F361748

General Info

Members Datasets Scaffolds Average Seq Length
250 159 500 204

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0390006|Ga0436360_0390006_989_1657
Length 222
Sequence MNQTWITATPRARAAPPPLARDLTVDPRRCALIIQDLQNDVIGDGGAFAASGSPAHARSQNVVENVRRVAAAARARGVAVIHVWFVVEPGAPGMTLNAPLFEGVVDNKALVRGSWGAAPVGGLEPQAGDFVVEKMRMSAWEGTRLETILKAAGRDMVIVTGAWTNMSIEHTARTGADKGYFMVVPEDCCSTMNADWHAASIGFALQNVSVVTTADAVARAFG

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20
Rhizosphere 76.8
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0390006 3300039438 Bacteria 2195
2 Ga0070683_100091882 3300005329 Bacteria 2851
3 Ga0070680_100173197 3300005336 Bacteria 1817
4 Ga0070671_100107169 3300005355 Bacteria 2346
5 Ga0070674_100164588 3300005356 Bacteria 1686
6 Ga0070703_10014960 3300005406 Bacteria 2216
7 Ga0070714_100015499 3300005435 Bacteria 6130
8 Ga0070714_100931058 3300005435 Bacteria 844
9 Ga0070713_100063564 3300005436 Bacteria 3095
10 Ga0070710_10062236 3300005437 Bacteria 2128
11 Ga0070700_100057264 3300005441 Bacteria 2446
12 Ga0070694_100107894 3300005444 Bacteria 1979
13 Ga0070708_100601520 3300005445 Bacteria 1037
14 Ga0068867_100462435 3300005459 Bacteria 1083
15 Ga0070706_100021289 3300005467 Bacteria 5972
16 Ga0070706_100026780 3300005467 Bacteria 5303
17 Ga0070707_100115725 3300005468 Bacteria 2602
18 Ga0070707_100542634 3300005468 Bacteria 1125
19 Ga0070707_100684008 3300005468 Bacteria 989
20 Ga0070698_100015650 3300005471 Bacteria 8011
21 Ga0070698_100303652 3300005471 Bacteria 1527
22 Ga0070698_100389444 3300005471 Bacteria 1326
23 Ga0070699_100053182 3300005518 Bacteria 3505
24 Ga0070699_100952486 3300005518 Bacteria 787
25 Ga0070679_100237274 3300005530 Bacteria 1782
26 Ga0070684_100174721 3300005535 Bacteria 1952
27 Ga0070684_100377447 3300005535 Bacteria 1305
28 Ga0070686_100311616 3300005544 Bacteria 1170
29 Ga0070696_100060525 3300005546 Bacteria 2648
30 Ga0070665_100001176 3300005548 Bacteria 32073
31 Ga0070704_100401876 3300005549 Bacteria 1169
32 Ga0068855_100404835 3300005563 Bacteria 1495
33 Ga0068855_100974786 3300005563 Bacteria 892
34 Ga0070664_100403924 3300005564 Bacteria 1250
35 Ga0068856_100176424 3300005614 Bacteria 2149
36 Ga0068856_100322261 3300005614 Bacteria 1563
37 Ga0068856_100341040 3300005614 Bacteria 1517
38 Ga0068870_10040041 3300005840 Bacteria 2428
39 Ga0068870_10184900 3300005840 Bacteria 1254
40 Ga0068858_100321927 3300005842 Bacteria 1478
41 Ga0081455_10044942 3300005937 Bacteria 3847
42 Ga0081455_10105910 3300005937 Bacteria 2246
43 Ga0081455_10194257 3300005937 Bacteria 1526
44 Ga0081539_10007907 3300005985 Bacteria 9479
45 Ga0070717_10081956 3300006028 Bacteria 2710
46 Ga0070716_100189183 3300006173 Bacteria 1358
47 Ga0068865_100117930 3300006881 Bacteria 1968
