F361932

General Info

Members Datasets Scaffolds Average Seq Length
250 170 500 297

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0179216|Ga0501040_0179216_344_1345
Length 333
Sequence VNRAIARLTVDRAIDLTVSPAIGSMASLRGFVLSAAPLIQTSYSDLLLFRRGKVRDVYEVDRDLLIVATDRISAFDYVLGSGIPDKGKVLNQLSAFWFTHLSDVVPNHMITIEADRFPAAVTPHTAELAGRAMLVRRTTPVPVECVARGYLSGSGWKEYAQTGSVCGIRLPAGLHESDRLPEPIFTPATKAESGHDVNISEAEAGAIVGRDVIARLKALTLELYRRGAAHAESRGIIVADTKFEFGFAGGTGPEHLILIDEALTPDSSRFWPKAEYTPGQAQPSFDKQYVRDYLESIHWNKQPPVPALPDDVVLRTRDKYLEAFRLLAGRSLA

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 1.6
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0179216 3300049576 Bacteria 1502
2 Ga0065715_10106689 3300005293 Bacteria 2812
3 Ga0070676_10043353 3300005328 Bacteria 2615
4 Ga0070683_100077175 3300005329 Bacteria 3115
5 Ga0070670_100025244 3300005331 Bacteria 5113
6 Ga0070670_100132771 3300005331 Bacteria 2151
7 Ga0070677_10148242 3300005333 Unclassified 1089
8 Ga0068869_100010968 3300005334 Bacteria 5933
9 Ga0068869_100174915 3300005334 Bacteria 1679
10 Ga0070666_10170390 3300005335 Bacteria 1524
11 Ga0070666_10250886 3300005335 Bacteria 1253
12 Ga0070680_100436335 3300005336 Bacteria 1118
13 Ga0070682_100059831 3300005337 Bacteria 2407
14 Ga0070660_100000291 3300005339 Bacteria 33421
15 Ga0070689_100038621 3300005340 Bacteria 3653
16 Ga0070687_100050576 3300005343 Bacteria 2147
17 Ga0070668_100107005 3300005347 Bacteria 2223
18 Ga0070675_100065814 3300005354 Bacteria 2997
19 Ga0070675_100422002 3300005354 Bacteria 1193
20 Ga0070674_100283736 3300005356 Bacteria 1313
21 Ga0070688_100278603 3300005365 Bacteria 1201
22 Ga0070701_10037013 3300005438 Bacteria 2462
23 Ga0070700_100033574 3300005441 Bacteria 3091
24 Ga0070700_100155085 3300005441 Bacteria 1570
25 Ga0070694_100175766 3300005444 Bacteria 1580
26 Ga0070681_10002630 3300005458 Bacteria 16479
27 Ga0070681_10109812 3300005458 Bacteria 2698
28 Ga0070685_10096454 3300005466 Bacteria 1799
29 Ga0070706_100119243 3300005467 Bacteria 2459
30 Ga0070698_100576864 3300005471 Bacteria 1065
31 Ga0070679_100059379 3300005530 Bacteria 3812
32 Ga0070697_100136288 3300005536 Bacteria 2062
33 Ga0068853_100077861 3300005539 Unclassified 2897
34 Ga0070686_100266757 3300005544 Bacteria 1257
35 Ga0070695_100157463 3300005545 Bacteria 1591
36 Ga0070665_100407975 3300005548 Bacteria 1367
37 Ga0070704_100243454 3300005549 Bacteria 1473
38 Ga0068855_100020503 3300005563 Bacteria 7926
39 Ga0068855_100181446 3300005563 Bacteria 2379
40 Ga0068859_100018595 3300005617 Bacteria 6986
41 Ga0068859_100022013 3300005617 Bacteria 6392
42 Ga0068864_100027609 3300005618 Bacteria 4795
43 Ga0068861_100103949 3300005719 Bacteria 2265
44 Ga0068861_100252776 3300005719 Bacteria 1505
45 Ga0068858_100252753 3300005842 Bacteria 1674
46 Ga0068862_100061266 3300005844 Bacteria 3233
