F361649

General Info

Members Datasets Scaffolds Average Seq Length
250 138 244 135

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_11022620|Ga0207648_110226202
Length 154
Sequence MLVVVVDTEAEFDWEALRAQAVEAMGHAYAPYSHFPVGAAAMVDDGRVVTGCNVENAAYGVTLCAECGVVSQLHITGGGRLTHFVCVDGRGAVIMPCGRCRQLLWENGGAELLLWTVSGVKPMTEVLPDAFGPEDLVRVEPVETTAGKAGTQDG

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
4 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
5 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
6 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
7 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
78 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
135 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0.4
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.8
Nodule 0
Rhizoplane 7.6
Rhizosphere 62
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001262 3300000549 Bacteria 3814
2 JGI24735J21928_10166653 3300002067 Bacteria 637
3 Ga0070683_100292602 3300005329 Bacteria 1549
4 Ga0070670_101056168 3300005331 Bacteria 740
5 Ga0070682_100667082 3300005337 Bacteria 830
6 Ga0070660_100052316 3300005339 Bacteria 3149
7 Ga0070668_100768688 3300005347 Bacteria 854
8 Ga0070668_101015123 3300005347 Bacteria 746
9 Ga0070674_100574268 3300005356 Bacteria 949
10 Ga0070659_100052767 3300005366 Bacteria 3198
11 Ga0070667_100220029 3300005367 Bacteria 1690
12 Ga0070679_100094878 3300005530 Bacteria 2971
13 Ga0070679_100641637 3300005530 Bacteria 1005
14 Ga0070684_100077547 3300005535 Bacteria 2935
15 Ga0070684_100403265 3300005535 Bacteria 1261
16 Ga0070672_101740226 3300005543 Bacteria 560
17 Ga0070665_100000523 3300005548 Bacteria 54648
18 Ga0070664_100291381 3300005564 Bacteria 1474
19 Ga0070664_101503413 3300005564 Bacteria 637
20 Ga0068852_102341043 3300005616 Bacteria 555
21 Ga0068864_101146243 3300005618 Bacteria 775
22 Ga0068860_100001163 3300005843 Bacteria 28791
23 Ga0081455_10275615 3300005937 Bacteria 1218
24 Ga0081539_10010915 3300005985 Bacteria 7290
25 Ga0075365_10003292 3300006038 Bacteria 8282
26 Ga0075365_10009148 3300006038 Bacteria 5676
27 Ga0075365_10032571 3300006038 Bacteria 3352
28 Ga0075365_10054335 3300006038 Bacteria 2655
29 Ga0075365_10059346 3300006038 Bacteria 2549
30 Ga0075365_10073113 3300006038 Bacteria 2310
31 Ga0075365_10081415 3300006038 Bacteria 2193
32 Ga0075365_10136022 3300006038 Bacteria 1703
33 Ga0075365_10216815 3300006038 Bacteria 1342
34 Ga0075365_10218869 3300006038 Bacteria 1336
35 Ga0075365_10246096 3300006038 Bacteria 1256
36 Ga0075365_10273710 3300006038 Bacteria 1188
37 Ga0075365_10282187 3300006038 Bacteria 1169
38 Ga0075365_10302596 3300006038 Bacteria 1125
39 Ga0075365_10867853 3300006038 Bacteria 636
40 Ga0075365_10900869 3300006038 Bacteria 624
41 Ga0075365_11180254 3300006038 Bacteria 539
42 Ga0075368_10083018 3300006042 Bacteria 1305
43 Ga0075363_100038360 3300006048 Bacteria 2519
44 Ga0075364_10044248 3300006051 Bacteria 2895
45 Ga0075364_10054921 3300006051 Bacteria 2605
46 Ga0075364_10103440 3300006051 Bacteria 1896
47 Ga0075364_10155138 3300006051 Bacteria 1544
48 Ga0075364_10233928 3300006051 Bacteria 1248
49 Ga0075367_10071708 3300006178 Bacteria 2084
50 Ga0075367_10262723 3300006178 Bacteria 1084
51 Ga0075367_10501835 3300006178 Bacteria 770
52 Ga0075367_10601653 3300006178 Bacteria 699
53 Ga0075370_10053695 3300006353 Bacteria 2287
54 Ga0075370_10168071 3300006353 Bacteria 1289
55 Ga0075370_10284168 3300006353 Bacteria 983
56 Ga0068871_101127765 3300006358 Bacteria 734
57 Ga0111539_12310769 3300009094 Bacteria 624
58 Ga0111539_12676401 3300009094 Bacteria 578
59 Ga0105245_10534186 3300009098 Bacteria 1193
60 Ga0105245_10955785 3300009098 Bacteria 900
61 Ga0105243_10319150 3300009148 Bacteria 1415
62 Ga0105243_10370117 3300009148 Bacteria 1322
63 Ga0105242_10375084 3300009176 Bacteria 1321
64 Ga0105248_12408064 3300009177 Bacteria 600
65 Ga0105246_10098821 3300011119 Bacteria 2121
66 Ga0163162_11180110 3300013306 Bacteria 868
