F361664

General Info

Members Datasets Scaffolds Average Seq Length
250 118 217 244

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10006506|Ga0265338_100065069
Length 283
Sequence MQINIKNDDYDIPYPHFIIYLLIIFMNKNKTAMSDSLVIIPTYNEKENIENMVRSILALPKAFDILVIDDGSPDGTGAIVKSLQKASPKSLFLIERKGKQGLGTAYIAGFKWALEREYEYIFEMDADFSHNPEDLIKLYNACHGYGVDLAIGSRYISGVNVVNWPISRVLMSYFASKYVRFILGVSITDTTAGFKCYRRRVLETIDLDSIRFKGYAFQIEMKFTTYKLGFKILEVPIIFVNRVLGTSKMDSGIFGEAVWGVIKLKIYSMFHPVRRAKKLPPAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
9 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
10 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
11 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
12 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
13 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
16 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
17 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
18 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
19 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
20 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
21 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
22 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
23 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
24 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
25 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
26 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
27 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
28 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
29 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
30 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
57 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
81 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
102 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
103 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
104 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
105 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
106 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
107 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
108 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
111 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
112 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
113 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
114 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
115 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
116 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
117 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
118 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.4
Metatranscriptomes 0.4
Isolates 13.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.8
Rhizoplane 2.4
Rhizosphere 82.4
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3028741 2162886007 Bacteria 1778
2 rootL2_10210692 3300003322 Bacteria 4423
3 Ga0055536_1004065 3300003781 Bacteria 7614
4 Ga0065165_1000302 3300005262 Bacteria 82711
5 Ga0065714_10073473 3300005288 Bacteria 3100
6 Ga0065714_10084482 3300005288 Bacteria 2176
7 Ga0065714_10090639 3300005288 Bacteria 1937
8 Ga0065714_10093380 3300005288 Bacteria 1845
9 Ga0065704_10001857 3300005289 Bacteria 6400
10 Ga0065704_10073834 3300005289 Bacteria 6752
11 Ga0065704_10268620 3300005289 Bacteria 948
12 Ga0065715_10099156 3300005293 Bacteria 3450
13 Ga0065715_10100249 3300005293 Bacteria 3323
14 Ga0065715_10179309 3300005293 Bacteria 1487
15 Ga0065715_10317942 3300005293 Bacteria 1007
16 Ga0068868_100147696 3300005338 Bacteria 1934
17 Ga0068855_100086259 3300005563 Bacteria 3630
18 Ga0068855_100748469 3300005563 Bacteria 1042
