F362145

General Info

Members Datasets Scaffolds Average Seq Length
251 158 502 186

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100039542|Ga0070683_1000395424
Length 200
Sequence MFVAVVPPPEVVEHLDAFLEARRDAAAYRWAGMEQFHVTLAFLAEVPDRALDDLVERLGRAASRRHPFAATVAGGGAFPDVGRARVLWAGLDLDDDGRTELTRMASGARAASNRAGVPVEGQRFRPHITVARLGHPKEVTSWVRLLDAYRGPTWTVDRMTLVASYLGEGPRRRPRYEAVEEFALSGPSRQGCGKGHAGRR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
145 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
149 2643221576 Nocardioides sp. Root614 Isolate Unclassified
150 2643221590 Nocardioides sp. Root682 Isolate Unclassified
151 2643221604 Nocardioides sp. Root190 Isolate Unclassified
152 2643221615 Nocardioides sp. Root224 Isolate Unclassified
153 2643221617 Nocardioides sp. Root79 Isolate Unclassified
154 2643221620 Nocardioides sp. Root240 Isolate Unclassified
155 2643221641 Nocardioides sp. Root122 Isolate Unclassified
156 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
157 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
158 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.77
Nodule 0.4
Rhizoplane 13.15
Rhizosphere 74.9
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100039542 3300005329 Bacteria 4331
2 JGI24735J21928_10011706 3300002067 Bacteria 2779
3 Ga0070658_10027419 3300005327 Bacteria 4571
4 Ga0070683_100041759 3300005329 Bacteria 4221
5 Ga0070670_101213674 3300005331 Unclassified 689
6 Ga0068869_100132843 3300005334 Bacteria 1915
7 Ga0070682_100022486 3300005337 Bacteria 3735
8 Ga0070682_100430570 3300005337 Bacteria 1005
9 Ga0068868_100220040 3300005338 Bacteria 1589
10 Ga0070660_100021339 3300005339 Bacteria 4774
11 Ga0070660_100408011 3300005339 Bacteria 1124
12 Ga0070687_100117225 3300005343 Bacteria 1517
13 Ga0070692_10137549 3300005345 Bacteria 1379
14 Ga0070668_100652411 3300005347 Bacteria 925
15 Ga0070675_100696156 3300005354 Bacteria 925
16 Ga0070674_100185503 3300005356 Bacteria 1596
17 Ga0070663_100106765 3300005455 Bacteria 2098
18 Ga0070678_100028436 3300005456 Bacteria 3813
19 Ga0070662_100097244 3300005457 Bacteria 2222
20 Ga0070681_10626625 3300005458 Bacteria 990
21 Ga0070681_10774608 3300005458 Bacteria 876
22 Ga0070698_100001000 3300005471 Bacteria 31123
23 Ga0070679_100018987 3300005530 Bacteria 6678
24 Ga0070679_100528986 3300005530 Bacteria 1123
25 Ga0070684_100021758 3300005535 Bacteria 5341
26 Ga0070686_100376677 3300005544 Bacteria 1073
27 Ga0070693_100018140 3300005547 Bacteria 3671
28 Ga0070665_100001227 3300005548 Bacteria 31181
29 Ga0070665_100517651 3300005548 Bacteria 1205
30 Ga0068855_100229041 3300005563 Bacteria 2082
31 Ga0070664_100055749 3300005564 Bacteria 3357
32 Ga0070664_100107160 3300005564 Bacteria 2436
33 Ga0068857_100016248 3300005577 Bacteria 6521
34 Ga0068852_100278043 3300005616 Bacteria 1613
35 Ga0068864_100200304 3300005618 Bacteria 1834