67 Ga0157372_12191444 3300013307 Bacteria 635
68 Ga0157372_12362512 3300013307 Bacteria 610
69 Ga0157375_10302343 3300013308 Bacteria 1763
70 Ga0157375_10600774 3300013308 Bacteria 1259
71 Ga0157375_11799762 3300013308 Bacteria 726
72 Ga0163163_10749930 3300014325 Bacteria 1040
73 Ga0163163_11276846 3300014325 Bacteria 796
74 Ga0157380_10335098 3300014326 Bacteria 1409
75 Ga0182008_10157725 3300014497 Bacteria 1141
76 Ga0157377_11274842 3300014745 Bacteria 573
77 Ga0163161_10710101 3300017792 Bacteria 838
78 Ga0206353_11405182 3300020082 Bacteria 1564
79 Ga0207662_10152746 3300025918 Bacteria 1470
80 Ga0207657_10005110 3300025919 Bacteria 13745
81 Ga0207652_10126842 3300025921 Bacteria 2274
82 Ga0207652_10490336 3300025921 Bacteria 1106
83 Ga0207650_10587123 3300025925 Bacteria 936
84 Ga0207650_11023196 3300025925 Bacteria 703
85 Ga0207687_10106759 3300025927 Bacteria 2070
86 Ga0207687_11327393 3300025927 Bacteria 618
87 Ga0207690_10022657 3300025932 Bacteria 3909
88 Ga0207669_10524253 3300025937 Bacteria 952
89 Ga0207691_10383232 3300025940 Bacteria 1200
90 Ga0207661_10061601 3300025944 Bacteria 3032
91 Ga0207667_10147141 3300025949 Bacteria 2425
92 Ga0207658_10183968 3300025986 Bacteria 1731
93 Ga0207648_11022620 3300026089 Bacteria 774
94 Ga0207683_10368257 3300026121 Bacteria 1320
95 Ga0209813_10075594 3300027866 Bacteria 1104
96 Ga0268266_10000866 3300028379 Bacteria 39366
97 Ga0268266_10079186 3300028379 Bacteria 2861
98 Ga0268264_10000246 3300028381 Bacteria 102361
99 Ga0307405_10855066 3300031731 Bacteria 766
100 Ga0307407_10464224 3300031903 Bacteria 921
101 Ga0307412_10027725 3300031911 Bacteria 3536
102 Ga0307412_11526072 3300031911 Bacteria 608
103 Ga0307409_100508848 3300031995 Bacteria 1174
104 Ga0307409_100548533 3300031995 Bacteria 1134
105 Ga0307409_101248010 3300031995 Bacteria 767
106 Ga0307416_100185181 3300032002 Bacteria 1956
107 Ga0307416_100631153 3300032002 Bacteria 1154
108 Ga0307415_100134769 3300032126 Bacteria 1876
109 Ga0307415_100217766 3300032126 Bacteria 1528
110 Ga0307415_100277527 3300032126 Bacteria 1376
111 Ga0395900_0340027 3300037418 Bacteria 1477
112 Ga0395900_0340719 3300037418 Bacteria 1475
113 Ga0395898_0056241 3300037466 Bacteria 3835
114 Ga0395898_0460567 3300037466 Bacteria 1211
115 Ga0436364_0974287 3300037853 Bacteria 1034
116 Ga0395901_0186659 3300038443 Bacteria 2174
117 Ga0395901_0498773 3300038443 Bacteria 1240
118 Ga0395901_0547253 3300038443 Bacteria 1173
119 Ga0439447_040569 3300041407 Bacteria 1136
120 Ga0439466_0203003 3300041411 Bacteria 603
121 Ga0439465_0037536 3300041413 Bacteria 1558
122 Ga0451800_0884432 3300041459 Bacteria 577
123 Ga0451841_1349447 3300041498 Bacteria 757
124 Ga0451853_3948641 3300041512 Bacteria 544
125 Ga0439446_0034484 3300042156 Bacteria 1473
126 Ga0466966_0004148 3300044684 Bacteria 9565
127 Ga0466961_0026982 3300044693 Bacteria 3692
128 Ga0466970_0357106 3300044765 Bacteria 830
129 Ga0466970_0569523 3300044765 Bacteria 655
130 Ga0466960_0005126 3300044901 Bacteria 5184
131 Ga0466960_0009530 3300044901 Bacteria 4007
132 Ga0466960_0060049 3300044901 Bacteria 1862
133 Ga0466960_0172658 3300044901 Bacteria 1167
134 Ga0466960_0351927 3300044901 Bacteria 840
135 Ga0466967_0832102 3300045976 Bacteria 917
136 Ga0495603_0022557 3300046455 Bacteria 3810
137 Ga0496104_0919638 3300048907 Bacteria 780
138 Ga0496105_0830769 3300048908 Bacteria 700
139 Ga0496108_0125181 3300048911 Bacteria 2206
140 Ga0496108_0413126 3300048911 Bacteria 1179
141 Ga0496108_1305070 3300048911 Bacteria 610
142 Ga0496109_0236355 3300048912 Bacteria 1719
143 Ga0496109_0237784 3300048912 Bacteria 1714
144 Ga0496109_0859079 3300048912 Bacteria 845
145 Ga0496110_0016248 3300048913 Bacteria 6211
146 Ga0496110_0067926 3300048913 Bacteria 3155
147 Ga0496110_0687564 3300048913 Bacteria 924
148 Ga0496110_1099597 3300048913 Bacteria 703
149 Ga0496111_0048758 3300048914 Bacteria 3052
150 Ga0496111_0060987 3300048914 Bacteria 2734
151 Ga0496111_0317150 3300048914 Bacteria 1155
152 Ga0496112_0525061 3300048915 Bacteria 1118