19 Ga0068856_100455651 3300005614 Unclassified 1300
20 Ga0079104_1000295 3300006946 Bacteria 63135
21 Ga0105251_10032878 3300009011 Bacteria 2580
22 Ga0105244_10000046 3300009036 Bacteria 143184
23 Ga0105243_10000007 3300009148 Bacteria 445042
24 Ga0157373_10000033 3300013100 Bacteria 124744
25 Ga0157371_10109983 3300013102 Bacteria 1956
26 Ga0157370_10002054 3300013104 Bacteria 24695
27 Ga0157370_10004267 3300013104 Bacteria 16464
28 Ga0157370_10007315 3300013104 Bacteria 12047
29 Ga0157370_10085369 3300013104 Bacteria 2965
30 Ga0157370_10179180 3300013104 Bacteria 1969
31 Ga0182006_1012807 3300015261 Bacteria 3660
32 Ga0182006_1037685 3300015261 Bacteria 1915
33 Ga0163161_10000034 3300017792 Bacteria 156805
34 Ga0163161_10045485 3300017792 Bacteria 3166
35 Ga0209676_1000363 3300025292 Bacteria 85613
36 Ga0209050_1025994 3300025298 Bacteria 1973
37 Ga0207655_1000034 3300025728 Bacteria 364737
38 Ga0207709_10000049 3300025935 Bacteria 237124
39 Ga0207665_10241806 3300025939 Bacteria 1330
40 Ga0207667_10076666 3300025949 Bacteria 3469
41 Ga0207667_10078771 3300025949 Bacteria 3415
42 Ga0207677_10199259 3300026023 Bacteria 1590
43 Ga0209281_1000230 3300027111 Bacteria 118190
44 Ga0209968_1000914 3300027526 Bacteria 4572
45 Ga0265323_10009785 3300028653 Bacteria 3902
46 Ga0265323_10043389 3300028653 Bacteria 1624
47 Ga0265322_10021285 3300028654 Bacteria 1858
48 Ga0265322_10055164 3300028654 Bacteria 1127
49 Ga0265338_10003745 3300028800 Bacteria 21128
50 Ga0265338_10006506 3300028800 Bacteria 14850
51 Ga0265327_10032868 3300031251 Bacteria 2900
52 Ga0265327_10035647 3300031251 Bacteria 2747
53 Ga0265327_10181924 3300031251 Bacteria 961
54 Ga0265316_10003574 3300031344 Bacteria 15683
55 Ga0265316_10039253 3300031344 Bacteria 3803
56 Ga0307408_100000477 3300031548 Bacteria 35055
57 Ga0307408_100001431 3300031548 Bacteria 17753
58 Ga0307408_100006420 3300031548 Bacteria 7796
59 Ga0307408_100006474 3300031548 Bacteria 7764
60 Ga0265342_10037036 3300031712 Bacteria 2978
61 Ga0316576_10025262 3300031727 Bacteria 4157
62 Ga0316576_10057122 3300031727 Bacteria 2851
63 Ga0316576_10122877 3300031727 Bacteria 1950
64 Ga0316576_10225249 3300031727 Unclassified 1410
65 Ga0316576_10231130 3300031727 Bacteria 1390
66 Ga0316578_10055954 3300031728 Bacteria 2316
67 Ga0316578_10057154 3300031728 Bacteria 2292
68 Ga0316578_10081019 3300031728 Bacteria 1931
69 Ga0307405_10000004 3300031731 Bacteria 444977
70 Ga0307405_10016259 3300031731 Bacteria 4052
71 Ga0307405_10026968 3300031731 Bacteria 3323
72 Ga0307405_10568969 3300031731 Bacteria 920
73 Ga0316577_10121108 3300031733 Bacteria 1470
74 Ga0316577_10182629 3300031733 Bacteria 1185
75 Ga0307413_10001516 3300031824 Bacteria 8897
76 Ga0307413_10049162 3300031824 Bacteria 2526
77 Ga0307413_10164872 3300031824 Bacteria 1561
78 Ga0307410_10000078 3300031852 Bacteria 33639
79 Ga0307406_10000293 3300031901 Bacteria 29385
80 Ga0307406_10022888 3300031901 Bacteria 3712
81 Ga0307412_10042737 3300031911 Bacteria 2947
82 Ga0307412_10046488 3300031911 Bacteria 2844
83 Ga0307412_10046551 3300031911 Bacteria 2842
84 Ga0307414_10000020 3300032004 Bacteria 228673
85 Ga0307414_10000693 3300032004 Bacteria 17282
86 Ga0307414_10001800 3300032004 Bacteria 11099
87 Ga0307414_10025347 3300032004 Bacteria 3797
88 Ga0307414_10337202 3300032004 Bacteria 1289
89 Ga0307414_10509072 3300032004 Unclassified 1066
90 Ga0307411_10000009 3300032005 Bacteria 319906
91 Ga0307411_10017073 3300032005 Bacteria 4124
92 Ga0307411_10169139 3300032005 Bacteria 1646
93 Ga0307510_10027490 3300033180 Bacteria 6518
94 Ga0316574_0035437 3300035398 Bacteria 3050
95 Ga0316574_0167702 3300035398 Bacteria 1414
