F362168

General Info

Members Datasets Scaffolds Average Seq Length
251 106 502 134

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100653446|Ga0068869_1006534462
Length 150
Sequence MSQRNKLNRFFNDLVKKTSQSHHSTLNELNITPLLDLVFVLLVIFIITTPQMMNNLEMTLPSAKPPPKTDEPKPKPNRIVLDDTGKVFLNDQVVTVSELKNQLQQIKVQTPDPVVVVKGSENVEYQNMVSVLDVLQQLDITKIGLATTAE

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
28 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
29 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
30 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
31 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
32 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
33 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
36 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
37 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
38 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
39 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
40 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
41 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
51 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
52 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
53 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
54 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
55 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
56 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
57 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
104 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
105 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
106 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 0.4
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 25.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100653446 3300005334 Unclassified 893
2 Ga0070690_100000528 3300005330 Bacteria 19182
3 Ga0070690_100498589 3300005330 Unclassified 911
4 Ga0068869_101376421 3300005334 Unclassified 624
5 Ga0070680_101814955 3300005336 Unclassified 528
6 Ga0070691_10524104 3300005341 Unclassified 688
7 Ga0070688_100036477 3300005365 Bacteria 2990
8 Ga0070713_101473982 3300005436 Unclassified 660
9 Ga0070710_10974564 3300005437 Bacteria 616
10 Ga0070694_101664498 3300005444 Unclassified 542
11 Ga0070681_10392313 3300005458 Unclassified 1299
12 Ga0070681_11096167 3300005458 Bacteria 717
13 Ga0070707_101663990 3300005468 Unclassified 605
14 Ga0070679_100664329 3300005530 Unclassified 985
15 Ga0070684_100059321 3300005535 Unclassified 3345
16 Ga0097621_101099049 3300006237 Bacteria 746
17 Ga0068871_100204610 3300006358 Unclassified 1705
18 Ga0075433_10890472 3300006852 Unclassified 776
19 Ga0105240_10014922 3300009093 Bacteria 10584
20 Ga0105240_10043517 3300009093 Bacteria 5713
21 Ga0105245_10940450 3300009098 Unclassified 907
22 Ga0105238_10171289 3300009551 Bacteria 2147
23 Ga0099796_10096222 3300010159 Bacteria 1107
24 Ga0099796_10268098 3300010159 Unclassified 714
25 Ga0157374_10193635 3300013296 Bacteria 1989
26 Ga0157374_10556472 3300013296 Unclassified 1155
27 Ga0157374_10684491 3300013296 Bacteria 1038
28 Ga0157380_12548916 3300014326 Unclassified 577
29 Ga0157376_11545596 3300014969 Unclassified 697
30 Ga0207707_10811565 3300025912 Unclassified 779
31 Ga0207695_10095136 3300025913 Bacteria 2984
32 Ga0207652_10553585 3300025921 Unclassified 1033
33 Ga0207694_10131468 3300025924 Bacteria 2007
34 Ga0265337_1002779 3300028556 Bacteria 7845
35 Ga0265337_1006013 3300028556 Bacteria 4735