153 Ga0496114_0286502 3300048917 Bacteria 1453
154 Ga0496114_0964974 3300048917 Bacteria 735
155 Ga0496124_0608556 3300048927 Bacteria 709
156 Ga0501032_0741627 3300049569 Bacteria 622
157 Ga0501033_0801855 3300049570 Bacteria 637
158 Ga0501034_1138332 3300049571 Bacteria 660
159 Ga0501034_1248441 3300049571 Bacteria 621
160 Ga0501036_0166849 3300049572 Bacteria 1856
161 Ga0501036_0198193 3300049572 Bacteria 1689
162 Ga0501036_0772450 3300049572 Bacteria 792
163 Ga0501038_0098999 3300049574 Bacteria 2431
164 Ga0501038_0632063 3300049574 Bacteria 807
165 Ga0501039_0311689 3300049575 Bacteria 1237
166 Ga0501040_0031359 3300049576 Bacteria 3592
167 Ga0501042_0064231 3300049578 Bacteria 2623
168 Ga0501042_0448750 3300049578 Bacteria 935
169 Ga0501046_0773380 3300049580 Bacteria 674
170 Ga0501048_0013369 3300049582 Bacteria 6092
171 Ga0501067_0005453 3300049583 Bacteria 7060
172 Ga0501068_0007289 3300049584 Bacteria 6127
173 Ga0501068_0098686 3300049584 Bacteria 1809
174 Ga0501068_0268539 3300049584 Bacteria 1089
175 Ga0501069_0373055 3300049585 Bacteria 842
176 Ga0501069_0600920 3300049585 Bacteria 660
177 Ga0501069_0813835 3300049585 Bacteria 566
178 Ga0501070_0101664 3300049586 Bacteria 2377
179 Ga0501070_0144543 3300049586 Bacteria 1963
180 Ga0501071_0145039 3300049587 Bacteria 1769
181 Ga0501071_0190261 3300049587 Bacteria 1539
182 Ga0501071_0461498 3300049587 Bacteria 973
183 Ga0501071_0705149 3300049587 Bacteria 777
184 Ga0501071_1040147 3300049587 Bacteria 633
185 Ga0501072_0007666 3300049588 Bacteria 8193
186 Ga0501072_0057004 3300049588 Bacteria 3078
187 Ga0501072_0798778 3300049588 Bacteria 739
188 Ga0501073_0001939 3300049589 Bacteria 15417
189 Ga0501074_0000537 3300049590 Bacteria 23318
190 Ga0501076_0010126 3300049592 Bacteria 6983
191 Ga0501076_0931280 3300049592 Bacteria 716
192 Ga0501077_0156685 3300049593 Bacteria 1445
193 Ga0501077_1022115 3300049593 Bacteria 532
194 Ga0501079_1014794 3300049741 Bacteria 654
195 Ga0501079_1148631 3300049741 Bacteria 612
196 Ga0501080_0001967 3300049742 Bacteria 17734
197 Ga0501081_0128728 3300049743 Bacteria 1808
198 Ga0501083_0003581 3300049744 Bacteria 10889
199 Ga0501083_0942550 3300049744 Bacteria 562
200 Ga0501035_0064910 3300049822 Bacteria 3244
201 Ga0501035_0139576 3300049822 Bacteria 2108
202 Ga0501044_0736361 3300049823 Bacteria 869
203 Ga0501045_0661643 3300049824 Bacteria 772
204 nmdc:mga03n38_243758_c1 3300050490 Bacteria 947
205 nmdc:mga00v17_136213_c1 3300050491 Bacteria 1572
206 nmdc:mga00v17_234733_c1 3300050491 Bacteria 1189
207 nmdc:mga00v17_30696_c1 3300050491 Bacteria 3163
208 nmdc:mga0yw44_101502_c1 3300050492 Bacteria 1833
209 nmdc:mga0yw44_1186637_c1 3300050492 Bacteria 515
210 nmdc:mga0yw44_200243_c1 3300050492 Bacteria 1319
211 nmdc:mga0yw44_210688_c1 3300050492 Bacteria 1285
212 nmdc:mga0yw44_245859_c1 3300050492 Bacteria 1190
213 nmdc:mga0yw44_287415_c1 3300050492 Bacteria 1100
214 nmdc:mga0yw44_382939_c1 3300050492 Bacteria 950
215 nmdc:mga0yw44_40591_c1 3300050492 Bacteria 2766
216 nmdc:mga0yw44_409994_c1 3300050492 Bacteria 917
217 nmdc:mga0yw44_425638_c1 3300050492 Bacteria 899
218 nmdc:mga0yw44_58469_c1 3300050492 Bacteria 2355
219 nmdc:mga0yw44_716392_c1 3300050492 Bacteria 680
220 nmdc:mga0yw44_7945_c1 3300050492 Bacteria 5257
221 nmdc:mga0yw44_853392_c1 3300050492 Bacteria 618
222 nmdc:mga0yw44_92104_c1 3300050492 Bacteria 1918
223 nmdc:mga0yw44_9244_c1 3300050492 Bacteria 4964
224 nmdc:mga06z11_137547_c1 3300050494 Bacteria 1378
225 nmdc:mga06z11_24885_c1 3300050494 Bacteria 1224
226 nmdc:mga04h51_12938_c2 3300050495 Bacteria 1105
227 nmdc:mga04h51_22511_c1 3300050495 Bacteria 1908
228 nmdc:mga04h51_230645_c1 3300050495 Bacteria 736
229 nmdc:mga07m45_206599_c1 3300050496 Bacteria 1142
230 nmdc:mga07m45_28931_c2 3300050496 Bacteria 1630
231 nmdc:mga07m45_795396_c1 3300050496 Bacteria 542
232 Ga0500644_0001430 3300053088 Bacteria 6333
233 Ga0500651_0695245 3300053093 Bacteria 544
234 Ga0500641_0013963 3300053096 Bacteria 2958