96 Ga0316574_0275538 3300035398 Bacteria 1072
97 Ga0316574_0303163 3300035398 Bacteria 1016
98 Ga0316582_0104733 3300036647 Bacteria 1877
99 Ga0316582_0109868 3300036647 Bacteria 1834
100 Ga0316584_0097479 3300036712 Bacteria 2201
101 Ga0316584_0097529 3300036712 Bacteria 2201
102 Ga0316584_0106372 3300036712 Bacteria 2099
103 Ga0316584_0170708 3300036712 Bacteria 1613
104 Ga0316584_0445158 3300036712 Bacteria 917
105 Ga0316584_0642510 3300036712 Bacteria 732
106 Ga0395898_0349136 3300037466 Unclassified 1411
107 Ga0400490_45272 3300038726 Bacteria 21907
108 Ga0439447_000063 3300041407 Bacteria 37978
109 Ga0439466_0001173 3300041411 Bacteria 10208
110 Ga0451791_0361109 3300041451 Bacteria 1177
111 Ga0451795_0116521 3300041456 Bacteria 1429
112 Ga0451795_1167483 3300041456 Bacteria 2041
113 Ga0451795_1585736 3300041456 Bacteria 2064
114 Ga0451807_2241744 3300041486 Bacteria 1025
115 Ga0451855_0453387 3300041511 Bacteria 1010
116 Ga0451855_1122875 3300041511 Bacteria 998
117 Ga0451577_0000072 3300042876 Bacteria 237934
118 Ga0451577_0000299 3300042876 Bacteria 96341
119 Ga0451577_0001144 3300042876 Bacteria 37489
120 Ga0451577_0005531 3300042876 Bacteria 12883
121 Ga0451577_0035634 3300042876 Bacteria 4482
122 Ga0451577_0043330 3300042876 Bacteria 4031
123 Ga0451577_0068667 3300042876 Bacteria 3160
124 Ga0451577_0112230 3300042876 Bacteria 2439
125 Ga0451577_0178235 3300042876 Bacteria 1916
126 Ga0451577_0218921 3300042876 Bacteria 1721
127 Ga0451577_0226159 3300042876 Bacteria 1691
128 Ga0451577_0252297 3300042876 Bacteria 1597
129 Ga0451577_0630581 3300042876 Bacteria 972
130 Ga0451577_0696194 3300042876 Bacteria 920
131 Ga0453683_0000224 3300044673 Bacteria 75668
132 Ga0453683_0000765 3300044673 Bacteria 32116
133 Ga0453683_0000962 3300044673 Bacteria 27319
134 Ga0453683_0002425 3300044673 Bacteria 14479
135 Ga0453683_0003428 3300044673 Bacteria 11686
136 Ga0453683_0012089 3300044673 Bacteria 5668
137 Ga0453683_0012818 3300044673 Bacteria 5486
138 Ga0453683_0055798 3300044673 Bacteria 2472
139 Ga0453683_0144732 3300044673 Bacteria 1500
140 Ga0453683_0211781 3300044673 Bacteria 1231
141 Ga0453683_0236367 3300044673 Bacteria 1163
142 Ga0453683_0265782 3300044673 Bacteria 1094
143 Ga0453683_0341923 3300044673 Bacteria 960
144 Ga0453683_0397320 3300044673 Bacteria 888
145 Ga0453683_0462142 3300044673 Bacteria 821
146 Ga0453684_0000138 3300044712 Bacteria 321864
147 Ga0453684_0000186 3300044712 Bacteria 273302
148 Ga0453684_0000259 3300044712 Bacteria 227264
149 Ga0453684_0000448 3300044712 Bacteria 166223
150 Ga0453684_0000721 3300044712 Bacteria 116843
151 Ga0453684_0000935 3300044712 Bacteria 96528
152 Ga0453684_0001471 3300044712 Bacteria 66489
153 Ga0453684_0006936 3300044712 Bacteria 21221
154 Ga0453684_0009186 3300044712 Bacteria 17380
155 Ga0453684_0012104 3300044712 Bacteria 14319
156 Ga0453684_0013990 3300044712 Bacteria 12924
157 Ga0453684_0025717 3300044712 Bacteria 8535
158 Ga0453684_0028366 3300044712 Bacteria 7989
159 Ga0453684_0044747 3300044712 Bacteria 5916
160 Ga0453684_0049415 3300044712 Archaea 5547
161 Ga0453684_0060423 3300044712 Bacteria 4874
162 Ga0453684_0064694 3300044712 Bacteria 4670
163 Ga0453684_0065902 3300044712 Bacteria 4615
164 Ga0453684_0154381 3300044712 Bacteria 2724
165 Ga0453684_0211029 3300044712 Bacteria 2257
166 Ga0453684_0281225 3300044712 Bacteria 1897
167 Ga0453684_0371923 3300044712 Bacteria 1606
168 Ga0453684_0376612 3300044712 Bacteria 1595
169 Ga0453684_0437733 3300044712 Bacteria 1457
170 Ga0453684_0484784 3300044712 Bacteria 1371
171 Ga0453684_0582559 3300044712 Unclassified 1228
172 Ga0453684_0839708 3300044712 Bacteria 988
