F361604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 195 | 500 | 380 |
Family's Representative Sequence
| Representative Sequence | 3300025229|Ga0209147_100014|Ga0209147_100014167 |
| Length | 405 |
| Sequence | MQINESLFLLTIKIGKFKECLEMSLPPHGGVLINRFNPEVTIKNGLKEIPLDLIALSDLELIGNGAYSPLTGYLGKDDYEQVVSTMRLKDGTVWSIPITLPVSGQIASNLKLGELVKLTWENNVYGLLKIDDIYTPNKLLEAQFVYGTTDTNHPGVAKMYSRGDVYLGGEVTVIRQINRTQFTEHYLSPKETRAKFASLNWKKIVGFQTRNPVHRAHEYIQKTALEIVDGLFLNPLVGETKSDDIPAEVRMKSYKVLLQNYYPTDRVFLAVFPAAMRYAGPREAVFHSIVRKNYGCTHFIVGRDHAGVGNYYGTYDAQKIFQKFSQDELGISLLFFENSFYCTKCENMASTKTCPHGSEHHVTLSGTKVREMLKNGEVPPSAFSRKEVVEVLIEGLKEPESISVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 14 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 15 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 23 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 24 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 27 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 28 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 29 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 30 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 39 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 40 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 41 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 42 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 43 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 44 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 45 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 46 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 47 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 55 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 56 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 57 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 58 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 59 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 60 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 61 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 62 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 63 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 64 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 65 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 66 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 67 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 68 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 69 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 70 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 71 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 72 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 73 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 74 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 96 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 97 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 98 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 99 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 100 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 101 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 102 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 103 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 104 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 105 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 106 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 107 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 108 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 109 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 110 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 111 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 112 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 113 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 114 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 115 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 116 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 117 