47 Ga0068862_100312778 3300005844 Bacteria 1448
48 Ga0075366_10015537 3300006195 Bacteria 4366
49 Ga0075366_10263534 3300006195 Bacteria 1052
50 Ga0097621_100000059 3300006237 Bacteria 57332
51 Ga0097621_100169992 3300006237 Bacteria 1878
52 Ga0097621_100204296 3300006237 Bacteria 1716
53 Ga0097621_100252525 3300006237 Bacteria 1544
54 Ga0068871_100000122 3300006358 Bacteria 48841
55 Ga0068871_100111453 3300006358 Bacteria 2301
56 Ga0075428_100138512 3300006844 Bacteria 2646
57 Ga0075431_100321354 3300006847 Bacteria 1561
58 Ga0075433_10153059 3300006852 Bacteria 2051
59 Ga0075434_100035211 3300006871 Bacteria 4948
60 Ga0075434_100140759 3300006871 Bacteria 2432
61 Ga0075434_100157165 3300006871 Bacteria 2293
62 Ga0068865_100086778 3300006881 Bacteria 2260
63 Ga0097620_100018595 3300006931 Bacteria 6986
64 Ga0097620_100022011 3300006931 Bacteria 6392
65 Ga0075435_100014009 3300007076 Bacteria 5980
66 Ga0075435_100024856 3300007076 Bacteria 4656
67 Ga0105240_10662430 3300009093 Bacteria 1143
68 Ga0111539_10003691 3300009094 Bacteria 20148
69 Ga0111539_10071256 3300009094 Bacteria 4101
70 Ga0111539_10470009 3300009094 Bacteria 1464
71 Ga0111539_10512779 3300009094 Bacteria 1397
72 Ga0105245_10199453 3300009098 Bacteria 1921
73 Ga0105245_10517686 3300009098 Bacteria 1211
74 Ga0105248_10069036 3300009177 Bacteria 3968
75 Ga0105248_10181145 3300009177 Bacteria 2374
76 Ga0105248_10518982 3300009177 Bacteria 1343
77 Ga0105237_10000003 3300009545 Bacteria 556908
78 Ga0105249_10134786 3300009553 Bacteria 2362
79 Ga0105246_10185675 3300011119 Bacteria 1605
80 Ga0157370_10031776 3300013104 Bacteria 5160
81 Ga0157370_10234029 3300013104 Bacteria 1700
82 Ga0163162_10168723 3300013306 Bacteria 2313
83 Ga0163162_10712263 3300013306 Bacteria 1125
84 Ga0157375_10327227 3300013308 Bacteria 1697
85 Ga0157380_10047697 3300014326 Bacteria 3370
86 Ga0157380_10080663 3300014326 Bacteria 2660
87 Ga0157380_10084427 3300014326 Bacteria 2604
88 Ga0157376_10067283 3300014969 Bacteria 3030
89 Ga0207682_10039525 3300025893 Bacteria 1919
90 Ga0207707_10039977 3300025912 Bacteria 4098
91 Ga0207671_10000012 3300025914 Bacteria 519494
92 Ga0207660_10100003 3300025917 Bacteria 2165
93 Ga0207662_10084249 3300025918 Bacteria 1945
94 Ga0207657_10002343 3300025919 Bacteria 20529
95 Ga0207652_10155075 3300025921 Bacteria 2051
96 Ga0207681_10180625 3300025923 Bacteria 1607
97 Ga0207659_10094933 3300025926 Bacteria 2236
98 Ga0207659_10107974 3300025926 Bacteria 2110
99 Ga0207659_10117488 3300025926 Bacteria 2033
100 Ga0207687_10204778 3300025927 Bacteria 1544
101 Ga0207706_10071463 3300025933 Bacteria 3052
102 Ga0207670_10050937 3300025936 Bacteria 2778
103 Ga0207670_10189447 3300025936 Bacteria 1555
104 Ga0207669_10069892 3300025937 Bacteria 2199
105 Ga0207691_10089675 3300025940 Bacteria 2757
106 Ga0207711_10129566 3300025941 Bacteria 2261