173 Ga0451576_0000065 3300045051 Bacteria 274445
174 Ga0451576_0000433 3300045051 Bacteria 96361
175 Ga0451576_0000549 3300045051 Bacteria 80496
176 Ga0451576_0003692 3300045051 Bacteria 20735
177 Ga0451576_0006033 3300045051 Bacteria 14961
178 Ga0451576_0017489 3300045051 Bacteria 7882
179 Ga0451576_0017961 3300045051 Bacteria 7763
180 Ga0451576_0021067 3300045051 Bacteria 7091
181 Ga0451576_0024767 3300045051 Bacteria 6476
182 Ga0451576_0031787 3300045051 Bacteria 5625
183 Ga0451576_0070467 3300045051 Bacteria 3639
184 Ga0451576_0124800 3300045051 Bacteria 2682
185 Ga0451576_0175833 3300045051 Bacteria 2235
186 Ga0451576_0210638 3300045051 Bacteria 2030
187 Ga0451576_0260542 3300045051 Bacteria 1812
188 Ga0451576_0295426 3300045051 Bacteria 1694
189 Ga0451576_0459820 3300045051 Bacteria 1336
190 Ga0451576_0478740 3300045051 Bacteria 1307
191 Ga0495610_0156522 3300046512 Bacteria 967
192 Ga0495616_0007588 3300046513 Bacteria 6490
193 Ga0495625_0174911 3300046660 Bacteria 1431
194 Ga0496115_0005290 3300048918 Bacteria 9387
195 Ga0496125_0000072 3300048928 Bacteria 238328
196 Ga0496126_0004269 3300048929 Bacteria 17192
197 Ga0501314_001560 3300049530 Bacteria 1674
198 Ga0501036_0160670 3300049572 Bacteria 1894
199 Ga0501040_0128734 3300049576 Bacteria 1779
200 Ga0501047_0026461 3300049581 Bacteria 5581
201 Ga0501217_036717 3300049661 Bacteria 1231
202 Ga0501238_000010 3300049671 Bacteria 33061
203 Ga0501238_005248 3300049671 Bacteria 1638
204 Ga0501249_000007 3300049679 Bacteria 198318
205 Ga0501249_001298 3300049679 Bacteria 5201
206 Ga0501225_0018451 3300049705 Bacteria 1934
207 Ga0501241_005087 3300049758 Bacteria 2457
208 Ga0501266_000013 3300049763 Bacteria 183849
209 Ga0501269_001207 3300049766 Bacteria 3515
210 Ga0501280_000947 3300049776 Bacteria 6063
211 Ga0501035_0404983 3300049822 Bacteria 1134
212 Ga0500641_0000022 3300053096 Bacteria 114746
213 Ga0500641_0000131 3300053096 Bacteria 28128
214 Ga0500594_0057116 3300053118 Bacteria 1115
215 Ga0500658_0000005 3300053134 Bacteria 369268
216 Ga0500622_0099865 3300053156 Bacteria 1430
217 Ga0500584_075593 3300053726 Bacteria 1457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0642510 Ga0316584_0642510_12_680 218
2 3300005563 Ga0068855_100748469 Ga0068855_1007484691 220
3 3300044673 Ga0453683_0265782 Ga0453683_0265782_399_1076 221
4 3300042876 Ga0451577_0043330 Ga0451577_0043330_305_991 222
5 3300044673 Ga0453683_0341923 Ga0453683_0341923_240_920 222
6 3300044712 Ga0453684_0009186 Ga0453684_0009186_11201_11887 222
7 3300028653 Ga0265323_10043389 Ga0265323_100433891 225
8 3300031251 Ga0265327_10181924 Ga0265327_101819242 232
9 3300044712 Ga0453684_0154381 Ga0453684_0154381_352_1068 235
10 iso_pu_bacteria 2522125168 2522553696 236
11 iso_pu_bacteria 2833640130 2833641300 236
12 3300005338 Ga0068868_100147696 Ga0068868_1001476962 237
13 3300005563 Ga0068855_100086259 Ga0068855_1000862593 237
14 3300005614 Ga0068856_100455651 Ga0068856_1004556511 237
15 3300025949 Ga0207667_10076666 Ga0207667_100766663 237
16 3300025949 Ga0207667_10078771 Ga0207667_100787713 237
17 3300026023 Ga0207677_10199259 Ga0207677_101992592 237
18 3300031251 Ga0265327_10035647 Ga0265327_100356472 237
19 iso_pu_bacteria 2513020052 2513236270 237
20 iso_pu_bacteria 2643221600 2644012676 237
21 iso_pu_bacteria 2643221716 2644641861 237
22 iso_pu_bacteria 2643221725 2644682031 237
23 iso_pu_bacteria 2738541279 2738735454 237
24 iso_pu_bacteria 2738541285 2738768031 237
25 iso_pu_bacteria 2738543007 2739217036 237
26 iso_pu_bacteria 2739367866 2740034142 237
27 iso_pu_bacteria 2802428842 2802654983 237
28 iso_pu_bacteria 2881359912 2881360992 237