36 Ga0068866_10223450 3300005718 Bacteria 1138
37 Ga0068861_100417253 3300005719 Bacteria 1195
38 Ga0068861_101211657 3300005719 Bacteria 730
39 Ga0068860_100393894 3300005843 Bacteria 1369
40 Ga0068862_100581066 3300005844 Bacteria 1073
41 Ga0075365_10057096 3300006038 Bacteria 2597
42 Ga0075365_10062673 3300006038 Bacteria 2487
43 Ga0075365_10065422 3300006038 Bacteria 2437
44 Ga0075365_10225589 3300006038 Bacteria 1315
45 Ga0075365_10407396 3300006038 Bacteria 960
46 Ga0075368_10088389 3300006042 Bacteria 1266
47 Ga0075367_10006975 3300006178 Bacteria 5754
48 Ga0068865_100124061 3300006881 Bacteria 1925
49 Ga0105245_10058800 3300009098 Bacteria 3461
50 Ga0105242_10815183 3300009176 Bacteria 925
51 Ga0105242_11550798 3300009176 Bacteria 695
52 Ga0105248_10486854 3300009177 Bacteria 1390
53 Ga0105238_11553515 3300009551 Bacteria 691
54 Ga0105239_10002783 3300010375 Bacteria 21910
55 Ga0105246_10003291 3300011119 Bacteria 9788
56 Ga0105246_11084002 3300011119 Bacteria 730
57 Ga0157371_10081511 3300013102 Bacteria 2291
58 Ga0157369_10051928 3300013105 Bacteria 4436
59 Ga0157372_10033741 3300013307 Bacteria 5624
60 Ga0157372_11740317 3300013307 Bacteria 717
61 Ga0157375_10043307 3300013308 Bacteria 4365
62 Ga0157375_10050519 3300013308 Bacteria 4079
63 Ga0157375_10235445 3300013308 Bacteria 1990
64 Ga0157375_10339150 3300013308 Bacteria 1668
65 Ga0157375_11909813 3300013308 Bacteria 705
66 Ga0163163_10132158 3300014325 Bacteria 2536
67 Ga0163163_10955915 3300014325 Bacteria 920
68 Ga0182008_10086639 3300014497 Bacteria 1542
69 Ga0157377_10060022 3300014745 Bacteria 2170
70 Ga0157377_10092044 3300014745 Bacteria 1792
71 Ga0157379_10008077 3300014968 Bacteria 9143
72 Ga0163161_10226627 3300017792 Bacteria 1449
73 Ga0163161_10434725 3300017792 Unclassified 1058
74 Ga0213875_10075183 3300021388 Bacteria 1576
75 Ga0207642_10181626 3300025899 Bacteria 1147
76 Ga0207705_10022106 3300025909 Bacteria 4538
77 Ga0207707_10045696 3300025912 Bacteria 3816
78 Ga0207662_10273597 3300025918 Bacteria 1115
79 Ga0207657_10035970 3300025919 Bacteria 4435
80 Ga0207652_10163621 3300025921 Bacteria 1995
81 Ga0207659_10697082 3300025926 Bacteria 869
82 Ga0207687_10007148 3300025927 Bacteria 7360
83 Ga0207690_10069864 3300025932 Bacteria 2417
84 Ga0207706_10142503 3300025933 Bacteria 2108
85 Ga0207686_10171581 3300025934 Bacteria 1530
86 Ga0207704_10015582 3300025938 Bacteria 3879
87 Ga0207704_10184127 3300025938 Bacteria 1512
88 Ga0207704_10491260 3300025938 Bacteria 987
89 Ga0207689_10196423 3300025942 Bacteria 1665
90 Ga0207661_10129356 3300025944 Bacteria 2160
91 Ga0207679_10096283 3300025945 Bacteria 2303
92 Ga0207679_10115408 3300025945 Bacteria 2127
93 Ga0207667_10066194 3300025949 Bacteria 3767
94 Ga0207678_10041684 3300026067 Bacteria 3980
95 Ga0207702_10064200 3300026078 Bacteria 3142
96 Ga0207674_10050401 3300026116 Bacteria 4253