235 Ga0500556_0001104 3300053104 Bacteria 13459
236 Ga0500593_000444 3300053117 Bacteria 16324
237 Ga0500573_0036535 3300053140 Bacteria 2836
238 Ga0500573_0564054 3300053140 Bacteria 501
239 Ga0501084_0003341 3300054114 Bacteria 12995
240 Ga0501084_0186271 3300054114 Bacteria 1752
241 Ga0501084_1065837 3300054114 Bacteria 679
242 Ga0501082_0021817 3300060353 Bacteria 5520
243 Ga0501082_0705982 3300060353 Bacteria 883
244 Ga0530510_0681202 3300061734 Bacteria 783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10044248 Ga0075364_100442483 116
2 3300006353 Ga0075370_10053695 Ga0075370_100536951 116
3 3300050491 nmdc:mga00v17_30696_c1 nmdc:mga00v17_30696_c1_432_857 116
4 3300050495 nmdc:mga04h51_230645_c1 nmdc:mga04h51_230645_c1_231_656 116
5 3300050496 nmdc:mga07m45_28931_c2 nmdc:mga07m45_28931_c2_304_729 116
6 3300005329 Ga0070683_100292602 Ga0070683_1002926022 127
7 3300005564 Ga0070664_101503413 Ga0070664_1015034131 127
8 3300006051 Ga0075364_10155138 Ga0075364_101551382 127
9 3300006358 Ga0068871_101127765 Ga0068871_1011277652 127
10 3300009094 Ga0111539_12676401 Ga0111539_126764011 127
11 3300014325 Ga0163163_10749930 Ga0163163_107499302 127
12 3300025925 Ga0207650_10587123 Ga0207650_105871232 127
13 3300031911 Ga0307412_11526072 Ga0307412_115260722 127
14 3300031995 Ga0307409_100508848 Ga0307409_1005088482 127
15 3300031995 Ga0307409_101248010 Ga0307409_1012480102 127
16 3300032002 Ga0307416_100185181 Ga0307416_1001851812 127
17 3300032126 Ga0307415_100217766 Ga0307415_1002177662 127
18 3300037418 Ga0395900_0340719 Ga0395900_0340719_224_616 127
19 3300041498 Ga0451841_1349447 Ga0451841_1349447_108_494 127
20 3300044765 Ga0466970_0569523 Ga0466970_0569523_144_530 127
21 3300045976 Ga0466967_0832102 Ga0466967_0832102_41_430 127
22 3300048913 Ga0496110_0687564 Ga0496110_0687564_476_871 127
23 3300049569 Ga0501032_0741627 Ga0501032_0741627_140_532 127
24 3300049570 Ga0501033_0801855 Ga0501033_0801855_167_580 127
25 3300049572 Ga0501036_0198193 Ga0501036_0198193_350_742 127
26 3300049574 Ga0501038_0098999 Ga0501038_0098999_710_1102 127
27 3300049576 Ga0501040_0031359 Ga0501040_0031359_909_1301 127
28 3300049578 Ga0501042_0064231 Ga0501042_0064231_1035_1427 127
29 3300049582 Ga0501048_0013369 Ga0501048_0013369_3396_3788 127
30 3300049584 Ga0501068_0268539 Ga0501068_0268539_156_548 127
31 3300049586 Ga0501070_0144543 Ga0501070_0144543_255_659 127
32 3300049587 Ga0501071_0145039 Ga0501071_0145039_379_771 127
33 3300049587 Ga0501071_0461498 Ga0501071_0461498_108_509 127
34 3300049592 Ga0501076_0010126 Ga0501076_0010126_1991_2383 127
35 3300049741 Ga0501079_1148631 Ga0501079_1148631_195_587 127
36 3300049743 Ga0501081_0128728 Ga0501081_0128728_743_1135 127
37 3300049744 Ga0501083_0942550 Ga0501083_0942550_60_476 127
38 3300049822 Ga0501035_0139576 Ga0501035_0139576_977_1369 127
39 3300049824 Ga0501045_0661643 Ga0501045_0661643_92_508 127
40 3300050491 nmdc:mga00v17_136213_c1 nmdc:mga00v17_136213_c1_182_586 127
41 3300053117 Ga0500593_000444 Ga0500593_000444_11232_11618 127
42 3300054114 Ga0501084_0186271 Ga0501084_0186271_358_750 127
43 3300061734 Ga0530510_0681202 Ga0530510_0681202_233_625 127
44 iso_pu_bacteria 2554235005 2554256613 127
45 iso_pu_bacteria 2643221615 2644090441 127
46 iso_pu_bacteria 2643221657 2644323431 127
47 iso_pu_bacteria 2857481737 2857483876 127
48 3300002067 JGI24735J21928_10166653 JGI24735J21928_101666532 129
49 3300005339 Ga0070660_100052316 Ga0070660_1000523163 129
50 3300005366 Ga0070659_100052767 Ga0070659_1000527672 129
51 3300005530 Ga0070679_100641637 Ga0070679_1006416372 129
52 3300005548 Ga0070665_100000523 Ga0070665_10000052326 129
53 3300005937 Ga0081455_10275615 Ga0081455_102756152 129
54 3300006038 Ga0075365_10218869 Ga0075365_102188692 129
55 3300006038 Ga0075365_10246096 Ga0075365_102460962 129
56 3300006038 Ga0075365_10302596 Ga0075365_103025962 129
57 3300006178 Ga0075367_10501835 Ga0075367_105018352 129
58 3300009098 Ga0105245_10955785 Ga0105245_109557852 129