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 118 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 119 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 120 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 121 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 122 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 123 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 124 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 125 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 126 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 127 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 128 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 129 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 130 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 131 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 132 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 133 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 134 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 135 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 136 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 137 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 138 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 139 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 140 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 141 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 142 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 143 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 144 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 145 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 146 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 147 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 148 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 149 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 150 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 151 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 152 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 153 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 154 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 155 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 156 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 157 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 158 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 159 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 160 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 161 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 162 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 163 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 164 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 165 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 166 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 167 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 168 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 169 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 170 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 171 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 172 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 173 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 174 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 175 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 176 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 177 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 178 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 179 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 180 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 181 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 182 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 183 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 184 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 185 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 186 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 187 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 188 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 189 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 190 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 191 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 192 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 193 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 194 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 195 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 48.4 |
| Metatranscriptomes | 9.2 |
| Isolates | 42.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.6 |
| Nodule | 0.4 |
| Rhizoplane | 6.4 |
| Rhizosphere | 49.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209147_100014 | 3300025229 | Bacteria | 597841 |
| 2 | JGI25159J45721_1002495 | 3300002987 | Bacteria | 6933 |
| 3 | JGI25159J45721_1010480 | 3300002987 | Bacteria | 2356 |
| 4 | JGI25151J46595_10000509 | 3300003187 | Bacteria | 36487 |
| 5 | JGI25151J46595_10001168 | 3300003187 | Bacteria | 18937 |
| 6 | JGI25151J46595_10001653 | 3300003187 | Bacteria | 14646 |
| 7 | JGI25151J46595_10004437 | 3300003187 | Bacteria | 7426 |
| 8 | JGI25151J46595_10008263 | 3300003187 | Bacteria | 5020 |
| 9 | JGI25151J46595_10014685 | 3300003187 | Bacteria | 3479 |
| 10 | JGI25151J46595_10016285 | 3300003187 | Bacteria | 3255 |
| 11 | JGI25151J46595_10018860 | 3300003187 | Bacteria | 2948 |
| 12 | JGI25151J46595_10020098 | 3300003187 | Bacteria | 2822 |
| 13 | JGI25151J46595_10020283 | 3300003187 | Bacteria | 2805 |
| 14 | JGI25151J46595_10034351 | 3300003187 | Bacteria | 1940 |
| 15 | JGI25151J46595_10040111 | 3300003187 | Bacteria | 1720 |
| 16 | rootH1_10001505 | 3300003316 | Bacteria | 52069 |
| 17 | rootH1_10232753 | 3300003323 | Bacteria | 6793 |
| 18 | Ga0006562J51391_1003962 | 3300003578 | Bacteria | 7460 |
| 19 | Ga0055532_1000046 | 3300003758 | Bacteria | 182389 |
| 20 | Ga0055536_1017003 | 3300003781 | Bacteria | 2401 |
| 21 | Ga0055528_1003645 | 3300003790 | Bacteria | 7647 |
| 22 | Ga0070676_10146046 | 3300005328 | Bacteria | 1510 |
| 23 | Ga0070671_100129661 | 3300005355 | Bacteria | 2124 |
| 24 | Ga0070672_100224825 | 3300005543 | Bacteria | 1575 |
| 25 | Ga0075428_100145649 | 3300006844 | Archaea | 2574 |
| 26 | Ga0075431_100080464 | 3300006847 | Archaea | 3364 |
| 27 | Ga0105251_10010749 | 3300009011 | Bacteria | 5280 |
| 28 | Ga0105251_10049535 | 3300009011 | Bacteria | 2010 |
| 29 | Ga0105244_10006993 | 3300009036 | Bacteria | 7220 |
| 30 | Ga0105250_10003751 | 3300009092 | Bacteria | 7138 |
| 31 | Ga0105250_10005759 | 3300009092 | Bacteria | 5516 |
| 32 | Ga0105250_10007189 | 3300009092 | Bacteria | 4798 |
| 33 | Ga0105250_10022472 | 3300009092 | Bacteria | 2544 |
| 34 | Ga0105245_10105397 | 3300009098 | Bacteria | 2615 |
| 35 | Ga0105247_10061752 | 3300009101 | Bacteria | 2323 |
| 36 | Ga0105242_10017036 | 3300009176 | Bacteria | 5658 |
| 37 | Ga0105246_10012743 | 3300011119 | Bacteria | 5256 |
| 38 | Ga0157337_1000003 | 3300012483 | Archaea | 11859 |
| 39 | Ga0157329_1000793 | 3300012491 | Archaea | 1404 |
| 40 | Ga0157378_10012893 | 3300013297 | Bacteria | 7318 |
| 41 | Ga0157377_10002022 | 3300014745 | Bacteria | 8889 |
| 42 | Ga0209147_100585 | 3300025229 | Bacteria | 20203 |
| 43 | Ga0209147_102285 | 3300025229 | Bacteria | 5006 |
| 44 | Ga0209673_1002953 | 3300025273 | Bacteria | 10655 |
| 45 | Ga0209130_1001073 | 3300025284 | Bacteria | 20515 |
| 46 | Ga0209130_1001554 | 3300025284 | Bacteria | 14588 |
| 47 | Ga0209676_1000607 | 3300025292 | Bacteria | 52454 |
| 48 | Ga0209676_1000808 | 3300025292 | Bacteria | 40975 |
| 49 | Ga0209676_1003902 | 3300025292 | Bacteria | 8685 |
| 50 | Ga0209676_1017164 | 3300025292 | Bacteria | 2575 |
| 51 | Ga0209025_1000041 | 3300025294 | Bacteria | 373694 |
| 52 | Ga0209025_1000258 | 3300025294 | Bacteria | 124837 |
| 53 | Ga0209025_1000578 | 3300025294 | Bacteria | 66380 |
| 54 | Ga0209025_1001044 | 3300025294 | Bacteria | 40695 |
| 55 | Ga0209025_1001434 | 3300025294 | Bacteria | 31435 |