97 Ga0207675_100479367 3300026118 Bacteria 1236
98 Ga0207683_10135034 3300026121 Bacteria 2221
99 Ga0207683_10210535 3300026121 Bacteria 1769
100 Ga0209813_10049962 3300027866 Bacteria 1303
101 Ga0268266_10012438 3300028379 Bacteria 7357
102 Ga0268266_10152433 3300028379 Bacteria 2085
103 Ga0268266_10428185 3300028379 Bacteria 1255
104 Ga0268265_10506346 3300028380 Bacteria 1139
105 Ga0268264_10018979 3300028381 Bacteria 5622
106 Ga0307410_10132847 3300031852 Bacteria 1831
107 Ga0307410_10367710 3300031852 Bacteria 1154
108 Ga0307407_10111241 3300031903 Bacteria 1720
109 Ga0307409_100036097 3300031995 Bacteria 3629
110 Ga0307409_100670338 3300031995 Bacteria 1033
111 Ga0307409_100692258 3300031995 Bacteria 1018
112 Ga0307414_10178924 3300032004 Bacteria 1704
113 Ga0307415_100145583 3300032126 Bacteria 1816
114 Ga0307415_100310806 3300032126 Bacteria 1310
115 Ga0373925_0758032 3300037068 Bacteria 800
116 Ga0395900_0024369 3300037418 Bacteria 6197
117 Ga0395905_0035230 3300037471 Bacteria 4700
118 Ga0395905_1004847 3300037471 Bacteria 737
119 Ga0436364_1401875 3300037853 Bacteria 966
120 Ga0436365_0637794 3300039437 Bacteria 2496
121 Ga0466961_0076246 3300044693 Bacteria 2125
122 Ga0466961_0113589 3300044693 Bacteria 1703
123 Ga0466961_0117283 3300044693 Bacteria 1673
124 Ga0466961_0176961 3300044693 Bacteria 1325
125 Ga0466963_0016871 3300044694 Bacteria 4547
126 Ga0466963_0051283 3300044694 Bacteria 2735
127 Ga0466963_0104158 3300044694 Bacteria 1944
128 Ga0466963_0143014 3300044694 Bacteria 1658
129 Ga0466963_0442736 3300044694 Bacteria 917
130 Ga0466964_0065038 3300044706 Bacteria 1527
131 Ga0466971_0060369 3300044719 Bacteria 1714
132 Ga0466970_0207213 3300044765 Bacteria 1092
133 Ga0466957_0012524 3300044842 Bacteria 4909
134 Ga0466957_0627878 3300044842 Bacteria 754
135 Ga0466960_0000408 3300044901 Bacteria 14765
136 Ga0466960_0009863 3300044901 Bacteria 3948
137 Ga0466967_0013579 3300045976 Bacteria 6300
138 Ga0466967_0025740 3300045976 Bacteria 4856
139 Ga0466967_0053084 3300045976 Bacteria 3561
140 Ga0466967_0056427 3300045976 Bacteria 3463
141 Ga0466967_0061111 3300045976 Bacteria 3341
142 Ga0466967_0151999 3300045976 Bacteria 2165
143 Ga0466967_0156512 3300045976 Bacteria 2135
144 Ga0466967_0248041 3300045976 Bacteria 1700
145 Ga0495665_0122416 3300046531 Bacteria 1362
146 Ga0496100_0065192 3300048903 Bacteria 2412
147 Ga0496100_1183741 3300048903 Bacteria 603
148 Ga0496102_0036915 3300048905 Bacteria 4405
149 Ga0496102_0052738 3300048905 Bacteria 3707
150 Ga0496102_0092254 3300048905 Bacteria 2804
151 Ga0496102_0663256 3300048905 Bacteria 966
152 Ga0496102_0685030 3300048905 Bacteria 948
153 Ga0496104_0016251 3300048907 Bacteria 6756
154 Ga0496105_0002380 3300048908 Bacteria 13627
155 Ga0496105_0037072 3300048908 Bacteria 4017
156 Ga0496106_0711982 3300048909 Bacteria 800
157 Ga0496107_0025363 3300048910 Bacteria 4197