29 iso_pu_bacteria 2904555929 2904557320 237
30 iso_pu_bacteria 2919191525 2919194800 237
31 iso_pu_bacteria 2919509842 2919510551 237
32 iso_pu_bacteria 2919683626 2919685346 237
33 iso_pu_bacteria 2929150217 2929150842 237
34 iso_pu_bacteria 2965320100 2965321686 237
35 iso_pu_bacteria 2977268062 2977272220 237
36 iso_pu_bacteria 3003233435 3003235382 237
37 iso_pu_bacteria 8054307821 8054308760 237
38 iso_pu_bacteria 8055419101 8055420604 237
39 iso_pu_bacteria 8055592153 8055597273 237
40 iso_pu_bacteria 8056440228 8056440693 237
41 3300028653 Ga0265323_10009785 Ga0265323_100097853 238
42 3300028654 Ga0265322_10021285 Ga0265322_100212851 238
43 3300028654 Ga0265322_10055164 Ga0265322_100551641 238
44 3300036712 Ga0316584_0445158 Ga0316584_0445158_151_867 238
45 iso_pu_bacteria 2884634485 2884635385 238
46 iso_pu_bacteria 2890737413 2890740467 238
47 iso_pu_bacteria 2919692658 2919695681 238
48 3300005288 Ga0065714_10090639 Ga0065714_100906392 239
49 3300005288 Ga0065714_10093380 Ga0065714_100933802 239
50 3300031733 Ga0316577_10182629 Ga0316577_101826291 239
51 3300032004 Ga0307414_10337202 Ga0307414_103372022 239
52 3300032005 Ga0307411_10017073 Ga0307411_100170732 239
53 3300036712 Ga0316584_0170708 Ga0316584_0170708_19_753 239
54 3300042876 Ga0451577_0035634 Ga0451577_0035634_511_1239 239
55 3300042876 Ga0451577_0068667 Ga0451577_0068667_1842_2570 239
56 3300042876 Ga0451577_0226159 Ga0451577_0226159_397_1125 239
57 3300044673 Ga0453683_0002425 Ga0453683_0002425_419_1147 239
58 3300044673 Ga0453683_0055798 Ga0453683_0055798_473_1201 239
59 3300044673 Ga0453683_0211781 Ga0453683_0211781_174_902 239
60 3300044673 Ga0453683_0397320 Ga0453683_0397320_25_750 239
61 3300044673 Ga0453683_0462142 Ga0453683_0462142_19_747 239
62 3300044712 Ga0453684_0000259 Ga0453684_0000259_1851_2579 239
63 3300044712 Ga0453684_0049415 Ga0453684_0049415_2385_3113 239
64 3300044712 Ga0453684_0437733 Ga0453684_0437733_272_1000 239
65 3300044712 Ga0453684_0484784 Ga0453684_0484784_490_1218 239
66 3300045051 Ga0451576_0003692 Ga0451576_0003692_4753_5493 239
67 3300045051 Ga0451576_0006033 Ga0451576_0006033_11849_12577 239
68 3300045051 Ga0451576_0021067 Ga0451576_0021067_5626_6354 239
69 3300045051 Ga0451576_0024767 Ga0451576_0024767_2352_3080 239
70 3300045051 Ga0451576_0124800 Ga0451576_0124800_1206_1934 239
71 3300003322 rootL2_10210692 rootL2_102106923 240
72 3300003781 Ga0055536_1004065 Ga0055536_10040659 240
73 3300005262 Ga0065165_1000302 Ga0065165_100030241 240
74 3300005289 Ga0065704_10001857 Ga0065704_100018574 240
75 3300009148 Ga0105243_10000007 Ga0105243_10000007200 240
76 3300013102 Ga0157371_10109983 Ga0157371_101099832 240
77 3300013104 Ga0157370_10179180 Ga0157370_101791802 240
78 3300017792 Ga0163161_10045485 Ga0163161_100454852 240
79 3300025292 Ga0209676_1000363 Ga0209676_100036377 240
80 3300025298 Ga0209050_1025994 Ga0209050_10259942 240
81 3300025935 Ga0207709_10000049 Ga0207709_10000049193 240
82 3300027526 Ga0209968_1000914 Ga0209968_10009145 240
83 3300031344 Ga0265316_10003574 Ga0265316_100035742 240
84 3300031344 Ga0265316_10039253 Ga0265316_100392533 240
85 3300031548 Ga0307408_100001431 Ga0307408_1000014312 240
86 3300031548 Ga0307408_100006420 Ga0307408_1000064203 240
87 3300031548 Ga0307408_100006474 Ga0307408_1000064744 240
88 3300031712 Ga0265342_10037036 Ga0265342_100370362 240
89 3300031727 Ga0316576_10025262 Ga0316576_100252622 240
90 3300031727 Ga0316576_10122877 Ga0316576_101228772 240
91 3300031731 Ga0307405_10026968 Ga0307405_100269683 240
92 3300031731 Ga0307405_10568969 Ga0307405_105689691 240
93 3300031911 Ga0307412_10042737 Ga0307412_100427373 240