36 Ga0265337_1009430 3300028556 Bacteria 3483
37 Ga0265337_1011863 3300028556 Bacteria 2986
38 Ga0265337_1028639 3300028556 Bacteria 1670
39 Ga0265337_1047762 3300028556 Unclassified 1212
40 Ga0265337_1062288 3300028556 Bacteria 1032
41 Ga0265337_1113240 3300028556 Unclassified 736
42 Ga0265337_1129435 3300028556 Unclassified 684
43 Ga0265326_10020851 3300028558 Unclassified 1878
44 Ga0265326_10025232 3300028558 Bacteria 1695
45 Ga0265326_10025503 3300028558 Bacteria 1686
46 Ga0265326_10028667 3300028558 Bacteria 1585
47 Ga0265326_10031884 3300028558 Bacteria 1501
48 Ga0265319_1000001 3300028563 Bacteria 549513
49 Ga0265319_1002032 3300028563 Bacteria 11388
50 Ga0265319_1002526 3300028563 Bacteria 9912
51 Ga0265319_1066538 3300028563 Bacteria 1161
52 Ga0265334_10075289 3300028573 Bacteria 1251
53 Ga0265334_10129732 3300028573 Bacteria 897
54 Ga0265334_10147440 3300028573 Bacteria 831
55 Ga0265334_10216893 3300028573 Bacteria 662
56 Ga0265323_10000587 3300028653 Bacteria 20017
57 Ga0265323_10004774 3300028653 Bacteria 5811
58 Ga0265323_10014153 3300028653 Bacteria 3166
59 Ga0265323_10030447 3300028653 Unclassified 2010
60 Ga0265323_10050936 3300028653 Unclassified 1470
61 Ga0265323_10054807 3300028653 Bacteria 1404
62 Ga0265323_10115730 3300028653 Bacteria 877
63 Ga0265322_10021475 3300028654 Bacteria 1849
64 Ga0265322_10033584 3300028654 Bacteria 1463
65 Ga0265322_10093472 3300028654 Bacteria 855
66 Ga0265322_10101559 3300028654 Bacteria 818
67 Ga0265336_10001564 3300028666 Bacteria 10269
68 Ga0265336_10016636 3300028666 Bacteria 2404
69 Ga0265336_10016963 3300028666 Bacteria 2374
70 Ga0265336_10056553 3300028666 Bacteria 1179
71 Ga0265336_10112226 3300028666 Unclassified 812
72 Ga0265338_10000009 3300028800 Bacteria 448611
73 Ga0265338_10000064 3300028800 Bacteria 190219
74 Ga0265338_10000305 3300028800 Bacteria 88659
75 Ga0265338_10000332 3300028800 Bacteria 85993
76 Ga0265338_10001094 3300028800 Bacteria 45068
77 Ga0265338_10001288 3300028800 Bacteria 41141
78 Ga0265338_10003199 3300028800 Bacteria 23354
79 Ga0265338_10004152 3300028800 Bacteria 19788
80 Ga0265338_10005271 3300028800 Bacteria 16934
81 Ga0265338_10005563 3300028800 Bacteria 16390
82 Ga0265338_10021326 3300028800 Bacteria 6761
83 Ga0265338_10028736 3300028800 Bacteria 5536
84 Ga0265338_10043120 3300028800 Bacteria 4189
85 Ga0265338_10043910 3300028800 Bacteria 4136
86 Ga0265338_10045265 3300028800 Bacteria 4049
87 Ga0265338_10049129 3300028800 Bacteria 3828
88 Ga0265338_10059371 3300028800 Unclassified 3370
89 Ga0265338_10070604 3300028800 Bacteria 2993
90 Ga0265338_10099035 3300028800 Bacteria 2383
91 Ga0265338_10117609 3300028800 Bacteria 2126
92 Ga0265338_10125378 3300028800 Bacteria 2038
93 Ga0265338_10153756 3300028800 Bacteria 1784
94 Ga0265338_10184379 3300028800 Bacteria 1588
95 Ga0265338_10194090 3300028800 Bacteria 1536
96 Ga0265338_10208133 3300028800 Bacteria 1470
97 Ga0265338_10242185 3300028800 Unclassified 1335
98 Ga0265338_10340867 3300028800 Bacteria 1080
99 Ga0265338_10367257 3300028800 Bacteria 1031
100 Ga0265338_10423387 3300028800 Unclassified 946
101 Ga0265338_10760978 3300028800 Bacteria 665
102 Ga0265338_11153569 3300028800 Unclassified 521
103 Ga0265324_10000250 3300029957 Bacteria 39869
104 Ga0265324_10002235 3300029957 Bacteria 10091
105 Ga0265324_10002252 3300029957 Bacteria 10053
106 Ga0265324_10002593 3300029957 Bacteria 9078
107 Ga0265324_10009492 3300029957 Bacteria 3795
108 Ga0265324_10018068 3300029957 Unclassified 2557