59 3300014325 Ga0163163_11276846 Ga0163163_112768462 129
60 3300025919 Ga0207657_10005110 Ga0207657_1000511012 129
61 3300025927 Ga0207687_10106759 Ga0207687_101067592 129
62 3300025932 Ga0207690_10022657 Ga0207690_100226573 129
63 3300025949 Ga0207667_10147141 Ga0207667_101471413 129
64 3300028379 Ga0268266_10000866 Ga0268266_1000086614 129
65 3300031731 Ga0307405_10855066 Ga0307405_108550662 129
66 3300032002 Ga0307416_100631153 Ga0307416_1006311532 129
67 3300032126 Ga0307415_100277527 Ga0307415_1002775272 129
68 3300037418 Ga0395900_0340027 Ga0395900_0340027_452_862 129
69 3300041407 Ga0439447_040569 Ga0439447_040569_247_642 129
70 3300041411 Ga0439466_0203003 Ga0439466_0203003_42_437 129
71 3300041413 Ga0439465_0037536 Ga0439465_0037536_541_936 129
72 3300042156 Ga0439446_0034484 Ga0439446_0034484_118_513 129
73 3300048907 Ga0496104_0919638 Ga0496104_0919638_320_730 129
74 3300048913 Ga0496110_1099597 Ga0496110_1099597_255_650 129
75 3300048914 Ga0496111_0317150 Ga0496111_0317150_632_1027 129
76 3300049584 Ga0501068_0098686 Ga0501068_0098686_1138_1548 129
77 3300049585 Ga0501069_0600920 Ga0501069_0600920_97_507 129
78 3300050492 nmdc:mga0yw44_245859_c1 nmdc:mga0yw44_245859_c1_633_1028 129
79 3300050492 nmdc:mga0yw44_287415_c1 nmdc:mga0yw44_287415_c1_237_653 129
80 3300053088 Ga0500644_0001430 Ga0500644_0001430_4106_4522 129
81 3300000549 LJQas_1001262 LJQas_10012623 130
82 3300005331 Ga0070670_101056168 Ga0070670_1010561681 130
83 3300005337 Ga0070682_100667082 Ga0070682_1006670822 130
84 3300005347 Ga0070668_100768688 Ga0070668_1007686882 130
85 3300005347 Ga0070668_101015123 Ga0070668_1010151232 130
86 3300005356 Ga0070674_100574268 Ga0070674_1005742682 130
87 3300005367 Ga0070667_100220029 Ga0070667_1002200292 130
88 3300005530 Ga0070679_100094878 Ga0070679_1000948782 130
89 3300005535 Ga0070684_100077547 Ga0070684_1000775472 130
90 3300005535 Ga0070684_100403265 Ga0070684_1004032652 130
91 3300005543 Ga0070672_101740226 Ga0070672_1017402262 130
92 3300005564 Ga0070664_100291381 Ga0070664_1002913811 130
93 3300005616 Ga0068852_102341043 Ga0068852_1023410431 130
94 3300005618 Ga0068864_101146243 Ga0068864_1011462432 130
95 3300005843 Ga0068860_100001163 Ga0068860_10000116310 130
96 3300005985 Ga0081539_10010915 Ga0081539_100109152 130
97 3300006038 Ga0075365_10003292 Ga0075365_1000329210 130
98 3300006038 Ga0075365_10009148 Ga0075365_100091484 130
99 3300006038 Ga0075365_10032571 Ga0075365_100325713 130
100 3300006038 Ga0075365_10054335 Ga0075365_100543353 130
101 3300006038 Ga0075365_10059346 Ga0075365_100593462 130
102 3300006038 Ga0075365_10073113 Ga0075365_100731132 130
103 3300006038 Ga0075365_10081415 Ga0075365_100814153 130
104 3300006038 Ga0075365_10136022 Ga0075365_101360222 130
105 3300006038 Ga0075365_10216815 Ga0075365_102168152 130
106 3300006038 Ga0075365_10273710 Ga0075365_102737102 130
107 3300006038 Ga0075365_10282187 Ga0075365_102821872 130
108 3300006038 Ga0075365_10867853 Ga0075365_108678532 130
109 3300006038 Ga0075365_10900869 Ga0075365_109008692 130
110 3300006038 Ga0075365_11180254 Ga0075365_111802542 130
111 3300006042 Ga0075368_10083018 Ga0075368_100830182 130
112 3300006048 Ga0075363_100038360 Ga0075363_1000383602 130
113 3300006051 Ga0075364_10054921 Ga0075364_100549213 130
114 3300006051 Ga0075364_10103440 Ga0075364_101034402 130
115 3300006051 Ga0075364_10233928 Ga0075364_102339282 130
116 3300006178 Ga0075367_10071708 Ga0075367_100717082 130
117 3300006178 Ga0075367_10262723 Ga0075367_102627232 130
118 3300006178 Ga0075367_10601653 Ga0075367_106016532 130
119 3300006353 Ga0075370_10168071 Ga0075370_101680712 130
120 3300006353 Ga0075370_10284168 Ga0075370_102841682 130
121 3300009094 Ga0111539_12310769 Ga0111539_123107692 130
122 3300009098 Ga0105245_10534186 Ga0105245_105341862 130
123 3300009148 Ga0105243_10319150 Ga0105243_103191502 130
124 3300009148 Ga0105243_10370117 Ga0105243_103701172 130
125 3300009176 Ga0105242_10375084 Ga0105242_103750842 130
126 3300009177 Ga0105248_12408064 Ga0105248_124080642 130