107 Ga0207711_10146123 3300025941 Bacteria 2130
108 Ga0207689_10037374 3300025942 Bacteria 4027
109 Ga0207667_10018775 3300025949 Bacteria 7743
110 Ga0207651_10176115 3300025960 Bacteria 1692
111 Ga0207651_10459401 3300025960 Bacteria 1094
112 Ga0207703_10448225 3300026035 Bacteria 1205
113 Ga0207708_10004012 3300026075 Bacteria 10827
114 Ga0207708_10070876 3300026075 Bacteria 2669
115 Ga0207708_10191932 3300026075 Bacteria 1626
116 Ga0207648_10011460 3300026089 Bacteria 8349
117 Ga0207676_10107882 3300026095 Bacteria 2323
118 Ga0207675_100122445 3300026118 Bacteria 2462
119 Ga0207675_100247892 3300026118 Bacteria 1723
120 Ga0207428_10017141 3300027907 Bacteria 6224
121 Ga0265338_10150912 3300028800 Bacteria 1806
122 Ga0265332_10037332 3300031238 Bacteria 2107
123 Ga0265339_10044698 3300031249 Bacteria 2442
124 Ga0265316_10000657 3300031344 Bacteria 38415
125 Ga0265316_10060733 3300031344 Bacteria 2937
126 Ga0307408_100319511 3300031548 Bacteria 1307
127 Ga0265342_10000176 3300031712 Bacteria 70818
128 Ga0307405_10219278 3300031731 Bacteria 1394
129 Ga0307413_10046189 3300031824 Bacteria 2588
130 Ga0307413_10198142 3300031824 Bacteria 1448
131 Ga0307410_10001587 3300031852 Bacteria 10415
132 Ga0307410_10058159 3300031852 Bacteria 2635
133 Ga0307410_10270576 3300031852 Bacteria 1329
134 Ga0307407_10025022 3300031903 Bacteria 3140
135 Ga0307409_100001740 3300031995 Bacteria 10980
136 Ga0307409_100243821 3300031995 Bacteria 1638
137 Ga0307416_100087664 3300032002 Bacteria 2658
138 Ga0307416_100369771 3300032002 Bacteria 1459
139 Ga0307415_100244307 3300032126 Bacteria 1454
140 Ga0373939_0011732 3300035114 Bacteria 2219
141 Ga0373956_0086110 3300035119 Bacteria 1446
142 Ga0373937_0025058 3300036401 Bacteria 5385
143 Ga0373925_0234857 3300037068 Bacteria 1467
144 Ga0395905_0000536 3300037471 Bacteria 51870
145 Ga0400490_03889 3300038726 Bacteria 2582
146 Ga0451807_1144826 3300041486 Bacteria 1499
147 Ga0439435_0019135 3300042436 Bacteria 1751
148 Ga0451577_0124081 3300042876 Unclassified 2314
149 Ga0453683_0000963 3300044673 Bacteria 27294
150 Ga0453684_0000858 3300044712 Bacteria 102289
151 Ga0451576_0000572 3300045051 Bacteria 78655
152 Ga0451576_0021231 3300045051 Bacteria 7058
153 Ga0451576_0072979 3300045051 Bacteria 3571
154 Ga0451576_0876682 3300045051 Bacteria 942
155 Ga0495592_0052253 3300046454 Bacteria 3035
156 Ga0495653_0055326 3300046463 Bacteria 3028
157 Ga0495608_0052308 3300046511 Bacteria 2704
158 Ga0495642_0093104 3300046528 Bacteria 1277
159 Ga0495598_0006723 3300046537 Bacteria 2608
160 Ga0495621_0007208 3300046539 Bacteria 3284
161 Ga0495645_0016571 3300046543 Bacteria 5266
162 Ga0495633_0022871 3300046558 Bacteria 3102
163 Ga0495667_0073384 3300046559 Bacteria 2229
164 Ga0495599_0027151 3300046678 Bacteria 3589
165 Ga0495669_0007779 3300046684 Bacteria 4499