109 Ga0265324_10018704 3300029957 Bacteria 2501
110 Ga0265324_10026225 3300029957 Bacteria 2063
111 Ga0265324_10079289 3300029957 Bacteria 1117
112 Ga0265330_10099440 3300031235 Bacteria 1246
113 Ga0265332_10009675 3300031238 Unclassified 4301
114 Ga0265328_10029794 3300031239 Unclassified 2035
115 Ga0265328_10153408 3300031239 Unclassified 867
116 Ga0265320_10000586 3300031240 Bacteria 28020
117 Ga0265320_10001321 3300031240 Bacteria 18120
118 Ga0265320_10003567 3300031240 Bacteria 10405
119 Ga0265320_10007793 3300031240 Bacteria 6614
120 Ga0265320_10031991 3300031240 Bacteria 2698
121 Ga0265320_10040226 3300031240 Bacteria 2332
122 Ga0265320_10120195 3300031240 Bacteria 1198
123 Ga0265320_10157038 3300031240 Bacteria 1025
124 Ga0265320_10420708 3300031240 Bacteria 590
125 Ga0265325_10026591 3300031241 Unclassified 3133
126 Ga0265325_10050615 3300031241 Bacteria 2138
127 Ga0265325_10094897 3300031241 Unclassified 1466
128 Ga0265325_10137160 3300031241 Unclassified 1166
129 Ga0265329_10000538 3300031242 Bacteria 19555
130 Ga0265329_10003405 3300031242 Bacteria 6933
131 Ga0265340_10005220 3300031247 Bacteria 7211
132 Ga0265340_10024979 3300031247 Bacteria 3030
133 Ga0265340_10033760 3300031247 Bacteria 2546
134 Ga0265340_10177020 3300031247 Bacteria 965
135 Ga0265340_10216546 3300031247 Bacteria 859
136 Ga0265339_10015789 3300031249 Bacteria 4517
137 Ga0265339_10034535 3300031249 Bacteria 2841
138 Ga0265339_10051159 3300031249 Bacteria 2256
139 Ga0265339_10143540 3300031249 Bacteria 1213
140 Ga0265339_10236084 3300031249 Bacteria 889
141 Ga0265339_10450475 3300031249 Bacteria 597
142 Ga0265331_10060703 3300031250 Bacteria 1786
143 Ga0265331_10115093 3300031250 Bacteria 1232
144 Ga0265331_10146510 3300031250 Bacteria 1073
145 Ga0265331_10157324 3300031250 Bacteria 1031
146 Ga0265327_10002506 3300031251 Bacteria 19194
147 Ga0265316_10018450 3300031344 Bacteria 5994
148 Ga0265316_10042998 3300031344 Bacteria 3606
149 Ga0265316_10051558 3300031344 Bacteria 3232
150 Ga0265316_10059422 3300031344 Bacteria 2973
151 Ga0265316_10089616 3300031344 Unclassified 2347
152 Ga0265316_10095344 3300031344 Unclassified 2266
153 Ga0265316_10229429 3300031344 Bacteria 1368
154 Ga0265316_10293318 3300031344 Bacteria 1186
155 Ga0265316_10339682 3300031344 Bacteria 1088
156 Ga0265316_10581364 3300031344 Bacteria 795
157 Ga0265316_10885774 3300031344 Unclassified 624
158 Ga0265316_11015358 3300031344 Unclassified 577
159 Ga0265313_10002888 3300031595 Bacteria 14389
160 Ga0265313_10005545 3300031595 Bacteria 9250
161 Ga0265313_10009009 3300031595 Bacteria 6543
162 Ga0265313_10060966 3300031595 Bacteria 1768
163 Ga0265313_10263633 3300031595 Bacteria 700
164 Ga0265314_10000729 3300031711 Bacteria 39601
165 Ga0265314_10001317 3300031711 Bacteria 28131
166 Ga0265314_10045058 3300031711 Bacteria 3121
167 Ga0265314_10056103 3300031711 Unclassified 2714
168 Ga0265314_10101548 3300031711 Bacteria 1848
169 Ga0265314_10277968 3300031711 Bacteria 949
170 Ga0265314_10423422 3300031711 Bacteria 715
171 Ga0265342_10052039 3300031712 Bacteria 2442
172 Ga0373926_0014828 3300035083 Bacteria 2654
173 Ga0373944_0080839 3300035089 Unclassified 1073
174 Ga0373945_0272780 3300035116 Unclassified 719
175 Ga0373953_0032376 3300035117 Bacteria 2039
176 Ga0373954_0009822 3300035118 Bacteria 4211
177 Ga0373956_0011996 3300035119 Bacteria 3582
178 Ga0373943_0059249 3300035170 Bacteria 1908
179 Ga0373924_0138292 3300035410 Bacteria 1062
180 Ga0373935_0064807 3300035692 Bacteria 2343