| 56 | Ga0209025_1001651 | 3300025294 | Bacteria | 27521 |
| 57 | Ga0209025_1002123 | 3300025294 | Bacteria | 22319 |
| 58 | Ga0209025_1008446 | 3300025294 | Bacteria | 7410 |
| 59 | Ga0209025_1009071 | 3300025294 | Bacteria | 7012 |
| 60 | Ga0209025_1012797 | 3300025294 | Bacteria | 5339 |
| 61 | Ga0209025_1015497 | 3300025294 | Bacteria | 4588 |
| 62 | Ga0209025_1016476 | 3300025294 | Bacteria | 4355 |
| 63 | Ga0209025_1017080 | 3300025294 | Bacteria | 4221 |
| 64 | Ga0209025_1019452 | 3300025294 | Bacteria | 3776 |
| 65 | Ga0209025_1034065 | 3300025294 | Bacteria | 2336 |
| 66 | Ga0209025_1051512 | 3300025294 | Bacteria | 1634 |
| 67 | Ga0207426_1006314 | 3300025302 | Bacteria | 5177 |
| 68 | Ga0207696_1001789 | 3300025711 | Bacteria | 11098 |
| 69 | Ga0207696_1005198 | 3300025711 | Bacteria | 5447 |
| 70 | Ga0207696_1014857 | 3300025711 | Bacteria | 2656 |
| 71 | Ga0207655_1010417 | 3300025728 | Bacteria | 5638 |
| 72 | Ga0207655_1010812 | 3300025728 | Bacteria | 5501 |
| 73 | Ga0207655_1062540 | 3300025728 | Bacteria | 1431 |
| 74 | Ga0207713_1001862 | 3300025735 | Bacteria | 16044 |
| 75 | Ga0207713_1018006 | 3300025735 | Bacteria | 3514 |
| 76 | Ga0207650_10026527 | 3300025925 | Bacteria | 4134 |
| 77 | Ga0207687_10112264 | 3300025927 | Bacteria | 2025 |
| 78 | Ga0207686_10004787 | 3300025934 | Bacteria | 7265 |
| 79 | Ga0207691_10194638 | 3300025940 | Bacteria | 1767 |
| 80 | Ga0207428_10204572 | 3300027907 | Unclassified | 1485 |
| 81 | Ga0237817_10690 | 3300030083 | Bacteria | 2945 |
| 82 | Ga0237817_10877 | 3300030083 | Bacteria | 2056 |
| 83 | Ga0307409_100011432 | 3300031995 | Bacteria | 5597 |
| 84 | Ga0307416_100016355 | 3300032002 | Bacteria | 5154 |
| 85 | Ga0237819_01779 | 3300038705 | Bacteria | 5043 |
| 86 | Ga0237819_02215 | 3300038705 | Bacteria | 4096 |
| 87 | Ga0237819_09658 | 3300038705 | Bacteria | 1285 |
| 88 | Ga0466966_0019897 | 3300044684 | Bacteria | 4414 |
| 89 | Ga0466966_0039225 | 3300044684 | Bacteria | 3051 |
| 90 | Ga0466959_0004696 | 3300045049 | Bacteria | 9201 |
| 91 | Ga0466958_0021900 | 3300045836 | Bacteria | 3738 |
| 92 | Ga0466967_0001369 | 3300045976 | Bacteria | 14046 |
| 93 | Ga0495605_0111527 | 3300046474 | Bacteria | 1248 |
| 94 | Ga0495584_0016137 | 3300046491 | Bacteria | 3810 |
| 95 | Ga0495585_0020944 | 3300046492 | Bacteria | 3757 |
| 96 | Ga0495622_0021172 | 3300046557 | Bacteria | 3030 |
| 97 | Ga0495661_0018166 | 3300046665 | Bacteria | 4630 |
| 98 | Ga0495660_0022536 | 3300046810 | Bacteria | 3595 |
| 99 | Ga0495683_0018046 | 3300047323 | Bacteria | 3652 |
| 100 | Ga0496100_0003500 | 3300048903 | Bacteria | 8199 |
| 101 | Ga0496101_0007114 | 3300048904 | Bacteria | 7236 |
| 102 | Ga0496102_0011060 | 3300048905 | Bacteria | 7773 |
| 103 | Ga0496103_0006909 | 3300048906 | Bacteria | 6778 |
| 104 | Ga0496104_0104688 | 3300048907 | Bacteria | 2711 |
| 105 | Ga0496105_0000623 | 3300048908 | Bacteria | 23715 |
| 106 | Ga0496106_0000867 | 3300048909 | Bacteria | 22000 |
| 107 | Ga0496107_0002789 | 3300048910 | Bacteria | 11527 |
| 108 | Ga0496108_0110733 | 3300048911 | Bacteria | 2347 |
| 109 | Ga0496109_0008358 | 3300048912 | Bacteria | 8793 |
| 110 | Ga0496110_0020665 | 3300048913 | Bacteria | 5561 |
| 111 | Ga0496111_0006869 | 3300048914 | Bacteria | 7427 |
| 112 | Ga0496112_0004674 | 3300048915 | Bacteria | 11641 |
| 113 | Ga0496112_0064693 | 3300048915 | Bacteria | 3609 |
| 114 | Ga0496113_0074348 | 3300048916 | Bacteria | 2591 |
| 115 | Ga0496116_0009978 | 3300048919 | Bacteria | 8023 |
| 116 | Ga0496117_0012269 | 3300048920 | Bacteria | 7576 |
| 117 | Ga0496119_0003143 | 3300048922 | Bacteria | 17366 |
| 118 | Ga0496122_0056803 | 3300048925 | Bacteria | 2913 |
| 119 | Ga0496125_0005263 | 3300048928 | Bacteria | 14485 |
| 120 | Ga0496126_0092364 | 3300048929 | Bacteria | 2659 |
| 121 | Ga0501341_00399 | 3300049131 | Bacteria | 1785 |
| 122 | Ga0501343_000201 | 3300049132 | Bacteria | 3091 |
| 123 | Ga0501344_00124 | 3300049133 | Bacteria | 2621 |