166 Ga0495600_0120120 3300046809 Bacteria 1709
167 Ga0495600_0187077 3300046809 Bacteria 1333
168 Ga0495677_0023299 3300047445 Bacteria 2248
169 Ga0496104_0041660 3300048907 Bacteria 4307
170 Ga0496105_0268288 3300048908 Bacteria 1379
171 Ga0496115_0090489 3300048918 Bacteria 2500
172 Ga0501031_0003040 3300049568 Bacteria 10721
173 Ga0501032_0007443 3300049569 Bacteria 7995
174 Ga0501033_0034726 3300049570 Bacteria 3780
175 Ga0501034_0080994 3300049571 Bacteria 3249
176 Ga0501036_0006161 3300049572 Bacteria 9729
177 Ga0501036_0172961 3300049572 Bacteria 1819
178 Ga0501037_0004384 3300049573 Bacteria 10248
179 Ga0501038_0004708 3300049574 Bacteria 12691
180 Ga0501039_0036508 3300049575 Bacteria 3793
181 Ga0501039_0070834 3300049575 Bacteria 2708
182 Ga0501040_0044935 3300049576 Unclassified 3012
183 Ga0501040_0238310 3300049576 Bacteria 1296
184 Ga0501041_0048356 3300049577 Bacteria 2591
185 Ga0501042_0009837 3300049578 Bacteria 6387
186 Ga0501042_0021394 3300049578 Bacteria 4508
187 Ga0501042_0074691 3300049578 Bacteria 2426
188 Ga0501043_0170196 3300049579 Bacteria 1699
189 Ga0501046_0002032 3300049580 Bacteria 19220
190 Ga0501047_0022449 3300049581 Bacteria 6059
191 Ga0501047_0161652 3300049581 Bacteria 2111
192 Ga0501048_0098575 3300049582 Bacteria 2061
193 Ga0501048_0103487 3300049582 Unclassified 2009
194 Ga0501048_0125798 3300049582 Bacteria 1812
195 Ga0501067_0098093 3300049583 Bacteria 1628
196 Ga0501068_0021856 3300049584 Bacteria 3738
197 Ga0501069_0001096 3300049585 Bacteria 13057
198 Ga0501069_0001258 3300049585 Bacteria 12418
199 Ga0501070_0010415 3300049586 Bacteria 7860
200 Ga0501070_0023197 3300049586 Bacteria 5198
201 Ga0501071_0005929 3300049587 Bacteria 7904
202 Ga0501071_0018307 3300049587 Bacteria 4848
203 Ga0501072_0036977 3300049588 Bacteria 3829
204 Ga0501073_0000358 3300049589 Bacteria 30865
205 Ga0501073_0003822 3300049589 Bacteria 11298
206 Ga0501073_0004910 3300049589 Bacteria 10040
207 Ga0501074_0005094 3300049590 Bacteria 9436
208 Ga0501074_0201483 3300049590 Bacteria 1418
209 Ga0501075_0127916 3300049591 Bacteria 1934
210 Ga0501075_0128469 3300049591 Bacteria 1930
211 Ga0501076_0050644 3300049592 Bacteria 3286
212 Ga0501076_0167581 3300049592 Unclassified 1790
213 Ga0501077_0051927 3300049593 Bacteria 2604
214 Ga0501077_0150078 3300049593 Bacteria 1479
215 Ga0501079_0002913 3300049741 Bacteria 12495
216 Ga0501079_0076625 3300049741 Bacteria 2586
217 Ga0501079_0084576 3300049741 Bacteria 2454
218 Ga0501079_0125183 3300049741 Bacteria 1999
219 Ga0501080_0104871 3300049742 Bacteria 2621
220 Ga0501080_0183000 3300049742 Bacteria 1928
221 Ga0501080_0203193 3300049742 Bacteria 1818
222 Ga0501081_0039969 3300049743 Bacteria 3211
223 Ga0501083_0001055 3300049744 Bacteria 18371
224 Ga0501035_0017235 3300049822 Bacteria 6658
225 Ga0501044_0120772 3300049823 Bacteria 2621