158 Ga0496107_0078295 3300048910 Bacteria 2408
159 Ga0496107_0716062 3300048910 Bacteria 736
160 Ga0496108_0032776 3300048911 Bacteria 4315
161 Ga0496108_0371949 3300048911 Bacteria 1248
162 Ga0496109_0006561 3300048912 Bacteria 9797
163 Ga0496109_0051029 3300048912 Bacteria 3767
164 Ga0496109_0093945 3300048912 Bacteria 2776
165 Ga0496109_0236134 3300048912 Bacteria 1720
166 Ga0496109_0895613 3300048912 Bacteria 825
167 Ga0496110_0025137 3300048913 Bacteria 5086
168 Ga0496110_0569020 3300048913 Bacteria 1029
169 Ga0496110_1242569 3300048913 Bacteria 654
170 Ga0496111_0039898 3300048914 Bacteria 3368
171 Ga0496111_0588324 3300048914 Bacteria 815
172 Ga0496112_0109449 3300048915 Bacteria 2733
173 Ga0496114_0009105 3300048917 Bacteria 7870
174 Ga0496114_0178154 3300048917 Bacteria 1855
175 Ga0496114_0257960 3300048917 Bacteria 1534
176 Ga0496114_0292772 3300048917 Bacteria 1436
177 Ga0496115_0092203 3300048918 Bacteria 2476
178 Ga0496115_0229186 3300048918 Bacteria 1532
179 Ga0501031_0001660 3300049568 Bacteria 13964
180 Ga0501032_0101039 3300049569 Bacteria 1911
181 Ga0501034_0005747 3300049571 Bacteria 13490
182 Ga0501034_0047329 3300049571 Bacteria 4343
183 Ga0501036_0002593 3300049572 Bacteria 14240
184 Ga0501036_0087884 3300049572 Bacteria 2627
185 Ga0501037_0050553 3300049573 Bacteria 3042
186 Ga0501038_0020014 3300049574 Bacteria 6024
187 Ga0501039_0006187 3300049575 Bacteria 9086
188 Ga0501040_0032428 3300049576 Bacteria 3534
189 Ga0501041_0025235 3300049577 Bacteria 3573
190 Ga0501042_0072914 3300049578 Bacteria 2456
191 Ga0501047_0113742 3300049581 Bacteria 2589
192 Ga0501047_0168907 3300049581 Bacteria 2057
193 Ga0501067_0001135 3300049583 Bacteria 14417
194 Ga0501067_0106616 3300049583 Bacteria 1557
195 Ga0501068_0006784 3300049584 Bacteria 6329
196 Ga0501068_0702496 3300049584 Unclassified 661
197 Ga0501069_0018150 3300049585 Bacteria 3794
198 Ga0501070_0002663 3300049586 Bacteria 15583
199 Ga0501070_0025451 3300049586 Bacteria 4963
200 Ga0501070_0144001 3300049586 Bacteria 1968
201 Ga0501071_0001586 3300049587 Bacteria 13311
202 Ga0501071_0051053 3300049587 Bacteria 2979
203 Ga0501071_0252274 3300049587 Bacteria 1332
204 Ga0501072_0013522 3300049588 Bacteria 6246
205 Ga0501072_0193607 3300049588 Bacteria 1621
206 Ga0501072_0638478 3300049588 Bacteria 838
207 Ga0501073_0001251 3300049589 Bacteria 18591
208 Ga0501074_0004346 3300049590 Bacteria 10124
209 Ga0501074_0101647 3300049590 Bacteria 2058
210 Ga0501075_0047776 3300049591 Bacteria 3216
211 Ga0501075_0325977 3300049591 Bacteria 1170
212 Ga0501076_0097551 3300049592 Bacteria 2367
213 Ga0501077_0170234 3300049593 Bacteria 1384
214 Ga0501079_0040927 3300049741 Bacteria 3576
215 Ga0501080_0002243 3300049742 Bacteria 16800
216 Ga0501080_0032741 3300049742 Bacteria 4849
217 Ga0501081_0080872 3300049743 Bacteria 2275
218 Ga0501081_0684579 3300049743 Bacteria 770