94 3300031911 Ga0307412_10046551 Ga0307412_100465512 240
95 3300032004 Ga0307414_10001800 Ga0307414_100018004 240
96 3300038726 Ga0400490_45272 Ga0400490_45272_1022_1750 240
97 3300041511 Ga0451855_0453387 Ga0451855_0453387_47_784 240
98 3300042876 Ga0451577_0630581 Ga0451577_0630581_35_775 240
99 3300044712 Ga0453684_0006936 Ga0453684_0006936_349_1137 240
100 3300044712 Ga0453684_0012104 Ga0453684_0012104_4421_5158 240
101 3300044712 Ga0453684_0013990 Ga0453684_0013990_5965_6735 240
102 3300044712 Ga0453684_0025717 Ga0453684_0025717_1584_2312 240
103 3300044712 Ga0453684_0028366 Ga0453684_0028366_6845_7585 240
104 3300044712 Ga0453684_0060423 Ga0453684_0060423_2921_3661 240
105 3300044712 Ga0453684_0065902 Ga0453684_0065902_3646_4380 240
106 3300044712 Ga0453684_0281225 Ga0453684_0281225_493_1221 240
107 3300044712 Ga0453684_0376612 Ga0453684_0376612_633_1379 240
108 3300044712 Ga0453684_0582559 Ga0453684_0582559_478_1215 240
109 3300044712 Ga0453684_0839708 Ga0453684_0839708_154_891 240
110 3300045051 Ga0451576_0070467 Ga0451576_0070467_2469_3206 240
111 3300045051 Ga0451576_0175833 Ga0451576_0175833_1085_1825 240
112 3300045051 Ga0451576_0210638 Ga0451576_0210638_962_1732 240
113 3300045051 Ga0451576_0478740 Ga0451576_0478740_387_1124 240
114 3300046513 Ga0495616_0007588 Ga0495616_0007588_3923_4645 240
115 3300048918 Ga0496115_0005290 Ga0496115_0005290_4537_5259 240
116 3300048928 Ga0496125_0000072 Ga0496125_0000072_181195_181917 240
117 3300048929 Ga0496126_0004269 Ga0496126_0004269_363_1085 240
118 3300049705 Ga0501225_0018451 Ga0501225_0018451_600_1361 240
119 2162886007 SwRhRL2b_contig_3028741 SwRhRL2b_0765.00007020 241
120 3300005288 Ga0065714_10073473 Ga0065714_100734733 241
121 3300005288 Ga0065714_10084482 Ga0065714_100844821 241
122 3300005289 Ga0065704_10073834 Ga0065704_100738344 241
123 3300005289 Ga0065704_10268620 Ga0065704_102686201 241
124 3300005293 Ga0065715_10099156 Ga0065715_100991561 241
125 3300005293 Ga0065715_10100249 Ga0065715_101002493 241
126 3300005293 Ga0065715_10179309 Ga0065715_101793091 241
127 3300005293 Ga0065715_10317942 Ga0065715_103179421 241
128 3300006946 Ga0079104_1000295 Ga0079104_100029527 241
129 3300009011 Ga0105251_10032878 Ga0105251_100328783 241
130 3300009036 Ga0105244_10000046 Ga0105244_1000004625 241
131 3300013100 Ga0157373_10000033 Ga0157373_1000003376 241
132 3300013104 Ga0157370_10002054 Ga0157370_100020542 241
133 3300013104 Ga0157370_10004267 Ga0157370_1000426715 241
134 3300013104 Ga0157370_10007315 Ga0157370_100073159 241
135 3300013104 Ga0157370_10085369 Ga0157370_100853693 241
136 3300015261 Ga0182006_1012807 Ga0182006_10128073 241
137 3300015261 Ga0182006_1037685 Ga0182006_10376853 241
138 3300017792 Ga0163161_10000034 Ga0163161_1000003452 241
139 3300025728 Ga0207655_1000034 Ga0207655_1000034240 241
140 3300025939 Ga0207665_10241806 Ga0207665_102418062 241
141 3300027111 Ga0209281_1000230 Ga0209281_100023083 241
142 3300028800 Ga0265338_10003745 Ga0265338_100037455 241
143 3300028800 Ga0265338_10006506 Ga0265338_100065069 241
144 3300031251 Ga0265327_10032868 Ga0265327_100328683 241
145 3300031548 Ga0307408_100000477 Ga0307408_10000047713 241
146 3300031727 Ga0316576_10057122 Ga0316576_100571222 241
147 3300031727 Ga0316576_10225249 Ga0316576_102252491 241
148 3300031727 Ga0316576_10231130 Ga0316576_102311302 241
149 3300031728 Ga0316578_10055954 Ga0316578_100559542 241
150 3300031728 Ga0316578_10057154 Ga0316578_100571542 241
151 3300031728 Ga0316578_10081019 Ga0316578_100810192 241
152 3300031731 Ga0307405_10000004 Ga0307405_10000004217 241
153 3300031731 Ga0307405_10016259 Ga0307405_100162592 241
154 3300031733 Ga0316577_10121108 Ga0316577_101211082 241