181 Ga0373927_0000978 3300035695 Bacteria 21734
182 Ga0373933_0087907 3300035724 Bacteria 1915
183 Ga0373947_0024773 3300035725 Bacteria 3499
184 Ga0373947_0178622 3300035725 Bacteria 1381
185 Ga0373937_0000659 3300036401 Bacteria 30219
186 Ga0373937_0357319 3300036401 Bacteria 1384
187 Ga0373937_0971768 3300036401 Bacteria 798
188 Ga0373925_0001696 3300037068 Bacteria 18540
189 Ga0373925_0325076 3300037068 Bacteria 1245
190 Ga0373925_0681130 3300037068 Bacteria 848
191 Ga0451807_0650601 3300041486 Bacteria 641
192 Ga0453683_0834549 3300044673 Bacteria 608
193 Ga0453684_0915731 3300044712 Unclassified 938
194 Ga0451576_0144216 3300045051 Bacteria 2483
195 Ga0451576_1774916 3300045051 Unclassified 638
196 Ga0495629_0044536 3300046459 Bacteria 3114
197 Ga0495629_0235941 3300046459 Bacteria 1260
198 Ga0495653_0310378 3300046463 Unclassified 1026
199 Ga0495580_1065921 3300046472 Unclassified 513
200 Ga0495582_0041853 3300046473 Bacteria 2524
201 Ga0495639_0178051 3300046475 Bacteria 1034
202 Ga0495664_0022947 3300046477 Bacteria 3619
203 Ga0495618_0000575 3300046514 Bacteria 26127
204 Ga0495618_0479634 3300046514 Bacteria 752
205 Ga0495628_0081448 3300046516 Bacteria 2514
206 Ga0495628_0727657 3300046516 Unclassified 699
207 Ga0495630_0000441 3300046517 Bacteria 31615
208 Ga0495630_0006378 3300046517 Bacteria 8387
209 Ga0495630_0216257 3300046517 Unclassified 1463
210 Ga0495630_0609065 3300046517 Unclassified 837
211 Ga0495630_0710564 3300046517 Bacteria 769
212 Ga0495666_0000586 3300046526 Bacteria 16276
213 Ga0495666_0224147 3300046526 Unclassified 860
214 Ga0495652_0113691 3300046529 Bacteria 2173
215 Ga0495640_0105895 3300046533 Bacteria 1842
216 Ga0495640_0199389 3300046533 Unclassified 1269
217 Ga0495586_0000553 3300046535 Bacteria 21702
218 Ga0495586_0001176 3300046535 Bacteria 14677
219 Ga0495645_0317865 3300046543 Unclassified 1012
220 Ga0495634_0006730 3300046642 Bacteria 8707
221 Ga0495634_0062288 3300046642 Bacteria 2477
222 Ga0495635_0175039 3300046663 Unclassified 1459
223 Ga0495599_0043588 3300046678 Bacteria 2816
224 Ga0495647_0258118 3300046681 Unclassified 777
225 Ga0495647_0309024 3300046681 Unclassified 714
226 Ga0495613_0000632 3300046689 Bacteria 28018
227 Ga0495613_0104576 3300046689 Bacteria 2044
228 Ga0495613_0224927 3300046689 Bacteria 1316
229 Ga0495581_0049822 3300047315 Bacteria 2419
230 Ga0495674_0009414 3300047319 Bacteria 9282
231 Ga0495674_0048309 3300047319 Bacteria 3766
232 Ga0495674_0392744 3300047319 Bacteria 1121
233 Ga0495676_0147256 3300047321 Bacteria 1680
234 Ga0495676_0171573 3300047321 Bacteria 1526
235 Ga0495680_0001937 3300047322 Bacteria 21766
236 Ga0495675_0225963 3300047444 Bacteria 1131
237 Ga0495684_0321195 3300047471 Unclassified 1107
238 Ga0501031_0040928 3300049568 Bacteria 3025
239 Ga0501032_0036069 3300049569 Bacteria 3377
240 Ga0501033_0033880 3300049570 Bacteria 3834
241 Ga0501034_1014514 3300049571 Unclassified 713
242 Ga0501037_1105562 3300049573 Unclassified 513
243 Ga0501046_0837325 3300049580 Bacteria 644
244 Ga0501070_0511824 3300049586 Bacteria 964
245 Ga0501044_0034322 3300049823 Bacteria 5321
246 nmdc:mga08x19_134266_c1 3300050514 Bacteria 1667
247 nmdc:mga0a205_1117767_c1 3300050515 Unclassified 635
248 Ga0500635_0039084 3300053080 Bacteria 1577
249 Ga0500643_100128 3300053087 Bacteria 786
250 Ga0500611_234887 3300053727 Bacteria 526
251 Ga0500645_012290 3300053730 Unclassified 2769
252 Ga0068869_100653446
253 Ga0070690_100000528