127 3300011119 Ga0105246_10098821 Ga0105246_100988212 130
128 3300013306 Ga0163162_11180110 Ga0163162_111801102 130
129 3300013307 Ga0157372_12191444 Ga0157372_121914442 130
130 3300013307 Ga0157372_12362512 Ga0157372_123625122 130
131 3300013308 Ga0157375_10302343 Ga0157375_103023432 130
132 3300013308 Ga0157375_10600774 Ga0157375_106007742 130
133 3300013308 Ga0157375_11799762 Ga0157375_117997622 130
134 3300014326 Ga0157380_10335098 Ga0157380_103350982 130
135 3300014497 Ga0182008_10157725 Ga0182008_101577252 130
136 3300014745 Ga0157377_11274842 Ga0157377_112748421 130
137 3300017792 Ga0163161_10710101 Ga0163161_107101012 130
138 3300020082 Ga0206353_11405182 Ga0206353_114051822 130
139 3300025918 Ga0207662_10152746 Ga0207662_101527462 130
140 3300025921 Ga0207652_10126842 Ga0207652_101268421 130
141 3300025921 Ga0207652_10490336 Ga0207652_104903362 130
142 3300025925 Ga0207650_11023196 Ga0207650_110231962 130
143 3300025927 Ga0207687_11327393 Ga0207687_113273932 130
144 3300025937 Ga0207669_10524253 Ga0207669_105242532 130
145 3300025940 Ga0207691_10383232 Ga0207691_103832322 130
146 3300025944 Ga0207661_10061601 Ga0207661_100616013 130
147 3300025986 Ga0207658_10183968 Ga0207658_101839682 130
148 3300026089 Ga0207648_11022620 Ga0207648_110226202 130
149 3300026121 Ga0207683_10368257 Ga0207683_103682572 130
150 3300027866 Ga0209813_10075594 Ga0209813_100755942 130
151 3300028379 Ga0268266_10079186 Ga0268266_100791863 130
152 3300028381 Ga0268264_10000246 Ga0268264_1000024680 130
153 3300031903 Ga0307407_10464224 Ga0307407_104642242 130
154 3300031911 Ga0307412_10027725 Ga0307412_100277252 130
155 3300031995 Ga0307409_100548533 Ga0307409_1005485332 130
156 3300032126 Ga0307415_100134769 Ga0307415_1001347691 130
157 3300037466 Ga0395898_0056241 Ga0395898_0056241_1307_1747 130
158 3300037466 Ga0395898_0460567 Ga0395898_0460567_206_625 130
159 3300037853 Ga0436364_0974287 Ga0436364_0974287_231_647 130
160 3300038443 Ga0395901_0186659 Ga0395901_0186659_404_844 130
161 3300038443 Ga0395901_0498773 Ga0395901_0498773_235_630 130
162 3300038443 Ga0395901_0547253 Ga0395901_0547253_463_882 130
163 3300041459 Ga0451800_0884432 Ga0451800_0884432_124_519 130
164 3300041512 Ga0451853_3948641 Ga0451853_3948641_102_500 130
165 3300044684 Ga0466966_0004148 Ga0466966_0004148_6483_6923 130
166 3300044693 Ga0466961_0026982 Ga0466961_0026982_1213_1653 130
167 3300044765 Ga0466970_0357106 Ga0466970_0357106_228_644 130
168 3300044901 Ga0466960_0005126 Ga0466960_0005126_919_1323 130
169 3300044901 Ga0466960_0009530 Ga0466960_0009530_268_672 130
170 3300044901 Ga0466960_0060049 Ga0466960_0060049_152_562 130
171 3300044901 Ga0466960_0172658 Ga0466960_0172658_703_1107 130
172 3300044901 Ga0466960_0351927 Ga0466960_0351927_52_453 130
173 3300046455 Ga0495603_0022557 Ga0495603_0022557_2895_3290 130
174 3300048908 Ga0496105_0830769 Ga0496105_0830769_279_677 130
175 3300048911 Ga0496108_0125181 Ga0496108_0125181_1611_2009 130
176 3300048911 Ga0496108_0413126 Ga0496108_0413126_94_489 130
177 3300048911 Ga0496108_1305070 Ga0496108_1305070_187_582 130
178 3300048912 Ga0496109_0236355 Ga0496109_0236355_1175_1570 130
179 3300048912 Ga0496109_0237784 Ga0496109_0237784_904_1299 130
180 3300048912 Ga0496109_0859079 Ga0496109_0859079_86_484 130
181 3300048913 Ga0496110_0016248 Ga0496110_0016248_1305_1700 130
182 3300048913 Ga0496110_0067926 Ga0496110_0067926_2190_2588 130
183 3300048914 Ga0496111_0048758 Ga0496111_0048758_1365_1763 130
184 3300048914 Ga0496111_0060987 Ga0496111_0060987_1952_2347 130
185 3300048915 Ga0496112_0525061 Ga0496112_0525061_71_469 130
186 3300048917 Ga0496114_0286502 Ga0496114_0286502_826_1221 130
187 3300048917 Ga0496114_0964974 Ga0496114_0964974_65_463 130
188 3300048927 Ga0496124_0608556 Ga0496124_0608556_65_472 130
189 3300049571 Ga0501034_1138332 Ga0501034_1138332_75_500 130
190 3300049571 Ga0501034_1248441 Ga0501034_1248441_38_433 130
191 3300049572 Ga0501036_0166849 Ga0501036_0166849_967_1374 130