| 124 | Ga0501345_00126 | 3300049134 | Bacteria | 2030 |
| 125 | Ga0501305_005438 | 3300049161 | Bacteria | 1543 |
| 126 | Ga0501311_001701 | 3300049527 | Bacteria | 1983 |
| 127 | Ga0501312_004154 | 3300049528 | Bacteria | 1690 |
| 128 | Ga0501315_000199 | 3300049531 | Bacteria | 3601 |
| 129 | Ga0501315_001621 | 3300049531 | Bacteria | 1969 |
| 130 | Ga0501316_000218 | 3300049532 | Bacteria | 3498 |
| 131 | Ga0501318_001895 | 3300049534 | Bacteria | 1734 |
| 132 | Ga0501319_000870 | 3300049535 | Bacteria | 1600 |
| 133 | Ga0501320_000292 | 3300049536 | Bacteria | 2738 |
| 134 | Ga0501321_002008 | 3300049537 | Bacteria | 1708 |
| 135 | Ga0501327_00441 | 3300049543 | Bacteria | 1645 |
| 136 | Ga0501330_000825 | 3300049546 | Bacteria | 1466 |
| 137 | Ga0501331_00216 | 3300049547 | Bacteria | 2190 |
| 138 | Ga0501332_00190 | 3300049548 | Bacteria | 2309 |
| 139 | Ga0501333_000028 | 3300049549 | Bacteria | 4059 |
| 140 | Ga0501334_00048 | 3300049550 | Bacteria | 3661 |
| 141 | Ga0501335_001166 | 3300049551 | Bacteria | 1963 |
| 142 | Ga0501338_00077 | 3300049554 | Bacteria | 2971 |
| 143 | Ga0501031_0033725 | 3300049568 | Bacteria | 3341 |
| 144 | Ga0501035_0048161 | 3300049822 | Bacteria | 3823 |
| 145 | 2511177109 | 2510917027 | Bacteria | 5287437 |
| 146 | 2511699459 | 2511231119 | Bacteria | 4019861 |
| 147 | 2512637853 | 2512564013 | Bacteria | 6286191 |
| 148 | 2540606689 | 2540341094 | Bacteria | 4061186 |
| 149 | 2545556328 | 2545555800 | Bacteria | 4222588 |
| 150 | 2553391763 | 2551306519 | Bacteria | 5465154 |
| 151 | 2578929761 | 2576861599 | Bacteria | 4217202 |
| 152 | 2595091618 | 2593339131 | Bacteria | 5116855 |
| 153 | 2631984148 | 2630968484 | Bacteria | 3876276 |
| 154 | 2644703916 | 2643221729 | Bacteria | 6621700 |
| 155 | 2644708609 | 2643221730 | Bacteria | 6523787 |
| 156 | 2644720212 | 2643221731 | Bacteria | 5623886 |
| 157 | 2644726708 | 2643221732 | Bacteria | 5756404 |
| 158 | 2651532870 | 2648501850 | Bacteria | 3975476 |
| 159 | 2672336217 | 2671180330 | Bacteria | 5521719 |
| 160 | 2674419762 | 2671180844 | Bacteria | 4164150 |
| 161 | 2685149345 | 2684622632 | Bacteria | 5380049 |
| 162 | 2695627409 | 2695420354 | Bacteria | 3922431 |
| 163 | 2698323834 | 2695420987 | Bacteria | 6152737 |
| 164 | 2705993392 | 2703719227 | Bacteria | 5631989 |
| 165 | 2717916797 | 2716884898 | Bacteria | 3928789 |
| 166 | 2721504725 | 2718218445 | Bacteria | 5113413 |
| 167 | 2738813440 | 2738541295 | Bacteria | 5730091 |
| 168 | 2738816684 | 2738541295 | Bacteria | 5730091 |
| 169 | 2739156305 | 2738541358 | Bacteria | 5932299 |
| 170 | 2739210755 | 2738543006 | Bacteria | 5904091 |
| 171 | 2739270339 | 2738543017 | Bacteria | 4271950 |
| 172 | 2745165688 | 2744054657 | Bacteria | 5016802 |
| 173 | 2757568013 | 2757320391 | Bacteria | 4746095 |
| 174 | 2777760983 | 2775507177 | Bacteria | 4384303 |
| 175 | 2777838783 | 2775507192 | Bacteria | 4622234 |
| 176 | 2808868920 | 2808606364 | Bacteria | 4465927 |
| 177 | 2816864604 | 2816332186 | Bacteria | 5331395 |
| 178 | 2817479821 | 2816332295 | Bacteria | 4352468 |
| 179 | 2817617355 | 2816332336 | Bacteria | 5207640 |
| 180 | 2819569833 | 2818991441 | Bacteria | 5062707 |
| 181 | 2819579507 | 2818991443 | Bacteria | 6598732 |
| 182 | 2819711293 | 2818991465 | Bacteria | 5388835 |
| 183 | 2831905390 | 2831905167 | Bacteria | 3319172 |
| 184 | 2842683436 | 2842682962 | Bacteria | 5589973 |
| 185 | 2842886146 | 2842882022 | Bacteria | 6158489 |
| 186 | 2849144084 | 2849139964 | Bacteria | 5613304 |
| 187 | 2852675566 | 2852673933 | Bacteria | 3347676 |
| 188 | 2857469577 | 2857465823 | Bacteria | 6772595 |
| 189 | 2857581345 | 2857581216 | Bacteria | 5522813 |
| 190 | 2857590535 | 2857586860 | Bacteria | 4354574 |
| 191 | 2857595045 | 2857591370 | Bacteria | 6569758 |
| 192 | 2877770237 | 2877768649 | Bacteria | 3957164 |
| 193 | 2880171240 | 2880169592 | Bacteria | 3900066 |
| 194 | 2897111257 | 2897109615 | Bacteria | 4009619 |
| 195 | 2898909385 | 2898907183 | Bacteria | 4067722 |
| 196 | 2904528561 | 2904524088 | Bacteria | 5887454 |
