 3300005530 Bacteria 2456
52 Ga0070679_100236404 3300005530 Bacteria 1786
53 Ga0070697_100000009 3300005536 Bacteria 181121
54 Ga0070697_100007643 3300005536 Bacteria 8415
55 Ga0070697_100048355 3300005536 Bacteria 3448
56 Ga0070697_100088655 3300005536 Bacteria 2555
57 Ga0070697_100190131 3300005536 Bacteria 1742
58 Ga0070697_100194925 3300005536 Bacteria 1720
59 Ga0070695_100000332 3300005545 Bacteria 24281
60 Ga0070695_100005858 3300005545 Bacteria 7251
61 Ga0070704_100038787 3300005549 Bacteria 3266
62 Ga0068855_100228517 3300005563 Bacteria 2084
63 Ga0081539_10000171 3300005985 Bacteria 152572
64 Ga0070717_10000045 3300006028 Bacteria 108775
65 Ga0070717_10002027 3300006028 Bacteria 14184
66 Ga0070717_10006282 3300006028 Bacteria 8727
67 Ga0070715_10013783 3300006163 Bacteria 2977
68 Ga0070716_100009320 3300006173 Bacteria 4890
69 Ga0070712_100021772 3300006175 Bacteria 4215
70 Ga0070712_100470948 3300006175 Unclassified 1049
71 Ga0075428_100034263 3300006844 Bacteria 5602
72 Ga0075433_10068726 3300006852 Bacteria 3111
73 Ga0075433_10139910 3300006852 Bacteria 2151
74 Ga0075433_10368468 3300006852 Bacteria 1268
75 Ga0075434_100064958 3300006871 Bacteria 3634
76 Ga0075434_100724070 3300006871 Unclassified 1012
77 Ga0075436_100129332 3300006914 Bacteria 1770
78 Ga0075435_100342250 3300007076 Bacteria 1281
79 Ga0099794_10001223 3300007265 Bacteria 8845
80 Ga0099794_10004576 3300007265 Bacteria 5455
81 Ga0099794_10168596 3300007265 Bacteria 1116
82 Ga0105240_10179861 3300009093 Bacteria 2497
83 Ga0111539_10014002 3300009094 Bacteria 10022
84 Ga0105245_10134562 3300009098 Bacteria 2322
85 Ga0157369_10001416 3300013105 Bacteria 29494
86 Ga0206356_10012764 3300020070 Unclassified 1066
87 Ga0206351_10125505 3300020077 Unclassified 936
88 Ga0206350_11423852 3300020080 Bacteria 1553
89 Ga0206354_11428261 3300020081 Unclassified 957
90 Ga0206353_10687152 3300020082 Unclassified 1154
91 Ga0224712_10132831 3300022467 Bacteria 1088
92 Ga0207692_10002230 3300025898 Bacteria 7416
93 Ga0207685_10000625 3300025905 Bacteria 6214
94 Ga0207699_10003860 3300025906 Bacteria 7159
95 Ga0207705_10239819 3300025909 Unclassified 1381
96 Ga0207684_10000003 3300025910 Bacteria 766933
97 Ga0207684_10000099 3300025910 Bacteria 163128
98 Ga0207684_10000192 3300025910 Bacteria 96931
99 Ga0207684_10008399 3300025910 Bacteria 9181
100 Ga0207684_10477634 3300025910 Bacteria 1069
101 Ga0207707_10041331 3300025912 Unclassified 4027
102 Ga0207693_10007191 3300025915 Bacteria 9169
103 Ga0207663_10071717 3300025916 Bacteria 2236
104 Ga0207660_10211518 3300025917 Bacteria 1519
105 Ga0207652_10023614 3300025921 Bacteria 5096
106 Ga0207646_10000144 3300025922 Bacteria 96931
107 Ga0207646_10000285 3300025922 Bacteria 69639
108 Ga0207646_10000382 3300025922 Bacteria 59480
109 Ga0207646_10000392 3300025922 Bacteria 58942
110 Ga0207646_10000579 3300025922 Bacteria 48026
111 Ga0207646_10004261 3300025922 Bacteria 15631
112 Ga0207646_10025901 3300025922 Bacteria 5362
113 Ga0207646_10037332 3300025922 Bacteria 4381
114 Ga0207646_10115956 3300025922 Bacteria 2406
115 Ga0207664_10001869 3300025929 Bacteria 13852
116 Ga0207664_10126008 3300025929 Unclassified 2150
117 Ga0207664_10159712 3300025929 Bacteria 1922
118 Ga0207665_10002633 3300025939 Bacteria 12067
119 Ga0207661_10017520 3300025944 Bacteria 5304