226 Ga0501045_0013967 3300049824 Bacteria 5684
227 Ga0501045_0052763 3300049824 Bacteria 2970
228 nmdc:mga0k408_9270_c1 3300050493 Bacteria 5303
229 nmdc:mga06r32_201626_c1 3300050510 Bacteria 1977
230 nmdc:mga08y16_116802_c1 3300050511 Bacteria 2778
231 nmdc:mga08y16_201544_c1 3300050511 Bacteria 2062
232 nmdc:mga08y16_336689_c1 3300050511 Bacteria 1551
233 nmdc:mga08y16_57420_c1 3300050511 Bacteria 4068
234 nmdc:mga0n895_234367_c1 3300050512 Bacteria 1863
235 nmdc:mga0n895_51150_c1 3300050512 Bacteria 4053
236 nmdc:mga0n895_51950_c1 3300050512 Bacteria 4023
237 nmdc:mga0rr50_24959_c1 3300050513 Bacteria 4149
238 nmdc:mga08x19_131644_c1 3300050514 Bacteria 1683
239 nmdc:mga0a205_102498_c1 3300050515 Bacteria 2760
240 nmdc:mga0a205_122409_c1 3300050515 Bacteria 2501
241 nmdc:mga0a205_159614_c1 3300050515 Bacteria 2152
242 Ga0495601_0001624 3300053077 Bacteria 12374
243 Ga0495595_0040676 3300053084 Bacteria 2125
244 Ga0495595_0093205 3300053084 Bacteria 1447
245 Ga0495619_0080435 3300053085 Bacteria 2193
246 Ga0495619_0091279 3300053085 Bacteria 2062
247 Ga0500573_0087594 3300053140 Bacteria 1763
248 Ga0501084_0008818 3300054114 Bacteria 8346
249 Ga0501082_0049965 3300060353 Bacteria 3606
250 Ga0530510_0134487 3300061734 Bacteria 1820
251 Ga0501040_0179216
252 Ga0065715_10106689
253 Ga0070676_10043353
254 Ga0070683_100077175
255 Ga0070670_100025244
256 Ga0070670_100132771
257 Ga0070677_10148242
258 Ga0068869_100010968
259 Ga0068869_100174915
260 Ga0070666_10170390
261 Ga0070666_10250886
262 Ga0070680_100436335
263 Ga0070682_100059831
264 Ga0070660_100000291
265 Ga0070689_100038621
266 Ga0070687_100050576
267 Ga0070668_100107005
268 Ga0070675_100065814
269 Ga0070675_100422002
270 Ga0070674_100283736
271 Ga0070688_100278603
272 Ga0070701_10037013
273 Ga0070700_100033574
274 Ga0070700_100155085
275 Ga0070694_100175766
276 Ga0070681_10002630
277 Ga0070681_10109812
278 Ga0070685_10096454
279 Ga0070706_100119243
280 Ga0070698_100576864
281 Ga0070679_100059379
282 Ga0070697_100136288
283 Ga0068853_100077861
284 Ga0070686_100266757
285 Ga0070695_100157463
286 Ga0070665_100407975
287 Ga0070704_100243454
288 Ga0068855_100020503
289 Ga0068855_100181446
290 Ga0068859_100018595
291 Ga0068859_100022013
292 Ga0068864_100027609
293 Ga0068861_100103949
294 Ga0068861_100252776
295 Ga0068858_100252753
296 Ga0068862_100061266
297 Ga0068862_100312778
298 Ga0075366_10015537
299 Ga0075366_10263534
300 Ga0097621_100000059
301 Ga0097621_100169992
302 Ga0097621_100204296
303 Ga0097621_100252525
304 Ga0068871_100000122
305 Ga0068871_100111453
306 Ga0075428_100138512
307 Ga0075431_100321354
308 Ga0075433_10153059
309 Ga0075434_100035211
310 Ga0075434_100140759
311 Ga0075434_100157165
312 Ga0068865_100086778
313 Ga0097620_100018595
314 Ga0097620_100022011
315 Ga0075435_100014009
316 Ga0075435_100024856
317 Ga0105240_10662430