192 3300049572 Ga0501036_0772450 Ga0501036_0772450_49_444 130
193 3300049574 Ga0501038_0632063 Ga0501038_0632063_253_648 130
194 3300049575 Ga0501039_0311689 Ga0501039_0311689_620_1027 130
195 3300049578 Ga0501042_0448750 Ga0501042_0448750_157_564 130
196 3300049580 Ga0501046_0773380 Ga0501046_0773380_135_560 130
197 3300049583 Ga0501067_0005453 Ga0501067_0005453_1844_2239 130
198 3300049584 Ga0501068_0007289 Ga0501068_0007289_3882_4277 130
199 3300049585 Ga0501069_0373055 Ga0501069_0373055_17_442 130
200 3300049585 Ga0501069_0813835 Ga0501069_0813835_103_510 130
201 3300049586 Ga0501070_0101664 Ga0501070_0101664_1241_1666 130
202 3300049587 Ga0501071_0190261 Ga0501071_0190261_683_1078 130
203 3300049587 Ga0501071_0705149 Ga0501071_0705149_25_432 130
204 3300049587 Ga0501071_1040147 Ga0501071_1040147_111_515 130
205 3300049588 Ga0501072_0007666 Ga0501072_0007666_806_1231 130
206 3300049588 Ga0501072_0057004 Ga0501072_0057004_871_1266 130
207 3300049588 Ga0501072_0798778 Ga0501072_0798778_167_574 130
208 3300049589 Ga0501073_0001939 Ga0501073_0001939_10201_10596 130
209 3300049590 Ga0501074_0000537 Ga0501074_0000537_10721_11116 130
210 3300049592 Ga0501076_0931280 Ga0501076_0931280_74_469 130
211 3300049593 Ga0501077_0156685 Ga0501077_0156685_828_1223 130
212 3300049593 Ga0501077_1022115 Ga0501077_1022115_25_432 130
213 3300049741 Ga0501079_1014794 Ga0501079_1014794_223_618 130
214 3300049742 Ga0501080_0001967 Ga0501080_0001967_3954_4349 130
215 3300049744 Ga0501083_0003581 Ga0501083_0003581_8631_9026 130
216 3300049822 Ga0501035_0064910 Ga0501035_0064910_2018_2413 130
217 3300049823 Ga0501044_0736361 Ga0501044_0736361_405_800 130
218 3300050490 nmdc:mga03n38_243758_c1 nmdc:mga03n38_243758_c1_22_447 130
219 3300050491 nmdc:mga00v17_234733_c1 nmdc:mga00v17_234733_c1_757_1179 130
220 3300050492 nmdc:mga0yw44_101502_c1 nmdc:mga0yw44_101502_c1_68_475 130
221 3300050492 nmdc:mga0yw44_1186637_c1 nmdc:mga0yw44_1186637_c1_50_457 130
222 3300050492 nmdc:mga0yw44_200243_c1 nmdc:mga0yw44_200243_c1_194_616 130
223 3300050492 nmdc:mga0yw44_210688_c1 nmdc:mga0yw44_210688_c1_202_603 130
224 3300050492 nmdc:mga0yw44_382939_c1 nmdc:mga0yw44_382939_c1_421_858 130
225 3300050492 nmdc:mga0yw44_40591_c1 nmdc:mga0yw44_40591_c1_1918_2337 130
226 3300050492 nmdc:mga0yw44_409994_c1 nmdc:mga0yw44_409994_c1_442_849 130
227 3300050492 nmdc:mga0yw44_425638_c1 nmdc:mga0yw44_425638_c1_429_854 130
228 3300050492 nmdc:mga0yw44_58469_c1 nmdc:mga0yw44_58469_c1_1192_1644 130
229 3300050492 nmdc:mga0yw44_716392_c1 nmdc:mga0yw44_716392_c1_224_652 130
230 3300050492 nmdc:mga0yw44_7945_c1 nmdc:mga0yw44_7945_c1_458_880 130
231 3300050492 nmdc:mga0yw44_853392_c1 nmdc:mga0yw44_853392_c1_188_595 130
232 3300050492 nmdc:mga0yw44_92104_c1 nmdc:mga0yw44_92104_c1_1021_1440 130
233 3300050492 nmdc:mga0yw44_9244_c1 nmdc:mga0yw44_9244_c1_3355_3780 130
234 3300050494 nmdc:mga06z11_137547_c1 nmdc:mga06z11_137547_c1_531_947 130
235 3300050494 nmdc:mga06z11_24885_c1 nmdc:mga06z11_24885_c1_525_938 130
236 3300050495 nmdc:mga04h51_12938_c2 nmdc:mga04h51_12938_c2_613_1029 130
237 3300050495 nmdc:mga04h51_22511_c1 nmdc:mga04h51_22511_c1_386_787 130
238 3300050496 nmdc:mga07m45_206599_c1 nmdc:mga07m45_206599_c1_83_499 130
239 3300050496 nmdc:mga07m45_795396_c1 nmdc:mga07m45_795396_c1_81_509 130
240 3300053093 Ga0500651_0695245 Ga0500651_0695245_56_463 130
241 3300053096 Ga0500641_0013963 Ga0500641_0013963_994_1410 130
242 3300053104 Ga0500556_0001104 Ga0500556_0001104_6027_6434 130
243 3300053140 Ga0500573_0036535 Ga0500573_0036535_968_1372 130
244 3300053140 Ga0500573_0564054 Ga0500573_0564054_59_466 130
245 3300054114 Ga0501084_0003341 Ga0501084_0003341_8645_9040 130
246 3300054114 Ga0501084_1065837 Ga0501084_1065837_77_502 130
247 3300060353 Ga0501082_0021817 Ga0501082_0021817_2530_2925 130
248 3300060353 Ga0501082_0705982 Ga0501082_0705982_240_647 130
249 iso_pu_bacteria 2811994878 2812349445 130
250 iso_pu_bacteria 2891968417 2891972840 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