48 Ga0068865_100658733 3300006881 Bacteria 890
49 Ga0075436_100340433 3300006914 Bacteria 1080
50 Ga0075435_100494789 3300007076 Bacteria 1057
51 Ga0105245_10465407 3300009098 Bacteria 1275
52 Ga0105245_10501782 3300009098 Bacteria 1229
53 Ga0105245_10955058 3300009098 Bacteria 900
54 Ga0114129_10088697 3300009147 Bacteria 4288
55 Ga0105243_10007847 3300009148 Bacteria 8204
56 Ga0105243_10303941 3300009148 Bacteria 1447
57 Ga0105243_10388040 3300009148 Bacteria 1294
58 Ga0105242_10140795 3300009176 Bacteria 2093
59 Ga0105242_10165236 3300009176 Bacteria 1941
60 Ga0105242_10385231 3300009176 Bacteria 1304
61 Ga0105249_10120508 3300009553 Bacteria 2492
62 Ga0105239_10607366 3300010375 Bacteria 1248
63 Ga0105246_10101446 3300011119 Bacteria 2096
64 Ga0157372_11107515 3300013307 Bacteria 916
65 Ga0157375_10129613 3300013308 Bacteria 2640
66 Ga0157375_10328975 3300013308 Bacteria 1693
67 Ga0157375_10633875 3300013308 Bacteria 1226
68 Ga0157375_11991941 3300013308 Bacteria 690
69 Ga0163163_10790468 3300014325 Bacteria 1012
70 Ga0157379_10295059 3300014968 Bacteria 1477
71 Ga0157376_10249875 3300014969 Bacteria 1656
72 Ga0182006_1130411 3300015261 Bacteria 865
73 Ga0213876_10013844 3300021384 Bacteria 4276
74 Ga0213876_10047310 3300021384 Bacteria 2274
75 Ga0207653_10005020 3300025885 Bacteria 4135
76 Ga0207692_10127378 3300025898 Bacteria 1434
77 Ga0207692_10307862 3300025898 Bacteria 966
78 Ga0207692_10614231 3300025898 Bacteria 700
79 Ga0207642_10227332 3300025899 Bacteria 1046
80 Ga0207699_10304769 3300025906 Bacteria 1113
81 Ga0207643_10039724 3300025908 Bacteria 2647
82 Ga0207643_10435365 3300025908 Bacteria 833
83 Ga0207684_10122039 3300025910 Bacteria 2234
84 Ga0207693_10001920 3300025915 Bacteria 18192
85 Ga0207693_10529701 3300025915 Bacteria 919
86 Ga0207652_10116902 3300025921 Bacteria 2369
87 Ga0207652_10249796 3300025921 Bacteria 1600
88 Ga0207646_10020196 3300025922 Bacteria 6175
89 Ga0207646_10199839 3300025922 Bacteria 1806
90 Ga0207659_10197664 3300025926 Bacteria 1604
91 Ga0207687_10074266 3300025927 Bacteria 2437
92 Ga0207687_10316825 3300025927 Bacteria 1261
93 Ga0207664_10460357 3300025929 Bacteria 1136
94 Ga0207709_10016881 3300025935 Bacteria 4067
95 Ga0207709_10066199 3300025935 Bacteria 2275
96 Ga0207709_10302391 3300025935 Bacteria 1190
97 Ga0207709_10563891 3300025935 Bacteria 897
98 Ga0207704_10472290 3300025938 Bacteria 1005
99 Ga0207665_10001869 3300025939 Bacteria 14192
100 Ga0207661_10012443 3300025944 Bacteria 6183
101 Ga0207661_10531225 3300025944 Bacteria 1076
102 Ga0207679_10333516 3300025945 Bacteria 1317
103 Ga0207667_10528301 3300025949 Bacteria 1195
104 Ga0207667_11101738 3300025949 Bacteria 777
105 Ga0207712_10325939 3300025961 Bacteria 1269
106 Ga0207703_10632947 3300026035 Bacteria 1014