219 Ga0501083_0011162 3300049744 Bacteria 6305
220 Ga0501083_0638221 3300049744 Bacteria 693
221 Ga0501035_0077420 3300049822 Bacteria 2939
222 Ga0501045_0007775 3300049824 Bacteria 7456
223 Ga0501045_0483916 3300049824 Bacteria 919
224 nmdc:mga00v17_563748_c1 3300050491 Bacteria 736
225 nmdc:mga0yw44_10901_c1 3300050492 Bacteria 4660
226 nmdc:mga0yw44_224023_c1 3300050492 Bacteria 1247
227 nmdc:mga0yw44_55958_c1 3300050492 Bacteria 2401
228 nmdc:mga0yw44_93406_c1 3300050492 Bacteria 1905
229 nmdc:mga06z11_211339_c1 3300050494 Bacteria 1131
230 nmdc:mga04h51_91075_c1 3300050495 Bacteria 1097
231 Ga0495595_0064489 3300053084 Bacteria 1722
232 Ga0495619_0021650 3300053085 Bacteria 4106
233 Ga0500556_0003300 3300053104 Bacteria 4787
234 Ga0500593_000046 3300053117 Bacteria 43103
235 Ga0501084_0020013 3300054114 Bacteria 5579
236 Ga0501084_0120663 3300054114 Bacteria 2204
237 Ga0501084_0701098 3300054114 Bacteria 854
238 Ga0501082_0012100 3300060353 Bacteria 7415
239 Ga0501082_0429127 3300060353 Bacteria 1154
240 Ga0501082_0484397 3300060353 Bacteria 1081
241 Ga0530510_0151083 3300061734 Bacteria 1715
242 2643890709 2643221576 Bacteria 5214352
243 2643959765 2643221590 Bacteria 5214697
244 2644032803 2643221604 Bacteria 5014917
245 2644091921 2643221615 Bacteria 5487866
246 2644100727 2643221617 Bacteria 5139111
247 2644117135 2643221620 Bacteria 5134593
248 2644231915 2643221641 Bacteria 4490190
249 2644321724 2643221657 Bacteria 5490246
250 2855390211 2855386786 Bacteria 4752232
251 8054611609 8054609563 Bacteria 5170090
252 Ga0070683_100039542
253 JGI24735J21928_10011706
254 Ga0070658_10027419
255 Ga0070683_100041759
256 Ga0070670_101213674
257 Ga0068869_100132843
258 Ga0070682_100022486
259 Ga0070682_100430570
260 Ga0068868_100220040
261 Ga0070660_100021339
262 Ga0070660_100408011
263 Ga0070687_100117225
264 Ga0070692_10137549
265 Ga0070668_100652411
266 Ga0070675_100696156
267 Ga0070674_100185503
268 Ga0070663_100106765
269 Ga0070678_100028436
270 Ga0070662_100097244
271 Ga0070681_10626625
272 Ga0070681_10774608
273 Ga0070698_100001000
274 Ga0070679_100018987
275 Ga0070679_100528986
276 Ga0070684_100021758
277 Ga0070686_100376677
278 Ga0070693_100018140
279 Ga0070665_100001227
280 Ga0070665_100517651
281 Ga0068855_100229041
282 Ga0070664_100055749
283 Ga0070664_100107160
284 Ga0068857_100016248
285 Ga0068852_100278043
286 Ga0068864_100200304
287 Ga0068866_10223450
288 Ga0068861_100417253
289 Ga0068861_101211657
290 Ga0068860_100393894
291 Ga0068862_100581066
292 Ga0075365_10057096
293 Ga0075365_10062673
294 Ga0075365_10065422
295 Ga0075365_10225589
296 Ga0075365_10407396
297 Ga0075368_10088389
298 Ga0075367_10006975
299 Ga0068865_100124061
300 Ga0105245_10058800
301 Ga0105242_10815183
302 Ga0105242_11550798
303 Ga0105248_10486854
304 Ga0105238_11553515
305 Ga0105239_10002783
306 Ga0105246_10003291
307 Ga0105246_11084002
308 Ga0157371_10081511