120 Ga0207661_10029807 3300025944 Bacteria 4195
121 Ga0207678_10348521 3300026067 Bacteria 1277
122 Ga0209588_1000067 3300027671 Bacteria 36153
123 Ga0207428_10118052 3300027907 Bacteria 2036
124 Ga0373953_0184424 3300035117 Bacteria 901
125 Ga0373956_0042504 3300035119 Bacteria 2021
126 Ga0373962_0054227 3300035242 Bacteria 1162
127 Ga0373937_0000556 3300036401 Bacteria 33122
128 Ga0395900_0003136 3300037418 Bacteria 17929
129 Ga0395900_0028140 3300037418 Bacteria 5756
130 Ga0395898_0002058 3300037466 Bacteria 25043
131 Ga0395898_0024332 3300037466 Bacteria 6107
132 Ga0395905_0010934 3300037471 Bacteria 8783
133 Ga0395901_0006872 3300038443 Bacteria 11494
134 Ga0395901_0089113 3300038443 Bacteria 3228
135 Ga0439451_002861 3300042009 Bacteria 3515
136 Ga0453683_0366863 3300044673 Bacteria 926
137 Ga0466965_0014747 3300044683 Bacteria 3701
138 Ga0466963_0000278 3300044694 Bacteria 22837
139 Ga0466963_0004639 3300044694 Bacteria 8014
140 Ga0466963_0005050 3300044694 Bacteria 7714
141 Ga0466963_0006630 3300044694 Bacteria 6870
142 Ga0466963_0056966 3300044694 Bacteria 2601
143 Ga0466963_0060019 3300044694 Bacteria 2539
144 Ga0466963_0073494 3300044694 Bacteria 2305
145 Ga0466963_0187503 3300044694 Bacteria 1445
146 Ga0466964_0003890 3300044706 Bacteria 5486
147 Ga0466964_0014860 3300044706 Bacteria 2963
148 Ga0466964_0024255 3300044706 Bacteria 2363
149 Ga0466964_0076446 3300044706 Unclassified 1428
150 Ga0466957_0032942 3300044842 Bacteria 3106
151 Ga0466957_0059982 3300044842 Bacteria 2333
152 Ga0466957_0082555 3300044842 Bacteria 2003
153 Ga0466957_0116451 3300044842 Bacteria 1700
154 Ga0466957_0117664 3300044842 Bacteria 1692
155 Ga0466959_0079622 3300045049 Bacteria 2362
156 Ga0466959_0177399 3300045049 Bacteria 1492
157 Ga0466959_0213544 3300045049 Bacteria 1340
158 Ga0466958_0002911 3300045836 Bacteria 8745
159 Ga0466958_0014506 3300045836 Bacteria 4498
160 Ga0466958_0050982 3300045836 Bacteria 2505
161 Ga0466958_0143515 3300045836 Bacteria 1504
162 Ga0466967_0000497 3300045976 Bacteria 19218
163 Ga0466967_0001791 3300045976 Bacteria 12862
164 Ga0466967_0003306 3300045976 Bacteria 10471
165 Ga0466967_0023019 3300045976 Bacteria 5097
166 Ga0466967_0064494 3300045976 Bacteria 3258
167 Ga0466967_0071216 3300045976 Bacteria 3112
168 Ga0466967_0074754 3300045976 Bacteria 3044
169 Ga0466967_0138805 3300045976 Bacteria 2262
170 Ga0466967_0239015 3300045976 Bacteria 1732
171 Ga0466967_0264591 3300045976 Bacteria 1646
172 Ga0466967_0500340 3300045976 Bacteria 1192
173 Ga0466967_0753827 3300045976 Bacteria 966
174 Ga0495592_0000114 3300046454 Bacteria 70630
175 Ga0495651_0004218 3300046462 Bacteria 11015
176 Ga0495653_0006142 3300046463 Bacteria 9851
177 Ga0495664_0180730 3300046477 Bacteria 1279
178 Ga0495664_0344793 3300046477 Bacteria 897
179 Ga0495608_0002773 3300046511 Bacteria 12579
180 Ga0495618_0002678 3300046514 Bacteria 11341
181 Ga0495628_0000310 3300046516 Bacteria 43937
182 Ga0495630_0053410 3300046517 Bacteria 3025
183 Ga0495652_0000144 3300046529 Bacteria 80486
184 Ga0495652_0436510 3300046529 Bacteria 919
185 Ga0495587_0000060 3300046536 Bacteria 93780
186 Ga0495645_0000054 3300046543 Bacteria 84855
187 Ga0495657_0027538 3300046675 Bacteria 4009
188 Ga0495599_0000048 3300046678 Bacteria 85175
189 Ga0495623_0000838 3300046679 Bacteria 20793