| 197 | 2904560779 | 2904560550 | Bacteria | 4029838 |
| 198 | 2904610198 | 2904606771 | Bacteria | 4684500 |
| 199 | 2915603021 | 2915597211 | Bacteria | 6475886 |
| 200 | 2915611814 | 2915606848 | Bacteria | 6032732 |
| 201 | 2916972885 | 2916971899 | Bacteria | 4250608 |
| 202 | 2919148191 | 2919143609 | Bacteria | 6219228 |
| 203 | 2919414281 | 2919414237 | Bacteria | 5429133 |
| 204 | 2919522041 | 2919517244 | Bacteria | 5858162 |
| 205 | 2919725176 | 2919720352 | Bacteria | 5986006 |
| 206 | 2928098470 | 2928093941 | Bacteria | 5965005 |
| 207 | 2928512441 | 2928510474 | Bacteria | 4815308 |
| 208 | 2929007899 | 2929004312 | Bacteria | 5678476 |
| 209 | 2929188082 | 2929183550 | Bacteria | 6377511 |
| 210 | 2929234617 | 2929233124 | Bacteria | 5948380 |
| 211 | 2936341292 | 2936340661 | Bacteria | 5139038 |
| 212 | 2936362781 | 2936361878 | Bacteria | 5632809 |
| 213 | 2938918793 | 2938917290 | Bacteria | 5914775 |
| 214 | 2939595972 | 2939593269 | Bacteria | 4798695 |
| 215 | 2947428163 | 2947426588 | Bacteria | 5357194 |
| 216 | 2956899051 | 2956897341 | Bacteria | 5447711 |
| 217 | 2956899433 | 2956897341 | Bacteria | 5447711 |
| 218 | 2960321125 | 2960319331 | Bacteria | 5502575 |
| 219 | 2960378373 | 2960375949 | Bacteria | 5361395 |
| 220 | 2964375991 | 2964375228 | Bacteria | 4909004 |
| 221 | 2965762655 | 2965761152 | Bacteria | 5806513 |
| 222 | 2969142685 | 2969141011 | Bacteria | 4118468 |
| 223 | 2971895006 | 2971893375 | Bacteria | 3929648 |
| 224 | 2977257771 | 2977254563 | Bacteria | 4828420 |
| 225 | 2979085086 | 2979083700 | Bacteria | 5894929 |
| 226 | 2990278795 | 2990275345 | Bacteria | 4887158 |
| 227 | 3001268662 | 3001267043 | Bacteria | 4823521 |
| 228 | 3001271770 | 3001267043 | Bacteria | 4823521 |
| 229 | 3001276909 | 3001272096 | Bacteria | 4729684 |
| 230 | 3001893190 | 3001892409 | Bacteria | 6328293 |
| 231 | 3001893200 | 3001892409 | Bacteria | 6328293 |
| 232 | 3006860160 | 3006858327 | Bacteria | 4317835 |
| 233 | 3006984926 | 3006984091 | Bacteria | 4207523 |
| 234 | 3006985036 | 3006984091 | Bacteria | 4207523 |
| 235 | 3006988714 | 3006988479 | Bacteria | 4767936 |
| 236 | 3006992821 | 3006988479 | Bacteria | 4767936 |
| 237 | 8022622581 | 8022621104 | Bacteria | 5241040 |
| 238 | 8022630861 | 8022630665 | Bacteria | 3886130 |
| 239 | 8022798205 | 8022792930 | Bacteria | 5693794 |
| 240 | 8022894175 | 8022893055 | Bacteria | 5300455 |
| 241 | 8022918714 | 8022914991 | Bacteria | 5584517 |
| 242 | 8023442529 | 8023438354 | Bacteria | 5779374 |
| 243 | 8023444425 | 8023438354 | Bacteria | 5779374 |
| 244 | 8023447875 | 8023444577 | Bacteria | 5661597 |
| 245 | 8051952867 | 8051952484 | Bacteria | 3926774 |
| 246 | 8052174637 | 8052174270 | Bacteria | 3881265 |
| 247 | 8054281969 | 8054280661 | Bacteria | 4232245 |
| 248 | 8055536116 | 8055531788 | Bacteria | 5249694 |
| 249 | 8057584170 | 8057582654 | Bacteria | 5218944 |
| 250 | 8057633341 | 8057632132 | Bacteria | 4726859 |
| 251 | Ga0209147_100014 | |||
| 252 | JGI25159J45721_1002495 | |||
| 253 | JGI25159J45721_1010480 | |||
| 254 | JGI25151J46595_10000509 | |||
| 255 | JGI25151J46595_10001168 | |||
| 256 | JGI25151J46595_10001653 | |||
| 257 | JGI25151J46595_10004437 | |||
| 258 | JGI25151J46595_10008263 | |||
| 259 | JGI25151J46595_10014685 | |||
| 260 | JGI25151J46595_10016285 | |||
| 261 | JGI25151J46595_10018860 | |||
| 262 | JGI25151J46595_10020098 | |||
| 263 | JGI25151J46595_10020283 | |||
| 264 | JGI25151J46595_10034351 | |||
| 265 | JGI25151J46595_10040111 | |||
| 266 | rootH1_10001505 | |||
| 267 | rootH1_10232753 | |||
| 268 | Ga0006562J51391_1003962 | |||
| 269 | Ga0055532_1000046 | |||
| 270 | Ga0055536_1017003 | |||
| 271 | Ga0055528_1003645 | |||
| 272 | Ga0070676_10146046 | |||
| 273 | Ga0070671_100129661 | |||
| 274 | Ga0070672_100224825 | |||
| 275 | Ga0075428_100145649 | |||
| 276 | Ga0075431_100080464 | |||
| 277 | Ga0105251_10010749 | |||
| 278 | Ga0105251_10049535 | |||
| 279 | Ga0105244_10006993 | |||