309 Ga0157369_10051928
310 Ga0157372_10033741
311 Ga0157372_11740317
312 Ga0157375_10043307
313 Ga0157375_10050519
314 Ga0157375_10235445
315 Ga0157375_10339150
316 Ga0157375_11909813
317 Ga0163163_10132158
318 Ga0163163_10955915
319 Ga0182008_10086639
320 Ga0157377_10060022
321 Ga0157377_10092044
322 Ga0157379_10008077
323 Ga0163161_10226627
324 Ga0163161_10434725
325 Ga0213875_10075183
326 Ga0207642_10181626
327 Ga0207705_10022106
328 Ga0207707_10045696
329 Ga0207662_10273597
330 Ga0207657_10035970
331 Ga0207652_10163621
332 Ga0207659_10697082
333 Ga0207687_10007148
334 Ga0207690_10069864
335 Ga0207706_10142503
336 Ga0207686_10171581
337 Ga0207704_10015582
338 Ga0207704_10184127
339 Ga0207704_10491260
340 Ga0207689_10196423
341 Ga0207661_10129356
342 Ga0207679_10096283
343 Ga0207679_10115408
344 Ga0207667_10066194
345 Ga0207678_10041684
346 Ga0207702_10064200
347 Ga0207674_10050401
348 Ga0207675_100479367
349 Ga0207683_10135034
350 Ga0207683_10210535
351 Ga0209813_10049962
352 Ga0268266_10012438
353 Ga0268266_10152433
354 Ga0268266_10428185
355 Ga0268265_10506346
356 Ga0268264_10018979
357 Ga0307410_10132847
358 Ga0307410_10367710
359 Ga0307407_10111241
360 Ga0307409_100036097
361 Ga0307409_100670338
362 Ga0307409_100692258
363 Ga0307414_10178924
364 Ga0307415_100145583
365 Ga0307415_100310806
366 Ga0373925_0758032
367 Ga0395900_0024369
368 Ga0395905_0035230
369 Ga0395905_1004847
370 Ga0436364_1401875
371 Ga0436365_0637794
372 Ga0466961_0076246
373 Ga0466961_0113589
374 Ga0466961_0117283
375 Ga0466961_0176961
376 Ga0466963_0016871
377 Ga0466963_0051283
378 Ga0466963_0104158
379 Ga0466963_0143014
380 Ga0466963_0442736
381 Ga0466964_0065038
382 Ga0466971_0060369
383 Ga0466970_0207213
384 Ga0466957_0012524
385 Ga0466957_0627878
386 Ga0466960_0000408
387 Ga0466960_0009863
388 Ga0466967_0013579
389 Ga0466967_0025740
390 Ga0466967_0053084
391 Ga0466967_0056427
392 Ga0466967_0061111
393 Ga0466967_0151999
394 Ga0466967_0156512
395 Ga0466967_0248041
396 Ga0495665_0122416
397 Ga0496100_0065192
398 Ga0496100_1183741
399 Ga0496102_0036915
400 Ga0496102_0052738
401 Ga0496102_0092254
402 Ga0496102_0663256
403 Ga0496102_0685030
404 Ga0496104_0016251
405 Ga0496105_0002380
406 Ga0496105_0037072
407 Ga0496106_0711982
408 Ga0496107_0025363
409 Ga0496107_0078295
410 Ga0496107_0716062
411 Ga0496108_0032776
412 Ga0496108_0371949
413 Ga0496109_0006561
414 Ga0496109_0051029
415 Ga0496109_0093945
416 Ga0496109_0236134
417 Ga0496109_0895613
418 Ga0496110_0025137
419 Ga0496110_0569020
420 Ga0496110_1242569
421 Ga0496111_0039898
422 Ga0496111_0588324
423 Ga0496112_0109449
424 Ga0496114_0009105
425 Ga0496114_0178154
426 Ga0496114_0257960
427 Ga0496114_0292772
428 Ga0496115_0092203
429 Ga0496115_0229186
430 Ga0501031_0001660
431 Ga0501032_0101039
432 Ga0501034_0005747
433 Ga0501034_0047329
434 Ga0501036_0002593
435 Ga0501036_0087884