155 3300031824 Ga0307413_10001516 Ga0307413_100015167 241
156 3300031824 Ga0307413_10049162 Ga0307413_100491622 241
157 3300031824 Ga0307413_10164872 Ga0307413_101648722 241
158 3300031852 Ga0307410_10000078 Ga0307410_1000007813 241
159 3300031901 Ga0307406_10000293 Ga0307406_1000029327 241
160 3300031901 Ga0307406_10022888 Ga0307406_100228884 241
161 3300031911 Ga0307412_10046488 Ga0307412_100464882 241
162 3300032004 Ga0307414_10000020 Ga0307414_1000002071 241
163 3300032004 Ga0307414_10000693 Ga0307414_100006938 241
164 3300032004 Ga0307414_10025347 Ga0307414_100253472 241
165 3300032004 Ga0307414_10509072 Ga0307414_105090722 241
166 3300032005 Ga0307411_10000009 Ga0307411_10000009203 241
167 3300032005 Ga0307411_10169139 Ga0307411_101691392 241
168 3300033180 Ga0307510_10027490 Ga0307510_100274905 241
169 3300035398 Ga0316574_0035437 Ga0316574_0035437_453_1193 241
170 3300035398 Ga0316574_0167702 Ga0316574_0167702_651_1394 241
171 3300035398 Ga0316574_0275538 Ga0316574_0275538_77_814 241
172 3300035398 Ga0316574_0303163 Ga0316574_0303163_98_835 241
173 3300036647 Ga0316582_0104733 Ga0316582_0104733_542_1282 241
174 3300036647 Ga0316582_0109868 Ga0316582_0109868_1011_1775 241
175 3300036712 Ga0316584_0097479 Ga0316584_0097479_241_981 241
176 3300036712 Ga0316584_0097529 Ga0316584_0097529_640_1383 241
177 3300036712 Ga0316584_0106372 Ga0316584_0106372_700_1437 241
178 3300037466 Ga0395898_0349136 Ga0395898_0349136_623_1372 241
179 3300041407 Ga0439447_000063 Ga0439447_000063_27906_28679 241
180 3300041411 Ga0439466_0001173 Ga0439466_0001173_59_802 241
181 3300041451 Ga0451791_0361109 Ga0451791_0361109_147_872 241
182 3300041456 Ga0451795_0116521 Ga0451795_0116521_580_1308 241
183 3300041456 Ga0451795_1167483 Ga0451795_1167483_349_1077 241
184 3300041456 Ga0451795_1585736 Ga0451795_1585736_295_1035 241
185 3300041486 Ga0451807_2241744 Ga0451807_2241744_39_776 241
186 3300041511 Ga0451855_1122875 Ga0451855_1122875_209_934 241
187 3300042876 Ga0451577_0000072 Ga0451577_0000072_51765_52505 241
188 3300042876 Ga0451577_0000299 Ga0451577_0000299_493_1230 241
189 3300042876 Ga0451577_0001144 Ga0451577_0001144_26232_26978 241
190 3300042876 Ga0451577_0005531 Ga0451577_0005531_2117_2869 241
191 3300042876 Ga0451577_0112230 Ga0451577_0112230_1391_2158 241
192 3300042876 Ga0451577_0178235 Ga0451577_0178235_998_1726 241
193 3300042876 Ga0451577_0218921 Ga0451577_0218921_639_1376 241
194 3300042876 Ga0451577_0252297 Ga0451577_0252297_168_905 241
195 3300042876 Ga0451577_0696194 Ga0451577_0696194_37_774 241
196 3300044673 Ga0453683_0000224 Ga0453683_0000224_55938_56678 241
197 3300044673 Ga0453683_0000765 Ga0453683_0000765_534_1271 241
198 3300044673 Ga0453683_0000962 Ga0453683_0000962_911_1648 241
199 3300044673 Ga0453683_0003428 Ga0453683_0003428_10906_11649 241
200 3300044673 Ga0453683_0012089 Ga0453683_0012089_3005_3748 241
201 3300044673 Ga0453683_0012818 Ga0453683_0012818_1087_1830 241
202 3300044673 Ga0453683_0144732 Ga0453683_0144732_575_1321 241
203 3300044673 Ga0453683_0236367 Ga0453683_0236367_85_822 241
204 3300044712 Ga0453684_0000138 Ga0453684_0000138_249938_250675 241
205 3300044712 Ga0453684_0000186 Ga0453684_0000186_220798_221538 241
206 3300044712 Ga0453684_0000448 Ga0453684_0000448_144497_145243 241
207 3300044712 Ga0453684_0000721 Ga0453684_0000721_53607_54359 241
208 3300044712 Ga0453684_0000935 Ga0453684_0000935_728_1465 241
209 3300044712 Ga0453684_0001471 Ga0453684_0001471_21367_22107 241
210 3300044712 Ga0453684_0044747 Ga0453684_0044747_4303_5046 241
211 3300044712 Ga0453684_0064694 Ga0453684_0064694_1652_2380 241