107 Ga0207678_10102648 3300026067 Bacteria 2441
108 Ga0207678_10472156 3300026067 Bacteria 1092
109 Ga0207702_11129571 3300026078 Bacteria 778
110 Ga0207674_10574588 3300026116 Bacteria 1089
111 Ga0207675_100101499 3300026118 Bacteria 2711
112 Ga0207683_10120802 3300026121 Bacteria 2352
113 Ga0268266_10007616 3300028379 Bacteria 9748
114 Ga0265319_1006869 3300028563 Bacteria 5197
115 Ga0265334_10086767 3300028573 Unclassified 1147
116 Ga0265318_10003613 3300028577 Bacteria 7729
117 Ga0265318_10007386 3300028577 Bacteria 4972
118 Ga0265338_10005680 3300028800 Bacteria 16151
119 Ga0265330_10077217 3300031235 Bacteria 1437
120 Ga0265325_10012438 3300031241 Bacteria 4866
121 Ga0265339_10036076 3300031249 Unclassified 2769
122 Ga0265327_10038236 3300031251 Unclassified 2620
123 Ga0265314_10027776 3300031711 Bacteria 4230
124 Ga0265342_10041365 3300031712 Unclassified 2791
125 Ga0316576_10117112 3300031727 Bacteria 1999
126 Ga0307416_100043183 3300032002 Bacteria 3528
127 Ga0307416_100770581 3300032002 Unclassified 1056
128 Ga0307415_100223934 3300032126 Bacteria 1510
129 Ga0373951_0075977 3300035091 Bacteria 862
130 Ga0373946_0046193 3300035171 Bacteria 1804
131 Ga0373962_0015505 3300035242 Bacteria 1955
132 Ga0316574_0045511 3300035398 Bacteria 2718
133 Ga0373931_0640291 3300035691 Bacteria 698
134 Ga0395899_0005617 3300037312 Bacteria 9733
135 Ga0395900_0018074 3300037418 Bacteria 7196
136 Ga0395900_0396808 3300037418 Bacteria 1344
137 Ga0395900_1213073 3300037418 Bacteria 670
138 Ga0395898_0015853 3300037466 Bacteria 7722
139 Ga0395905_0006295 3300037471 Bacteria 11971
140 Ga0395905_0034957 3300037471 Bacteria 4717
141 Ga0395901_0054619 3300038443 Bacteria 4151
142 Ga0395901_0171084 3300038443 Bacteria 2279
143 Ga0436365_0407997 3300039437 Bacteria 8912
144 Ga0436365_1572415 3300039437 Bacteria 5603
145 Ga0436363_0055121 3300039450 Bacteria 1403
146 Ga0436363_0208809 3300039450 Bacteria 4090
147 Ga0436363_1212849 3300039450 Bacteria 854
148 Ga0436362_0759340 3300039453 Bacteria 857
149 Ga0436362_1213805 3300039453 Bacteria 975
150 Ga0439465_0189167 3300041413 Bacteria 747
151 Ga0451787_355531 3300041441 Bacteria 1012
152 Ga0451793_1257459 3300041452 Bacteria 1523
153 Ga0451807_1499648 3300041486 Bacteria 3196
154 Ga0439446_0045297 3300042156 Bacteria 1303
155 Ga0439434_0033175 3300042435 Bacteria 1573
156 Ga0495603_0123466 3300046455 Bacteria 1509
157 Ga0495629_0388507 3300046459 Bacteria 949
158 Ga0495641_0171549 3300046461 Bacteria 971
159 Ga0495582_0097617 3300046473 Bacteria 1643
160 Ga0495639_0094137 3300046475 Bacteria 1409
161 Ga0495584_0133295 3300046491 Bacteria 1261
162 Ga0495608_0295126 3300046511 Bacteria 1004
163 Ga0495630_0398230 3300046517 Bacteria 1055
164 Ga0495657_0293852 3300046675 Bacteria 970
165 Ga0495646_0205126 3300046680 Bacteria 1072