318 Ga0111539_10003691
319 Ga0111539_10071256
320 Ga0111539_10470009
321 Ga0111539_10512779
322 Ga0105245_10199453
323 Ga0105245_10517686
324 Ga0105248_10069036
325 Ga0105248_10181145
326 Ga0105248_10518982
327 Ga0105237_10000003
328 Ga0105249_10134786
329 Ga0105246_10185675
330 Ga0157370_10031776
331 Ga0157370_10234029
332 Ga0163162_10168723
333 Ga0163162_10712263
334 Ga0157375_10327227
335 Ga0157380_10047697
336 Ga0157380_10080663
337 Ga0157380_10084427
338 Ga0157376_10067283
339 Ga0207682_10039525
340 Ga0207707_10039977
341 Ga0207671_10000012
342 Ga0207660_10100003
343 Ga0207662_10084249
344 Ga0207657_10002343
345 Ga0207652_10155075
346 Ga0207681_10180625
347 Ga0207659_10094933
348 Ga0207659_10107974
349 Ga0207659_10117488
350 Ga0207687_10204778
351 Ga0207706_10071463
352 Ga0207670_10050937
353 Ga0207670_10189447
354 Ga0207669_10069892
355 Ga0207691_10089675
356 Ga0207711_10129566
357 Ga0207711_10146123
358 Ga0207689_10037374
359 Ga0207667_10018775
360 Ga0207651_10176115
361 Ga0207651_10459401
362 Ga0207703_10448225
363 Ga0207708_10004012
364 Ga0207708_10070876
365 Ga0207708_10191932
366 Ga0207648_10011460
367 Ga0207676_10107882
368 Ga0207675_100122445
369 Ga0207675_100247892
370 Ga0207428_10017141
371 Ga0265338_10150912
372 Ga0265332_10037332
373 Ga0265339_10044698
374 Ga0265316_10000657
375 Ga0265316_10060733
376 Ga0307408_100319511
377 Ga0265342_10000176
378 Ga0307405_10219278
379 Ga0307413_10046189
380 Ga0307413_10198142
381 Ga0307410_10001587
382 Ga0307410_10058159
383 Ga0307410_10270576
384 Ga0307407_10025022
385 Ga0307409_100001740
386 Ga0307409_100243821
387 Ga0307416_100087664
388 Ga0307416_100369771
389 Ga0307415_100244307
390 Ga0373939_0011732
391 Ga0373956_0086110
392 Ga0373937_0025058
393 Ga0373925_0234857
394 Ga0395905_0000536
395 Ga0400490_03889
396 Ga0451807_1144826
397 Ga0439435_0019135
398 Ga0451577_0124081
399 Ga0453683_0000963
400 Ga0453684_0000858
401 Ga0451576_0000572
402 Ga0451576_0021231
403 Ga0451576_0072979
404 Ga0451576_0876682
405 Ga0495592_0052253
406 Ga0495653_0055326
407 Ga0495608_0052308
408 Ga0495642_0093104
409 Ga0495598_0006723
410 Ga0495621_0007208
411 Ga0495645_0016571
412 Ga0495633_0022871
413 Ga0495667_0073384
414 Ga0495599_0027151
415 Ga0495669_0007779
416 Ga0495600_0120120
417 Ga0495600_0187077
418 Ga0495677_0023299
419 Ga0496104_0041660
420 Ga0496105_0268288
421 Ga0496115_0090489
422 Ga0501031_0003040
423 Ga0501032_0007443
424 Ga0501033_0034726
425 Ga0501034_0080994
426 Ga0501036_0006161
427 Ga0501036_0172961
428 Ga0501037_0004384
429 Ga0501038_0004708
430 Ga0501039_0036508
431 Ga0501039_0070834
432 Ga0501040_0044935
433 Ga0501040_0238310
434 Ga0501041_0048356
435 Ga0501042_0009837
436 Ga0501042_0021394
437 Ga0501042_0074691
438 Ga0501043_0170196
439 Ga0501046_0002032
440 Ga0501047_0022449
441 Ga0501047_0161652
442 Ga0501048_0098575