190 Ga0495646_0017703 3300046680 Bacteria 4517
191 Ga0495613_0087566 3300046689 Bacteria 2257
192 Ga0495600_0012279 3300046809 Bacteria 5352
193 Ga0495604_0000043 3300047317 Bacteria 116335
194 Ga0495674_0155961 3300047319 Bacteria 1912
195 Ga0495680_0011709 3300047322 Bacteria 7748
196 Ga0495675_0000041 3300047444 Bacteria 86087
197 Ga0495602_0000931 3300048088 Bacteria 28283
198 Ga0496100_0003536 3300048903 Bacteria 8159
199 Ga0496101_0006135 3300048904 Bacteria 7714
200 Ga0496102_0005988 3300048905 Bacteria 10356
201 Ga0496102_0042122 3300048905 Bacteria 4137
202 Ga0496103_0021658 3300048906 Bacteria 3868
203 Ga0496104_0033874 3300048907 Bacteria 4760
204 Ga0496105_0161974 3300048908 Bacteria 1836
205 Ga0496106_0017347 3300048909 Bacteria 5328
206 Ga0496107_0010235 3300048910 Bacteria 6508
207 Ga0496108_0006289 3300048911 Bacteria 9625
208 Ga0496109_0312495 3300048912 Bacteria 1482
209 Ga0496110_0006437 3300048913 Bacteria 9300
210 Ga0496111_0027601 3300048914 Bacteria 4018
211 Ga0496112_0534628 3300048915 Bacteria 1106
212 Ga0496113_0009848 3300048916 Bacteria 6292
213 Ga0496114_0002059 3300048917 Bacteria 15309
214 Ga0496115_0013106 3300048918 Bacteria 6260
215 Ga0501031_0036282 3300049568 Bacteria 3215
216 Ga0501031_0369267 3300049568 Bacteria 928
217 Ga0501034_0241172 3300049571 Bacteria 1754
218 Ga0501036_0229758 3300049572 Bacteria 1557
219 Ga0501039_0136254 3300049575 Bacteria 1928
220 Ga0501040_0430209 3300049576 Bacteria 949
221 Ga0501042_0149276 3300049578 Bacteria 1685
222 Ga0501070_0114542 3300049586 Bacteria 2227
223 Ga0501071_0257966 3300049587 Bacteria 1316
224 Ga0501072_0009533 3300049588 Bacteria 7385
225 Ga0501076_0384529 3300049592 Bacteria 1153
226 Ga0501077_0028442 3300049593 Bacteria 3552
227 Ga0501077_0053932 3300049593 Bacteria 2553
228 Ga0501079_0104505 3300049741 Bacteria 2197
229 Ga0501080_0084773 3300049742 Bacteria 2944
230 Ga0501080_0126328 3300049742 Bacteria 2369
231 Ga0501083_0223712 3300049744 Unclassified 1226
232 Ga0501044_0064770 3300049823 Bacteria 3730
233 Ga0501045_0476292 3300049824 Unclassified 928
234 nmdc:mga05p37_20744_c1 3300050507 Bacteria 5204
235 nmdc:mga05p37_461284_c1 3300050507 Bacteria 1468
236 nmdc:mga0n895_27058_c1 3300050512 Bacteria 5443
237 nmdc:mga08x19_235296_c1 3300050514 Bacteria 1262
238 nmdc:mga08x19_46139_c1 3300050514 Bacteria 2786
239 nmdc:mga08x19_78444_c1 3300050514 Bacteria 2165
240 nmdc:mga0a205_24475_c1 3300050515 Bacteria 5743
241 Ga0495601_0000084 3300053077 Bacteria 51113
242 Ga0495601_0047187 3300053077 Bacteria 2711
243 Ga0495601_0112287 3300053077 Bacteria 1765
244 Ga0495612_0081577 3300053078 Bacteria 1359
245 Ga0495595_0044469 3300053084 Bacteria 2040
246 Ga0495619_0020445 3300053085 Bacteria 4215
247 Ga0466962_0008258 3300061719 Bacteria 4990
248 Ga0466962_0073565 3300061719 Bacteria 1633
249 Ga0466962_0085181 3300061719 Bacteria 1513
250 Ga0530510_0260512 3300061734 Archaea 1293
251 Ga0530510_0328537 3300061734 Unclassified 1147
252 Ga0070682_100241099
253 Ga0058863_11647530
254 Ga0070683_100068423
255 Ga0070683_100101969
256 Ga0070683_100184684
257 Ga0070680_100175422
258 Ga0070703_10013589
259 Ga0070709_10005625
260 Ga0070714_100032375
261 Ga0070714_100073065
262 Ga0070714_100125069
263 Ga0070714_100229691
264 Ga0070714_100373632
265 Ga0070714_100373897
266 Ga0070713_100004927