166 Ga0495647_0012064 3300046681 Bacteria 2971
167 Ga0495658_0621139 3300046683 Bacteria 692
168 Ga0495613_0177004 3300046689 Bacteria 1512
169 Ga0495604_0332442 3300047317 Bacteria 1013
170 Ga0495674_0136892 3300047319 Bacteria 2060
171 Ga0495676_0121449 3300047321 Bacteria 1900
172 Ga0495676_0148169 3300047321 Bacteria 1674
173 Ga0495680_0018182 3300047322 Bacteria 5977
174 Ga0495680_0182419 3300047322 Bacteria 1514
175 Ga0495680_0252499 3300047322 Bacteria 1250
176 Ga0496100_0250454 3300048903 Bacteria 1310
177 Ga0496100_0479426 3300048903 Bacteria 956
178 Ga0496100_0493296 3300048903 Bacteria 943
179 Ga0496101_0017663 3300048904 Bacteria 4839
180 Ga0496101_0346885 3300048904 Bacteria 1166
181 Ga0496103_0050304 3300048906 Bacteria 2578
182 Ga0496103_0193599 3300048906 Bacteria 1307
183 Ga0496103_0279470 3300048906 Bacteria 1074
184 Ga0496104_0241698 3300048907 Bacteria 1718
185 Ga0496104_0575316 3300048907 Bacteria 1037
186 Ga0496105_0128659 3300048908 Bacteria 2088
187 Ga0496105_0151052 3300048908 Bacteria 1909
188 Ga0496105_0315931 3300048908 Bacteria 1253
189 Ga0496106_0182085 3300048909 Bacteria 1668
190 Ga0496106_0206854 3300048909 Bacteria 1563
191 Ga0496106_0327802 3300048909 Bacteria 1229
192 Ga0496107_0032257 3300048910 Bacteria 3743
193 Ga0496107_0038546 3300048910 Bacteria 3428
194 Ga0496107_0144925 3300048910 Bacteria 1756
195 Ga0496108_0002298 3300048911 Bacteria 15310
196 Ga0496108_0016513 3300048911 Bacteria 6025
197 Ga0496108_0023570 3300048911 Bacteria 5066
198 Ga0496108_0052275 3300048911 Bacteria 3423
199 Ga0496108_0166543 3300048911 Bacteria 1906
200 Ga0496108_0623115 3300048911 Bacteria 939
201 Ga0496109_0006151 3300048912 Bacteria 10089
202 Ga0496109_0018559 3300048912 Bacteria 6111
203 Ga0496109_0018669 3300048912 Bacteria 6095
204 Ga0496109_0020182 3300048912 Bacteria 5887
205 Ga0496109_0334217 3300048912 Bacteria 1430
206 Ga0496110_0005746 3300048913 Bacteria 9742
207 Ga0496110_0038499 3300048913 Bacteria 4161
208 Ga0496110_0042837 3300048913 Bacteria 3951
209 Ga0496110_0157686 3300048913 Bacteria 2056
210 Ga0496110_0467544 3300048913 Bacteria 1149
211 Ga0496111_0001932 3300048914 Bacteria 12266
212 Ga0496111_0465272 3300048914 Bacteria 932
213 Ga0496111_0551066 3300048914 Bacteria 846
214 Ga0496112_0056627 3300048915 Bacteria 3859
215 Ga0496112_0107348 3300048915 Bacteria 2762
216 Ga0496112_0145784 3300048915 Bacteria 2336
217 Ga0496112_0243505 3300048915 Bacteria 1750
218 Ga0496112_0899154 3300048915 Bacteria 807
219 Ga0496113_0382212 3300048916 Bacteria 1130
220 Ga0496114_0092868 3300048917 Bacteria 2565
221 Ga0496114_0116739 3300048917 Bacteria 2292
222 Ga0496114_0212890 3300048917 Bacteria 1695
223 Ga0496126_0057079 3300048929 Bacteria 3527
224 Ga0501036_0306730 3300049572 Bacteria 1327