254 Ga0070690_100498589
255 Ga0068869_101376421
256 Ga0070680_101814955
257 Ga0070691_10524104
258 Ga0070688_100036477
259 Ga0070713_101473982
260 Ga0070710_10974564
261 Ga0070694_101664498
262 Ga0070681_10392313
263 Ga0070681_11096167
264 Ga0070707_101663990
265 Ga0070679_100664329
266 Ga0070684_100059321
267 Ga0097621_101099049
268 Ga0068871_100204610
269 Ga0075433_10890472
270 Ga0105240_10014922
271 Ga0105240_10043517
272 Ga0105245_10940450
273 Ga0105238_10171289
274 Ga0099796_10096222
275 Ga0099796_10268098
276 Ga0157374_10193635
277 Ga0157374_10556472
278 Ga0157374_10684491
279 Ga0157380_12548916
280 Ga0157376_11545596
281 Ga0207707_10811565
282 Ga0207695_10095136
283 Ga0207652_10553585
284 Ga0207694_10131468
285 Ga0265337_1002779
286 Ga0265337_1006013
287 Ga0265337_1009430
288 Ga0265337_1011863
289 Ga0265337_1028639
290 Ga0265337_1047762
291 Ga0265337_1062288
292 Ga0265337_1113240
293 Ga0265337_1129435
294 Ga0265326_10020851
295 Ga0265326_10025232
296 Ga0265326_10025503
297 Ga0265326_10028667
298 Ga0265326_10031884
299 Ga0265319_1000001
300 Ga0265319_1002032
301 Ga0265319_1002526
302 Ga0265319_1066538
303 Ga0265334_10075289
304 Ga0265334_10129732
305 Ga0265334_10147440
306 Ga0265334_10216893
307 Ga0265323_10000587
308 Ga0265323_10004774
309 Ga0265323_10014153
310 Ga0265323_10030447
311 Ga0265323_10050936
312 Ga0265323_10054807
313 Ga0265323_10115730
314 Ga0265322_10021475
315 Ga0265322_10033584
316 Ga0265322_10093472
317 Ga0265322_10101559
318 Ga0265336_10001564
319 Ga0265336_10016636
320 Ga0265336_10016963
321 Ga0265336_10056553
322 Ga0265336_10112226
323 Ga0265338_10000009
324 Ga0265338_10000064
325 Ga0265338_10000305
326 Ga0265338_10000332
327 Ga0265338_10001094
328 Ga0265338_10001288
329 Ga0265338_10003199
330 Ga0265338_10004152
331 Ga0265338_10005271
332 Ga0265338_10005563
333 Ga0265338_10021326
334 Ga0265338_10028736
335 Ga0265338_10043120
336 Ga0265338_10043910
337 Ga0265338_10045265
338 Ga0265338_10049129
339 Ga0265338_10059371
340 Ga0265338_10070604
341 Ga0265338_10099035
342 Ga0265338_10117609
343 Ga0265338_10125378
344 Ga0265338_10153756
345 Ga0265338_10184379
346 Ga0265338_10194090
347 Ga0265338_10208133
348 Ga0265338_10242185
349 Ga0265338_10340867
350 Ga0265338_10367257
351 Ga0265338_10423387
352 Ga0265338_10760978
353 Ga0265338_11153569
354 Ga0265324_10000250
355 Ga0265324_10002235
356 Ga0265324_10002252
357 Ga0265324_10002593
358 Ga0265324_10009492
359 Ga0265324_10018068
360 Ga0265324_10018704
361 Ga0265324_10026225
362 Ga0265324_10079289
363 Ga0265330_10099440
364 Ga0265332_10009675
365 Ga0265328_10029794
366 Ga0265328_10153408
367 Ga0265320_10000586
368 Ga0265320_10001321
369 Ga0265320_10003567
370 Ga0265320_10007793
371 Ga0265320_10031991
372 Ga0265320_10040226
373 Ga0265320_10120195
374 Ga0265320_10157038
375 Ga0265320_10420708
376 Ga0265325_10026591
377 Ga0265325_10050615
378 Ga0265325_10094897
379 Ga0265325_10137160
380 Ga0265329_10000538
381 Ga0265329_10003405
382 Ga0265340_10005220
383 Ga0265340_10024979
384 Ga0265340_10033760
385 Ga0265340_10177020
386 Ga0265340_10216546
387 Ga0265339_10015789
388 Ga0265339_10034535
389 Ga0265339_10051159
390 Ga0265339_10143540
391 Ga0265339_10236084
392 Ga0265339_10450475
393 Ga0265331_10060703
394 Ga0265331_10115093
395 Ga0265331_10146510
396 Ga0265331_10157324
397 Ga0265327_10002506
398 Ga0265316_10018450
399 Ga0265316_10042998
400 Ga0265316_10051558
401 Ga0265316_10059422
402 Ga0265316_10089616
403 Ga0265316_10095344
404 Ga0265316_10229429