212 3300044712 Ga0453684_0211029 Ga0453684_0211029_370_1110 241
213 3300044712 Ga0453684_0371923 Ga0453684_0371923_538_1275 241
214 3300045051 Ga0451576_0000065 Ga0451576_0000065_221941_222681 241
215 3300045051 Ga0451576_0000433 Ga0451576_0000433_513_1250 241
216 3300045051 Ga0451576_0000549 Ga0451576_0000549_20981_21727 241
217 3300045051 Ga0451576_0017489 Ga0451576_0017489_5112_5849 241
218 3300045051 Ga0451576_0017961 Ga0451576_0017961_6630_7373 241
219 3300045051 Ga0451576_0031787 Ga0451576_0031787_4355_5092 241
220 3300045051 Ga0451576_0260542 Ga0451576_0260542_364_1107 241
221 3300045051 Ga0451576_0295426 Ga0451576_0295426_702_1463 241
222 3300045051 Ga0451576_0459820 Ga0451576_0459820_508_1245 241
223 3300046512 Ga0495610_0156522 Ga0495610_0156522_101_826 241
224 3300046660 Ga0495625_0174911 Ga0495625_0174911_125_868 241
225 3300049530 Ga0501314_001560 Ga0501314_001560_54_797 241
226 3300049572 Ga0501036_0160670 Ga0501036_0160670_413_1138 241
227 3300049576 Ga0501040_0128734 Ga0501040_0128734_804_1532 241
228 3300049581 Ga0501047_0026461 Ga0501047_0026461_127_852 241
229 3300049661 Ga0501217_036717 Ga0501217_036717_426_1157 241
230 3300049671 Ga0501238_000010 Ga0501238_000010_16706_17449 241
231 3300049671 Ga0501238_005248 Ga0501238_005248_640_1404 241
232 3300049679 Ga0501249_000007 Ga0501249_000007_46382_47107 241
233 3300049679 Ga0501249_001298 Ga0501249_001298_2610_3383 241
234 3300049758 Ga0501241_005087 Ga0501241_005087_829_1572 241
235 3300049763 Ga0501266_000013 Ga0501266_000013_85113_85886 241
236 3300049766 Ga0501269_001207 Ga0501269_001207_1198_1941 241
237 3300049776 Ga0501280_000947 Ga0501280_000947_927_1670 241
238 3300049822 Ga0501035_0404983 Ga0501035_0404983_135_860 241
239 3300053096 Ga0500641_0000022 Ga0500641_0000022_31811_32554 241
240 3300053096 Ga0500641_0000131 Ga0500641_0000131_5655_6380 241
241 3300053118 Ga0500594_0057116 Ga0500594_0057116_373_1098 241
242 3300053134 Ga0500658_0000005 Ga0500658_0000005_93744_94517 241
243 3300053156 Ga0500622_0099865 Ga0500622_0099865_46_822 241
244 3300053726 Ga0500584_075593 Ga0500584_075593_298_1023 241
245 iso_pu_bacteria 2643221667 2644370548 241
246 iso_pu_bacteria 2739367857 2740003787 241
247 iso_pu_bacteria 2739367858 2740008604 241
248 iso_pu_bacteria 2857613821 2857616551 241
249 iso_pu_bacteria 2857618242 2857622736 241
250 iso_pu_bacteria 2904419702 2904421704 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

37

206

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.875 4 232
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8417 4 240
2bo4-assembly1.cif.gz_A dissection of mannosylglycerate synthase: an archetypal mannosyltransferase 0.8089 5 233
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7965 4 240
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.794 3 230
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9602 2 239 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9447 2 239 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8836 4 229 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8828 6 234 3.90.550.10
af_A0A0R0GWU7_24_252_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8799 4 226 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A076NWL3-F1-model_v4 deleted 0.9959 1 241
AF-A0A354S739-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9951 1 238 GO:0004582
GO:0009247
GO:0016020
AF-A0A076NWL3-F1-model_v4 deleted 0.9918 1 241
AF-A0A6N4EAQ1-F1-model_v4 deleted 0.9901 4 113
AF-A0A7V3CZJ5-F1-model_v4 Polyprenol monophosphomannose synthase 0.9897 118 240 GO:0004582
GO:0009247
GO:0016020

Feature Viewer

pLDDT pTM Quality
91.29 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map