225 Ga0501038_0147276 3300049574 Bacteria 1922
226 Ga0501040_0073100 3300049576 Bacteria 2369
227 Ga0501040_0491286 3300049576 Bacteria 885
228 Ga0501041_0053350 3300049577 Bacteria 2466
229 Ga0501041_0081806 3300049577 Bacteria 1989
230 Ga0501042_0186759 3300049578 Bacteria 1495
231 Ga0501043_0593388 3300049579 Bacteria 819
232 Ga0501046_0215892 3300049580 Bacteria 1422
233 Ga0501067_0401443 3300049583 Bacteria 764
234 Ga0501069_0101374 3300049585 Bacteria 1634
235 Ga0501071_0185177 3300049587 Bacteria 1561
236 Ga0501072_0051291 3300049588 Bacteria 3249
237 Ga0501072_0133569 3300049588 Bacteria 1979
238 Ga0501075_0083464 3300049591 Bacteria 2420
239 Ga0501076_0867272 3300049592 Bacteria 744
240 Ga0501076_0995541 3300049592 Bacteria 691
241 Ga0501081_0721920 3300049743 Bacteria 748
242 Ga0501045_0026178 3300049824 Bacteria 4194
243 nmdc:mga0rr50_244030_c1 3300050513 Bacteria 1489
244 Ga0495619_0207704 3300053085 Bacteria 1356
245 Ga0501084_0031993 3300054114 Bacteria 4400
246 Ga0501084_0085098 3300054114 Bacteria 2655
247 Ga0501084_0112979 3300054114 Bacteria 2283
248 Ga0501082_0094895 3300060353 Bacteria 2578
249 Ga0501082_0165706 3300060353 Bacteria 1920
250 Ga0530510_0021846 3300061734 Bacteria 4555
251 Ga0436360_0390006
252 Ga0070683_100091882
253 Ga0070680_100173197
254 Ga0070671_100107169
255 Ga0070674_100164588
256 Ga0070703_10014960
257 Ga0070714_100015499
258 Ga0070714_100931058
259 Ga0070713_100063564
260 Ga0070710_10062236
261 Ga0070700_100057264
262 Ga0070694_100107894
263 Ga0070708_100601520
264 Ga0068867_100462435
265 Ga0070706_100021289
266 Ga0070706_100026780
267 Ga0070707_100115725
268 Ga0070707_100542634
269 Ga0070707_100684008
270 Ga0070698_100015650
271 Ga0070698_100303652
272 Ga0070698_100389444
273 Ga0070699_100053182
274 Ga0070699_100952486
275 Ga0070679_100237274
276 Ga0070684_100174721
277 Ga0070684_100377447
278 Ga0070686_100311616
279 Ga0070696_100060525
280 Ga0070665_100001176
281 Ga0070704_100401876
282 Ga0068855_100404835
283 Ga0068855_100974786
284 Ga0070664_100403924
285 Ga0068856_100176424
286 Ga0068856_100322261
287 Ga0068856_100341040
288 Ga0068870_10040041
289 Ga0068870_10184900
290 Ga0068858_100321927
291 Ga0081455_10044942
292 Ga0081455_10105910
293 Ga0081455_10194257
294 Ga0081539_10007907
295 Ga0070717_10081956
296 Ga0070716_100189183
297 Ga0068865_100117930
298 Ga0068865_100658733
299 Ga0075436_100340433
300 Ga0075435_100494789
301 Ga0105245_10465407
302 Ga0105245_10501782
303 Ga0105245_10955058
304 Ga0114129_10088697
305 Ga0105243_10007847
306 Ga0105243_10303941
307 Ga0105243_10388040
308 Ga0105242_10140795
309 Ga0105242_10165236
310 Ga0105242_10385231
311 Ga0105249_10120508
312 Ga0105239_10607366
313 Ga0105246_10101446
314 Ga0157372_11107515
315 Ga0157375_10129613