405 Ga0265316_10293318
406 Ga0265316_10339682
407 Ga0265316_10581364
408 Ga0265316_10885774
409 Ga0265316_11015358
410 Ga0265313_10002888
411 Ga0265313_10005545
412 Ga0265313_10009009
413 Ga0265313_10060966
414 Ga0265313_10263633
415 Ga0265314_10000729
416 Ga0265314_10001317
417 Ga0265314_10045058
418 Ga0265314_10056103
419 Ga0265314_10101548
420 Ga0265314_10277968
421 Ga0265314_10423422
422 Ga0265342_10052039
423 Ga0373926_0014828
424 Ga0373944_0080839
425 Ga0373945_0272780
426 Ga0373953_0032376
427 Ga0373954_0009822
428 Ga0373956_0011996
429 Ga0373943_0059249
430 Ga0373924_0138292
431 Ga0373935_0064807
432 Ga0373927_0000978
433 Ga0373933_0087907
434 Ga0373947_0024773
435 Ga0373947_0178622
436 Ga0373937_0000659
437 Ga0373937_0357319
438 Ga0373937_0971768
439 Ga0373925_0001696
440 Ga0373925_0325076
441 Ga0373925_0681130
442 Ga0451807_0650601
443 Ga0453683_0834549
444 Ga0453684_0915731
445 Ga0451576_0144216
446 Ga0451576_1774916
447 Ga0495629_0044536
448 Ga0495629_0235941
449 Ga0495653_0310378
450 Ga0495580_1065921
451 Ga0495582_0041853
452 Ga0495639_0178051
453 Ga0495664_0022947
454 Ga0495618_0000575
455 Ga0495618_0479634
456 Ga0495628_0081448
457 Ga0495628_0727657
458 Ga0495630_0000441
459 Ga0495630_0006378
460 Ga0495630_0216257
461 Ga0495630_0609065
462 Ga0495630_0710564
463 Ga0495666_0000586
464 Ga0495666_0224147
465 Ga0495652_0113691
466 Ga0495640_0105895
467 Ga0495640_0199389
468 Ga0495586_0000553
469 Ga0495586_0001176
470 Ga0495645_0317865
471 Ga0495634_0006730
472 Ga0495634_0062288
473 Ga0495635_0175039
474 Ga0495599_0043588
475 Ga0495647_0258118
476 Ga0495647_0309024
477 Ga0495613_0000632
478 Ga0495613_0104576
479 Ga0495613_0224927
480 Ga0495581_0049822
481 Ga0495674_0009414
482 Ga0495674_0048309
483 Ga0495674_0392744
484 Ga0495676_0147256
485 Ga0495676_0171573
486 Ga0495680_0001937
487 Ga0495675_0225963
488 Ga0495684_0321195
489 Ga0501031_0040928
490 Ga0501032_0036069
491 Ga0501033_0033880
492 Ga0501034_1014514
493 Ga0501037_1105562
494 Ga0501046_0837325
495 Ga0501070_0511824
496 Ga0501044_0034322
497 nmdc:mga08x19_134266_c1
498 nmdc:mga0a205_1117767_c1
499 Ga0500635_0039084
500 Ga0500643_100128
501 Ga0500611_234887
502 Ga0500645_012290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

22

150

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.878 51 120
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.8502 51 120
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8349 51 120
5by4-assembly1.cif.gz_A-2 structure and function of the escherichia coli tol-pal stator protein tolr 0.8236 49 122
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.8097 48 115
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8097 48 115 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7875 49 119 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7785 49 119 3.30.420.270
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7462 48 115 3.30.420.270
af_Q9VJY1_8_244_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7446 72 124 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3M3A539-F1-model_v4 TonB system transport protein ExbD2 0.9565 50 123 GO:0005886
GO:0015031
GO:0022857
AF-A0A7X8UXP4-F1-model_v4 Uncharacterized protein 0.9565 50 123
AF-A0A355S830-F1-model_v4 Uncharacterized protein 0.9496 50 123
AF-A0A3D4TQY9-F1-model_v4 Biopolymer transporter ExbD 0.9452 51 126 GO:0005886
GO:0015031
GO:0022857
AF-A0A3D0I8Q4-F1-model_v4 Biopolymer transporter ExbD 0.941 50 122 GO:0005886
GO:0015031
GO:0022857

Map