267 Ga0070710_10003691
268 Ga0070705_100031147
269 Ga0070708_100000028
270 Ga0070708_100001330
271 Ga0070708_100020689
272 Ga0070708_100043875
273 Ga0070708_100205973
274 Ga0070708_100365251
275 Ga0070681_10025393
276 Ga0070706_100000077
277 Ga0070706_100000161
278 Ga0070706_100000832
279 Ga0070706_100145672
280 Ga0070707_100000062
281 Ga0070707_100000425
282 Ga0070707_100000700
283 Ga0070707_100017470
284 Ga0070707_100117865
285 Ga0070707_100127086
286 Ga0070707_100177810
287 Ga0070707_100249427
288 Ga0070707_100504326
289 Ga0070698_100009141
290 Ga0070698_100026993
291 Ga0070698_100037343
292 Ga0070698_100084493
293 Ga0070698_100219447
294 Ga0070698_100572320
295 Ga0070699_100000070
296 Ga0070699_100000320
297 Ga0070699_100000781
298 Ga0070699_100007006
299 Ga0070699_100152495
300 Ga0070699_100204944
301 Ga0070679_100019018
302 Ga0070679_100134262
303 Ga0070679_100236404
304 Ga0070697_100000009
305 Ga0070697_100007643
306 Ga0070697_100048355
307 Ga0070697_100088655
308 Ga0070697_100190131
309 Ga0070697_100194925
310 Ga0070695_100000332
311 Ga0070695_100005858
312 Ga0070704_100038787
313 Ga0068855_100228517
314 Ga0081539_10000171
315 Ga0070717_10000045
316 Ga0070717_10002027
317 Ga0070717_10006282
318 Ga0070715_10013783
319 Ga0070716_100009320
320 Ga0070712_100021772
321 Ga0070712_100470948
322 Ga0075428_100034263
323 Ga0075433_10068726
324 Ga0075433_10139910
325 Ga0075433_10368468
326 Ga0075434_100064958
327 Ga0075434_100724070
328 Ga0075436_100129332
329 Ga0075435_100342250
330 Ga0099794_10001223
331 Ga0099794_10004576
332 Ga0099794_10168596
333 Ga0105240_10179861
334 Ga0111539_10014002
335 Ga0105245_10134562
336 Ga0157369_10001416
337 Ga0206356_10012764
338 Ga0206351_10125505
339 Ga0206350_11423852
340 Ga0206354_11428261
341 Ga0206353_10687152
342 Ga0224712_10132831
343 Ga0207692_10002230
344 Ga0207685_10000625
345 Ga0207699_10003860
346 Ga0207705_10239819
347 Ga0207684_10000003
348 Ga0207684_10000099
349 Ga0207684_10000192
350 Ga0207684_10008399
351 Ga0207684_10477634
352 Ga0207707_10041331
353 Ga0207693_10007191
354 Ga0207663_10071717
355 Ga0207660_10211518
356 Ga0207652_10023614
357 Ga0207646_10000144
358 Ga0207646_10000285
359 Ga0207646_10000382
360 Ga0207646_10000392
361 Ga0207646_10000579
362 Ga0207646_10004261
363 Ga0207646_10025901
364 Ga0207646_10037332
365 Ga0207646_10115956
366 Ga0207664_10001869
367 Ga0207664_10126008
368 Ga0207664_10159712
369 Ga0207665_10002633
370 Ga0207661_10017520
371 Ga0207661_10029807
372 Ga0207678_10348521
373 Ga0209588_1000067
374 Ga0207428_10118052
375 Ga0373953_0184424
376 Ga0373956_0042504
377 Ga0373962_0054227
378 Ga0373937_0000556
379 Ga0395900_0003136
380 Ga0395900_0028140
381 Ga0395898_0002058
382 Ga0395898_0024332
383 Ga0395905_0010934
384 Ga0395901_0006872
385 Ga0395901_0089113
386 Ga0439451_002861
387 Ga0453683_0366863
388 Ga0466965_0014747
389 Ga0466963_0000278
390 Ga0466963_0004639
391 Ga0466963_0005050
392 Ga0466963_0006630
393 Ga0466963_0056966
394 Ga0466963_0060019
395 Ga0466963_0073494
396 Ga0466963_0187503
397 Ga0466964_0003890
398 Ga0466964_0014860
399 Ga0466964_0024255
400 Ga0466964_0076446
401 Ga0466957_0032942
402 Ga0466957_0059982
403 Ga0466957_0082555
404 Ga0466957_0116451
405 Ga0466957_0117664
406 Ga0466959_0079622
407 Ga0466959_0177399
408 Ga0466959_0213544
409 Ga0466958_0002911