316 Ga0157375_10328975
317 Ga0157375_10633875
318 Ga0157375_11991941
319 Ga0163163_10790468
320 Ga0157379_10295059
321 Ga0157376_10249875
322 Ga0182006_1130411
323 Ga0213876_10013844
324 Ga0213876_10047310
325 Ga0207653_10005020
326 Ga0207692_10127378
327 Ga0207692_10307862
328 Ga0207692_10614231
329 Ga0207642_10227332
330 Ga0207699_10304769
331 Ga0207643_10039724
332 Ga0207643_10435365
333 Ga0207684_10122039
334 Ga0207693_10001920
335 Ga0207693_10529701
336 Ga0207652_10116902
337 Ga0207652_10249796
338 Ga0207646_10020196
339 Ga0207646_10199839
340 Ga0207659_10197664
341 Ga0207687_10074266
342 Ga0207687_10316825
343 Ga0207664_10460357
344 Ga0207709_10016881
345 Ga0207709_10066199
346 Ga0207709_10302391
347 Ga0207709_10563891
348 Ga0207704_10472290
349 Ga0207665_10001869
350 Ga0207661_10012443
351 Ga0207661_10531225
352 Ga0207679_10333516
353 Ga0207667_10528301
354 Ga0207667_11101738
355 Ga0207712_10325939
356 Ga0207703_10632947
357 Ga0207678_10102648
358 Ga0207678_10472156
359 Ga0207702_11129571
360 Ga0207674_10574588
361 Ga0207675_100101499
362 Ga0207683_10120802
363 Ga0268266_10007616
364 Ga0265319_1006869
365 Ga0265334_10086767
366 Ga0265318_10003613
367 Ga0265318_10007386
368 Ga0265338_10005680
369 Ga0265330_10077217
370 Ga0265325_10012438
371 Ga0265339_10036076
372 Ga0265327_10038236
373 Ga0265314_10027776
374 Ga0265342_10041365
375 Ga0316576_10117112
376 Ga0307416_100043183
377 Ga0307416_100770581
378 Ga0307415_100223934
379 Ga0373951_0075977
380 Ga0373946_0046193
381 Ga0373962_0015505
382 Ga0316574_0045511
383 Ga0373931_0640291
384 Ga0395899_0005617
385 Ga0395900_0018074
386 Ga0395900_0396808
387 Ga0395900_1213073
388 Ga0395898_0015853
389 Ga0395905_0006295
390 Ga0395905_0034957
391 Ga0395901_0054619
392 Ga0395901_0171084
393 Ga0436365_0407997
394 Ga0436365_1572415
395 Ga0436363_0055121
396 Ga0436363_0208809
397 Ga0436363_1212849
398 Ga0436362_0759340
399 Ga0436362_1213805
400 Ga0439465_0189167
401 Ga0451787_355531
402 Ga0451793_1257459
403 Ga0451807_1499648
404 Ga0439446_0045297
405 Ga0439434_0033175
406 Ga0495603_0123466
407 Ga0495629_0388507
408 Ga0495641_0171549
409 Ga0495582_0097617
410 Ga0495639_0094137
411 Ga0495584_0133295
412 Ga0495608_0295126
413 Ga0495630_0398230
414 Ga0495657_0293852
415 Ga0495646_0205126
416 Ga0495647_0012064
417 Ga0495658_0621139
418 Ga0495613_0177004
419 Ga0495604_0332442
420 Ga0495674_0136892
421 Ga0495676_0121449
422 Ga0495676_0148169
423 Ga0495680_0018182
424 Ga0495680_0182419
425 Ga0495680_0252499
426 Ga0496100_0250454
427 Ga0496100_0479426
428 Ga0496100_0493296
429 Ga0496101_0017663
430 Ga0496101_0346885
431 Ga0496103_0050304
432 Ga0496103_0193599
433 Ga0496103_0279470
434 Ga0496104_0241698
435 Ga0496104_0575316
436 Ga0496105_0128659
437 Ga0496105_0151052
438 Ga0496105_0315931
439 Ga0496106_0182085