443 Ga0501048_0103487
444 Ga0501048_0125798
445 Ga0501067_0098093
446 Ga0501068_0021856
447 Ga0501069_0001096
448 Ga0501069_0001258
449 Ga0501070_0010415
450 Ga0501070_0023197
451 Ga0501071_0005929
452 Ga0501071_0018307
453 Ga0501072_0036977
454 Ga0501073_0000358
455 Ga0501073_0003822
456 Ga0501073_0004910
457 Ga0501074_0005094
458 Ga0501074_0201483
459 Ga0501075_0127916
460 Ga0501075_0128469
461 Ga0501076_0050644
462 Ga0501076_0167581
463 Ga0501077_0051927
464 Ga0501077_0150078
465 Ga0501079_0002913
466 Ga0501079_0076625
467 Ga0501079_0084576
468 Ga0501079_0125183
469 Ga0501080_0104871
470 Ga0501080_0183000
471 Ga0501080_0203193
472 Ga0501081_0039969
473 Ga0501083_0001055
474 Ga0501035_0017235
475 Ga0501044_0120772
476 Ga0501045_0013967
477 Ga0501045_0052763
478 nmdc:mga0k408_9270_c1
479 nmdc:mga06r32_201626_c1
480 nmdc:mga08y16_116802_c1
481 nmdc:mga08y16_201544_c1
482 nmdc:mga08y16_336689_c1
483 nmdc:mga08y16_57420_c1
484 nmdc:mga0n895_234367_c1
485 nmdc:mga0n895_51150_c1
486 nmdc:mga0n895_51950_c1
487 nmdc:mga0rr50_24959_c1
488 nmdc:mga08x19_131644_c1
489 nmdc:mga0a205_102498_c1
490 nmdc:mga0a205_122409_c1
491 nmdc:mga0a205_159614_c1
492 Ga0495601_0001624
493 Ga0495595_0040676
494 Ga0495595_0093205
495 Ga0495619_0080435
496 Ga0495619_0091279
497 Ga0500573_0087594
498 Ga0501084_0008818
499 Ga0501082_0049965
500 Ga0530510_0134487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

48

306

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1obd-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9404 5 294
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9388 5 297
2cnv-assembly1.cif.gz_A saicar-synthase from saccharomyces cerevisiae complexed saicar 0.9347 5 294
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9337 5 296
1a48-assembly1.cif.gz_A saicar synthase 0.9306 5 294
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9748 106 247 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9567 106 247 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9486 106 247 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9383 108 239 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9251 106 247 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A3B8RLM1-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9943 2 123 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2V9PDV4-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9939 2 214 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A7Z9Y8X1-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9939 4 102 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-X1PU38-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9932 50 171 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A1F9BMV4-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9925 7 295 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map