410 Ga0466958_0014506
411 Ga0466958_0050982
412 Ga0466958_0143515
413 Ga0466967_0000497
414 Ga0466967_0001791
415 Ga0466967_0003306
416 Ga0466967_0023019
417 Ga0466967_0064494
418 Ga0466967_0071216
419 Ga0466967_0074754
420 Ga0466967_0138805
421 Ga0466967_0239015
422 Ga0466967_0264591
423 Ga0466967_0500340
424 Ga0466967_0753827
425 Ga0495592_0000114
426 Ga0495651_0004218
427 Ga0495653_0006142
428 Ga0495664_0180730
429 Ga0495664_0344793
430 Ga0495608_0002773
431 Ga0495618_0002678
432 Ga0495628_0000310
433 Ga0495630_0053410
434 Ga0495652_0000144
435 Ga0495652_0436510
436 Ga0495587_0000060
437 Ga0495645_0000054
438 Ga0495657_0027538
439 Ga0495599_0000048
440 Ga0495623_0000838
441 Ga0495646_0017703
442 Ga0495613_0087566
443 Ga0495600_0012279
444 Ga0495604_0000043
445 Ga0495674_0155961
446 Ga0495680_0011709
447 Ga0495675_0000041
448 Ga0495602_0000931
449 Ga0496100_0003536
450 Ga0496101_0006135
451 Ga0496102_0005988
452 Ga0496102_0042122
453 Ga0496103_0021658
454 Ga0496104_0033874
455 Ga0496105_0161974
456 Ga0496106_0017347
457 Ga0496107_0010235
458 Ga0496108_0006289
459 Ga0496109_0312495
460 Ga0496110_0006437
461 Ga0496111_0027601
462 Ga0496112_0534628
463 Ga0496113_0009848
464 Ga0496114_0002059
465 Ga0496115_0013106
466 Ga0501031_0036282
467 Ga0501031_0369267
468 Ga0501034_0241172
469 Ga0501036_0229758
470 Ga0501039_0136254
471 Ga0501040_0430209
472 Ga0501042_0149276
473 Ga0501070_0114542
474 Ga0501071_0257966
475 Ga0501072_0009533
476 Ga0501076_0384529
477 Ga0501077_0028442
478 Ga0501077_0053932
479 Ga0501079_0104505
480 Ga0501080_0084773
481 Ga0501080_0126328
482 Ga0501083_0223712
483 Ga0501044_0064770
484 Ga0501045_0476292
485 nmdc:mga05p37_20744_c1
486 nmdc:mga05p37_461284_c1
487 nmdc:mga0n895_27058_c1
488 nmdc:mga08x19_235296_c1
489 nmdc:mga08x19_46139_c1
490 nmdc:mga08x19_78444_c1
491 nmdc:mga0a205_24475_c1
492 Ga0495601_0000084
493 Ga0495601_0047187
494 Ga0495601_0112287
495 Ga0495612_0081577
496 Ga0495595_0044469
497 Ga0495619_0020445
498 Ga0466962_0008258
499 Ga0466962_0073565
500 Ga0466962_0085181
501 Ga0530510_0260512
502 Ga0530510_0328537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

34

253

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8646 32 243
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8589 27 241
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8369 28 244
3azp-assembly1.cif.gz_A crystal structure of puromycin hydrolase s511a mutant 0.834 100 242
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.8321 28 244
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8735 31 244 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8494 26 239 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.829 31 239 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8082 26 244 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8061 28 242 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2W4MFV4-F1-model_v4 Dienelactone hydrolase family protein 0.9683 106 244 GO:0016787
AF-A0A7W1N809-F1-model_v4 Dienelactone hydrolase family protein 0.961 30 244 GO:0016787
AF-A0A2W4MFV4-F1-model_v4 Dienelactone hydrolase family protein 0.9542 106 244 GO:0016787
AF-A0A7W1N809-F1-model_v4 Dienelactone hydrolase family protein 0.9519 30 244 GO:0016787
AF-A0A532EI34-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9475 48 244 GO:0016787

Map