| 280 | Ga0105250_10003751 | |||
| 281 | Ga0105250_10005759 | |||
| 282 | Ga0105250_10007189 | |||
| 283 | Ga0105250_10022472 | |||
| 284 | Ga0105245_10105397 | |||
| 285 | Ga0105247_10061752 | |||
| 286 | Ga0105242_10017036 | |||
| 287 | Ga0105246_10012743 | |||
| 288 | Ga0157337_1000003 | |||
| 289 | Ga0157329_1000793 | |||
| 290 | Ga0157378_10012893 | |||
| 291 | Ga0157377_10002022 | |||
| 292 | Ga0209147_100585 | |||
| 293 | Ga0209147_102285 | |||
| 294 | Ga0209673_1002953 | |||
| 295 | Ga0209130_1001073 | |||
| 296 | Ga0209130_1001554 | |||
| 297 | Ga0209676_1000607 | |||
| 298 | Ga0209676_1000808 | |||
| 299 | Ga0209676_1003902 | |||
| 300 | Ga0209676_1017164 | |||
| 301 | Ga0209025_1000041 | |||
| 302 | Ga0209025_1000258 | |||
| 303 | Ga0209025_1000578 | |||
| 304 | Ga0209025_1001044 | |||
| 305 | Ga0209025_1001434 | |||
| 306 | Ga0209025_1001651 | |||
| 307 | Ga0209025_1002123 | |||
| 308 | Ga0209025_1008446 | |||
| 309 | Ga0209025_1009071 | |||
| 310 | Ga0209025_1012797 | |||
| 311 | Ga0209025_1015497 | |||
| 312 | Ga0209025_1016476 | |||
| 313 | Ga0209025_1017080 | |||
| 314 | Ga0209025_1019452 | |||
| 315 | Ga0209025_1034065 | |||
| 316 | Ga0209025_1051512 | |||
| 317 | Ga0207426_1006314 | |||
| 318 | Ga0207696_1001789 | |||
| 319 | Ga0207696_1005198 | |||
| 320 | Ga0207696_1014857 | |||
| 321 | Ga0207655_1010417 | |||
| 322 | Ga0207655_1010812 | |||
| 323 | Ga0207655_1062540 | |||
| 324 | Ga0207713_1001862 | |||
| 325 | Ga0207713_1018006 | |||
| 326 | Ga0207650_10026527 | |||
| 327 | Ga0207687_10112264 | |||
| 328 | Ga0207686_10004787 | |||
| 329 | Ga0207691_10194638 | |||
| 330 | Ga0207428_10204572 | |||
| 331 | Ga0237817_10690 | |||
| 332 | Ga0237817_10877 | |||
| 333 | Ga0307409_100011432 | |||
| 334 | Ga0307416_100016355 | |||
| 335 | Ga0237819_01779 | |||
| 336 | Ga0237819_02215 | |||
| 337 | Ga0237819_09658 | |||
| 338 | Ga0466966_0019897 | |||
| 339 | Ga0466966_0039225 | |||
| 340 | Ga0466959_0004696 | |||
| 341 | Ga0466958_0021900 | |||
| 342 | Ga0466967_0001369 | |||
| 343 | Ga0495605_0111527 | |||
| 344 | Ga0495584_0016137 | |||
| 345 | Ga0495585_0020944 | |||
| 346 | Ga0495622_0021172 | |||
| 347 | Ga0495661_0018166 | |||
| 348 | Ga0495660_0022536 | |||
| 349 | Ga0495683_0018046 | |||
| 350 | Ga0496100_0003500 | |||
| 351 | Ga0496101_0007114 | |||
| 352 | Ga0496102_0011060 | |||
| 353 | Ga0496103_0006909 | |||
| 354 | Ga0496104_0104688 | |||
| 355 | Ga0496105_0000623 | |||
| 356 | Ga0496106_0000867 | |||
| 357 | Ga0496107_0002789 | |||
| 358 | Ga0496108_0110733 | |||
| 359 | Ga0496109_0008358 | |||
| 360 | Ga0496110_0020665 | |||
| 361 | Ga0496111_0006869 | |||
| 362 | Ga0496112_0004674 | |||
| 363 | Ga0496112_0064693 | |||
| 364 | Ga0496113_0074348 | |||
| 365 | Ga0496116_0009978 | |||
| 366 | Ga0496117_0012269 | |||
| 367 | Ga0496119_0003143 | |||
| 368 | Ga0496122_0056803 | |||
| 369 | Ga0496125_0005263 | |||
| 370 | Ga0496126_0092364 | |||
| 371 | Ga0501341_00399 | |||
| 372 | Ga0501343_000201 | |||
| 373 | Ga0501344_00124 | |||
| 374 | Ga0501345_00126 | |||
| 375 | Ga0501305_005438 | |||
| 376 | Ga0501311_001701 | |||
| 377 | Ga0501312_004154 | |||
| 378 | Ga0501315_000199 | |||
| 379 | Ga0501315_001621 | |||
| 380 | Ga0501316_000218 | |||
| 381 | Ga0501318_001895 | |||
| 382 | Ga0501319_000870 | |||
| 383 | Ga0501320_000292 | |||
| 384 | Ga0501321_002008 | |||
| 385 | Ga0501327_00441 | |||
| 386 | Ga0501330_000825 | |||
| 387 | Ga0501331_00216 | |||
| 388 | Ga0501332_00190 | |||
| 389 | Ga0501333_000028 | |||
| 390 | Ga0501334_00048 | |||
| 391 | Ga0501335_001166 | |||
| 392 | Ga0501338_00077 | |||
| 393 | Ga0501031_0033725 | |||
| 394 | Ga0501035_0048161 | |||
| 395 | 2511177109 | |||
| 396 | 2511699459 | |||
| 397 | 2512637853 | |||
| 398 | 2540606689 | |||
| 399 | 2545556328 | |||
| 400 | 2553391763 | |||
| 401 | 2578929761 | |||
| 402 | 2595091618 | |||
| 403 | 2631984148 | |||
| 404 | 2644703916 | |||
| 405 | 2644708609 | |||
| 406 | 2644720212 | |||
| 407 | 2644726708 | |||
| 408 | 2651532870 | |||
| 409 | 2672336217 | |||