440 Ga0496106_0206854
441 Ga0496106_0327802
442 Ga0496107_0032257
443 Ga0496107_0038546
444 Ga0496107_0144925
445 Ga0496108_0002298
446 Ga0496108_0016513
447 Ga0496108_0023570
448 Ga0496108_0052275
449 Ga0496108_0166543
450 Ga0496108_0623115
451 Ga0496109_0006151
452 Ga0496109_0018559
453 Ga0496109_0018669
454 Ga0496109_0020182
455 Ga0496109_0334217
456 Ga0496110_0005746
457 Ga0496110_0038499
458 Ga0496110_0042837
459 Ga0496110_0157686
460 Ga0496110_0467544
461 Ga0496111_0001932
462 Ga0496111_0465272
463 Ga0496111_0551066
464 Ga0496112_0056627
465 Ga0496112_0107348
466 Ga0496112_0145784
467 Ga0496112_0243505
468 Ga0496112_0899154
469 Ga0496113_0382212
470 Ga0496114_0092868
471 Ga0496114_0116739
472 Ga0496114_0212890
473 Ga0496126_0057079
474 Ga0501036_0306730
475 Ga0501038_0147276
476 Ga0501040_0073100
477 Ga0501040_0491286
478 Ga0501041_0053350
479 Ga0501041_0081806
480 Ga0501042_0186759
481 Ga0501043_0593388
482 Ga0501046_0215892
483 Ga0501067_0401443
484 Ga0501069_0101374
485 Ga0501071_0185177
486 Ga0501072_0051291
487 Ga0501072_0133569
488 Ga0501075_0083464
489 Ga0501076_0867272
490 Ga0501076_0995541
491 Ga0501081_0721920
492 Ga0501045_0026178
493 nmdc:mga0rr50_244030_c1
494 Ga0495619_0207704
495 Ga0501084_0031993
496 Ga0501084_0085098
497 Ga0501084_0112979
498 Ga0501082_0094895
499 Ga0501082_0165706
500 Ga0530510_0021846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

30

216

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kl2-assembly2.cif.gz_E crystal structure of a putative isochorismatase from streptomyces avermitilis 0.9461 3 202
3kl2-assembly2.cif.gz_E crystal structure of a putative isochorismatase from streptomyces avermitilis 0.9325 3 202
8bln-assembly3.cif.gz_F structure of rutb 0.9131 3 200
8bll-assembly7.cif.gz_L structure of rutb 0.9108 3 202
8bkd-assembly3.cif.gz_E structure of rutb 0.9065 3 201
ID Description Score Start End Superfamily
3kl2C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9469 4 200 3.40.50.850
3kl2C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9287 4 200 3.40.50.850
af_Q2G220_1_186_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9125 7 200 3.40.50.850
af_P75897_5_227_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9088 1 200 3.40.50.850
af_I1L789_3_202_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9028 3 202 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A848T1G6-F1-model_v4 Isochorismatase family protein 0.9896 3 199 GO:0016787
AF-A0A258JNK1-F1-model_v4 Isochorismatase-like domain-containing protein 0.9885 2 202 GO:0016810
AF-A0A368X7I7-F1-model_v4 Nicotinamidase-related amidase 0.9885 3 200 GO:0016810
AF-A0A1I3HAJ9-F1-model_v4 Gluconolactonase 0.9884 3 199 GO:0016787
AF-A0A6I1JDW2-F1-model_v4 Gluconolactonase 0.9883 2 199 GO:0016787

Map