13

115

0.88

PF08211

dCMP_cyt_deam_2

Cytidine and deoxycytidylate deaminase zinc-binding region

3

94

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kw6-assembly1.cif.gz_A crystal structure of cytidine deaminase from streptomyces noursei 0.9579 5 123
3r2n-assembly1.cif.gz_C crystal structure of cytidine deaminase from mycobacterium leprae 0.9575 4 121
6kw6-assembly1.cif.gz_A crystal structure of cytidine deaminase from streptomyces noursei 0.95 5 123
4f3w-assembly1.cif.gz_C crystal structure of cytidine deaminase cdd from mycobacterium marinum 0.946 5 122
3r2n-assembly1.cif.gz_C crystal structure of cytidine deaminase from mycobacterium leprae 0.9419 4 121
ID Description Score Start End Superfamily
4wigA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9192 4 129 3.40.140.10
4wigA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9122 4 129 3.40.140.10
af_Q9S789_14_154_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8456 3 124 3.40.140.10
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8456 12 125 3.40.140.10
af_Q9SU86_8_154_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8433 10 129 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A6B3G8F7-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9636 21 112 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A0Q5RXH0-F1-model_v4 deleted 0.9557 11 121
AF-A0A259SAC9-F1-model_v4 Cytidine deaminase 0.9471 3 93 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A7Y5NZ28-F1-model_v4 deleted 0.9445 1 110
AF-A0A7J9Y1T5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9437 2 97 GO:0004126
GO:0005829
GO:0008270
GO:0009972

Feature Viewer

pLDDT pTM Quality
90.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map