| 410 | 2674419762 | |||
| 411 | 2685149345 | |||
| 412 | 2695627409 | |||
| 413 | 2698323834 | |||
| 414 | 2705993392 | |||
| 415 | 2717916797 | |||
| 416 | 2721504725 | |||
| 417 | 2738813440 | |||
| 418 | 2738816684 | |||
| 419 | 2739156305 | |||
| 420 | 2739210755 | |||
| 421 | 2739270339 | |||
| 422 | 2745165688 | |||
| 423 | 2757568013 | |||
| 424 | 2777760983 | |||
| 425 | 2777838783 | |||
| 426 | 2808868920 | |||
| 427 | 2816864604 | |||
| 428 | 2817479821 | |||
| 429 | 2817617355 | |||
| 430 | 2819569833 | |||
| 431 | 2819579507 | |||
| 432 | 2819711293 | |||
| 433 | 2831905390 | |||
| 434 | 2842683436 | |||
| 435 | 2842886146 | |||
| 436 | 2849144084 | |||
| 437 | 2852675566 | |||
| 438 | 2857469577 | |||
| 439 | 2857581345 | |||
| 440 | 2857590535 | |||
| 441 | 2857595045 | |||
| 442 | 2877770237 | |||
| 443 | 2880171240 | |||
| 444 | 2897111257 | |||
| 445 | 2898909385 | |||
| 446 | 2904528561 | |||
| 447 | 2904560779 | |||
| 448 | 2904610198 | |||
| 449 | 2915603021 | |||
| 450 | 2915611814 | |||
| 451 | 2916972885 | |||
| 452 | 2919148191 | |||
| 453 | 2919414281 | |||
| 454 | 2919522041 | |||
| 455 | 2919725176 | |||
| 456 | 2928098470 | |||
| 457 | 2928512441 | |||
| 458 | 2929007899 | |||
| 459 | 2929188082 | |||
| 460 | 2929234617 | |||
| 461 | 2936341292 | |||
| 462 | 2936362781 | |||
| 463 | 2938918793 | |||
| 464 | 2939595972 | |||
| 465 | 2947428163 | |||
| 466 | 2956899051 | |||
| 467 | 2956899433 | |||
| 468 | 2960321125 | |||
| 469 | 2960378373 | |||
| 470 | 2964375991 | |||
| 471 | 2965762655 | |||
| 472 | 2969142685 | |||
| 473 | 2971895006 | |||
| 474 | 2977257771 | |||
| 475 | 2979085086 | |||
| 476 | 2990278795 | |||
| 477 | 3001268662 | |||
| 478 | 3001271770 | |||
| 479 | 3001276909 | |||
| 480 | 3001893190 | |||
| 481 | 3001893200 | |||
| 482 | 3006860160 | |||
| 483 | 3006984926 | |||
| 484 | 3006985036 | |||
| 485 | 3006988714 | |||
| 486 | 3006992821 | |||
| 487 | 8022622581 | |||
| 488 | 8022630861 | |||
| 489 | 8022798205 | |||
| 490 | 8022894175 | |||
| 491 | 8022918714 | |||
| 492 | 8023442529 | |||
| 493 | 8023444425 | |||
| 494 | 8023447875 | |||
| 495 | 8051952867 | |||
| 496 | 8052174637 | |||
| 497 | 8054281969 | |||
| 498 | 8055536116 | |||
| 499 | 8057584170 | |||
| 500 | 8057633341 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v47-assembly1.cif.gz_B | crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps | 0.9699 | 21 | 368 |
| 1v47-assembly1.cif.gz_A | crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps | 0.9678 | 21 | 370 |
| 1v47-assembly1.cif.gz_B | crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps | 0.9616 | 21 | 368 |
| 1v47-assembly1.cif.gz_A | crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps | 0.9596 | 21 | 370 |
| 1i2d-assembly1.cif.gz_A | crystal structure of atp sulfurylase from penicillium chrysogenum | 0.9469 | 21 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gksA01 | Alpha Beta;Roll;Sulfate adenylyltransferase;Sulfate adenylyltransferase | 0.9734 | 21 | 150 | 3.10.400.10 |
| 1v47B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.964 | 159 | 368 | 3.40.50.620 |
| 1v47B01 | Alpha Beta;Roll;Sulfate adenylyltransferase;Sulfate adenylyltransferase | 0.9638 | 21 | 154 | 3.10.400.10 |
| 1r6xA01 | Alpha Beta;Roll;Sulfate adenylyltransferase;Sulfate adenylyltransferase | 0.9524 | 18 | 150 | 3.10.400.10 |
| 1v47B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9506 | 159 | 368 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M8TBM5-F1-model_v4 | deleted | 0.998 | 6 | 94 |
|
| AF-A0A2M7WEW6-F1-model_v4 | Adenylyltransferase (EC 2.7.1.25, EC 2.7.7.4) | 0.9921 | 22 | 142 |
GO:0004020
GO:0004781 GO:0005524 GO:0005737 GO:0010134 GO:0019379 |
| AF-A0A7V5CBC6-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9919 | 21 | 125 |
GO:0004781
GO:0005524 GO:0005737 GO:0010134 GO:0019379 |
| AF-A0A5C8MNA6-F1-model_v4 | Sulfate adenylyltransferase (EC 2.7.7.4) | 0.9914 | 6 | 190 |
GO:0004781
GO:0005524 |
| AF-A0A4V5TXN0-F1-model_v4 | deleted | 0.9909 | 1 | 244 |
|