436 Ga0501037_0050553
437 Ga0501038_0020014
438 Ga0501039_0006187
439 Ga0501040_0032428
440 Ga0501041_0025235
441 Ga0501042_0072914
442 Ga0501047_0113742
443 Ga0501047_0168907
444 Ga0501067_0001135
445 Ga0501067_0106616
446 Ga0501068_0006784
447 Ga0501068_0702496
448 Ga0501069_0018150
449 Ga0501070_0002663
450 Ga0501070_0025451
451 Ga0501070_0144001
452 Ga0501071_0001586
453 Ga0501071_0051053
454 Ga0501071_0252274
455 Ga0501072_0013522
456 Ga0501072_0193607
457 Ga0501072_0638478
458 Ga0501073_0001251
459 Ga0501074_0004346
460 Ga0501074_0101647
461 Ga0501075_0047776
462 Ga0501075_0325977
463 Ga0501076_0097551
464 Ga0501077_0170234
465 Ga0501079_0040927
466 Ga0501080_0002243
467 Ga0501080_0032741
468 Ga0501081_0080872
469 Ga0501081_0684579
470 Ga0501083_0011162
471 Ga0501083_0638221
472 Ga0501035_0077420
473 Ga0501045_0007775
474 Ga0501045_0483916
475 nmdc:mga00v17_563748_c1
476 nmdc:mga0yw44_10901_c1
477 nmdc:mga0yw44_224023_c1
478 nmdc:mga0yw44_55958_c1
479 nmdc:mga0yw44_93406_c1
480 nmdc:mga06z11_211339_c1
481 nmdc:mga04h51_91075_c1
482 Ga0495595_0064489
483 Ga0495619_0021650
484 Ga0500556_0003300
485 Ga0500593_000046
486 Ga0501084_0020013
487 Ga0501084_0120663
488 Ga0501084_0701098
489 Ga0501082_0012100
490 Ga0501082_0429127
491 Ga0501082_0484397
492 Ga0530510_0151083
493 2643890709
494 2643959765
495 2644032803
496 2644091921
497 2644100727
498 2644117135
499 2644231915
500 2644321724
501 2855390211
502 8054611609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

5

88

0.92

PF02834

LigT_PEase

LigT like Phosphoesterase

91

171

0.88

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

7

168

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h7f-assembly1.cif.gz_A crystal structure of mn-derivative drcpdase 0.858 2 188
5ldi-assembly4.cif.gz_D crystal structure of e.coli ligt in apo form 0.8569 2 188
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8554 1 188
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8511 1 188
5ldo-assembly3.cif.gz_C crystal structure of e.coli ligt complexed with 3'-amp 0.8475 2 188
ID Description Score Start End Superfamily
5h7fA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.858 2 188 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8486 3 188 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.84 3 188 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8228 1 183 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8148 1 183 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A6L6XSZ9-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9921 1 187 GO:0004113
GO:0008664
AF-A0A6L6XSZ9-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9868 1 187 GO:0004113
GO:0008664
AF-A0A177L5L3-F1-model_v4 deleted 0.9746 2 187
AF-A0A847KIY9-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9679 1 187 GO:0004113
GO:0008664
AF-A0A1Q4B491-F1-model_v4 deleted 0.9618 1 188

Map