F361604

General Info

Members Datasets Scaffolds Average Seq Length
250 195 500 380

Family's Representative Sequence

Representative Sequence 3300025229|Ga0209147_100014|Ga0209147_100014167
Length 405
Sequence MQINESLFLLTIKIGKFKECLEMSLPPHGGVLINRFNPEVTIKNGLKEIPLDLIALSDLELIGNGAYSPLTGYLGKDDYEQVVSTMRLKDGTVWSIPITLPVSGQIASNLKLGELVKLTWENNVYGLLKIDDIYTPNKLLEAQFVYGTTDTNHPGVAKMYSRGDVYLGGEVTVIRQINRTQFTEHYLSPKETRAKFASLNWKKIVGFQTRNPVHRAHEYIQKTALEIVDGLFLNPLVGETKSDDIPAEVRMKSYKVLLQNYYPTDRVFLAVFPAAMRYAGPREAVFHSIVRKNYGCTHFIVGRDHAGVGNYYGTYDAQKIFQKFSQDELGISLLFFENSFYCTKCENMASTKTCPHGSEHHVTLSGTKVREMLKNGEVPPSAFSRKEVVEVLIEGLKEPESISVE

Samples

Sample ID Description Type Environment
1 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
23 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
48 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
49 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
50 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
51 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
52 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
53 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
54 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
55 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
56 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
57 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
58 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
59 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
60 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
61 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
62 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
63 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
66 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
67 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
70 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
98 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
99 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
100 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
101 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
102 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
103 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
104 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
105 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
106 2643221729 Bacillus sp. Root11 Isolate Unclassified
107 2643221730 Bacillus sp. Root131 Isolate Unclassified
108 2643221731 Bacillus sp. Root147 Isolate Unclassified
109 2643221732 Bacillus sp. Root239 Isolate Unclassified
110 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
111 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
112 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
113 2684622632 Bacillus cereus 905 Isolate Unclassified
114 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
115 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
116 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
117 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
118 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
119 2738541295 Bacillus sp. OK085 Isolate Unclassified
120 2738541358 Bacillus sp. OV752 Isolate Unclassified
121 2738543006 Bacillus sp. OK077 Isolate Unclassified
122 2738543017 Bacillus sp. OV186 Isolate Unclassified
123 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
124 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
125 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
126 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
127 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
128 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
129 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
130 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
131 2818991441 Niallia circulans 3243 Isolate Rhizosphere
132 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
133 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
134 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
135 2842682962 Bacillus sp. R-72492 Isolate Unclassified
136 2842882022 Bacillus sp. R-71893 Isolate Unclassified
137 2849139964 Bacillus sp. R-71875 Isolate Unclassified
138 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
139 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
140 2857581216 Bacillus sp. R-71922 Isolate Unclassified
141 2857586860 Bacillus sp. R-71935 Isolate Unclassified
142 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
143 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
144 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
145 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
146 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
147 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
148 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
149 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
150 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
151 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
152 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
153 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
154 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
155 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
156 2919720352 Priestia megaterium 4340 Isolate Unclassified
157 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
158 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
159 2929004312 Priestia megaterium 1104 Isolate Unclassified
160 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
161 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
162 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
163 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
164 2938917290 Bacillus sp. CR71 Isolate Unclassified
165 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
166 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
167 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
168 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
169 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
170 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
171 2965761152 Bacillus sp. COPE52 Isolate Unclassified
172 2969141011 Bacillus velezensis MH25 Isolate Unclassified
173 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
174 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
175 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
176 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
177 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
178 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
179 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
180 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
181 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
182 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
183 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
184 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
185 8022792930 Bacillus sp. Xin Isolate Rhizosphere
186 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
187 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
188 8023438354 Bacillus sp. BH2 Isolate Unclassified
189 8023444577 Bacillus sp. BH32 Isolate Unclassified
190 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
191 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
192 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
193 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
194 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
195 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 48.4
Metatranscriptomes 9.2
Isolates 42.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.6
Nodule 0.4
Rhizoplane 6.4
Rhizosphere 49.6
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209147_100014 3300025229 Bacteria 597841
2 JGI25159J45721_1002495 3300002987 Bacteria 6933
3 JGI25159J45721_1010480 3300002987 Bacteria 2356
4 JGI25151J46595_10000509 3300003187 Bacteria 36487
5 JGI25151J46595_10001168 3300003187 Bacteria 18937
6 JGI25151J46595_10001653 3300003187 Bacteria 14646
7 JGI25151J46595_10004437 3300003187 Bacteria 7426
8 JGI25151J46595_10008263 3300003187 Bacteria 5020
9 JGI25151J46595_10014685 3300003187 Bacteria 3479
10 JGI25151J46595_10016285 3300003187 Bacteria 3255
11 JGI25151J46595_10018860 3300003187 Bacteria 2948
12 JGI25151J46595_10020098 3300003187 Bacteria 2822
13 JGI25151J46595_10020283 3300003187 Bacteria 2805
14 JGI25151J46595_10034351 3300003187 Bacteria 1940
15 JGI25151J46595_10040111 3300003187 Bacteria 1720
16 rootH1_10001505 3300003316 Bacteria 52069
17 rootH1_10232753 3300003323 Bacteria 6793
18 Ga0006562J51391_1003962 3300003578 Bacteria 7460
19 Ga0055532_1000046 3300003758 Bacteria 182389
20 Ga0055536_1017003 3300003781 Bacteria 2401
21 Ga0055528_1003645 3300003790 Bacteria 7647
22 Ga0070676_10146046 3300005328 Bacteria 1510
23 Ga0070671_100129661 3300005355 Bacteria 2124
24 Ga0070672_100224825 3300005543 Bacteria 1575
25 Ga0075428_100145649 3300006844 Archaea 2574
26 Ga0075431_100080464 3300006847 Archaea 3364
27 Ga0105251_10010749 3300009011 Bacteria 5280
28 Ga0105251_10049535 3300009011 Bacteria 2010
29 Ga0105244_10006993 3300009036 Bacteria 7220
30 Ga0105250_10003751 3300009092 Bacteria 7138
31 Ga0105250_10005759 3300009092 Bacteria 5516
32 Ga0105250_10007189 3300009092 Bacteria 4798
33 Ga0105250_10022472 3300009092 Bacteria 2544
34 Ga0105245_10105397 3300009098 Bacteria 2615
35 Ga0105247_10061752 3300009101 Bacteria 2323
36 Ga0105242_10017036 3300009176 Bacteria 5658
37 Ga0105246_10012743 3300011119 Bacteria 5256
38 Ga0157337_1000003 3300012483 Archaea 11859
39 Ga0157329_1000793 3300012491 Archaea 1404
40 Ga0157378_10012893 3300013297 Bacteria 7318
41 Ga0157377_10002022 3300014745 Bacteria 8889
42 Ga0209147_100585 3300025229 Bacteria 20203
43 Ga0209147_102285 3300025229 Bacteria 5006
44 Ga0209673_1002953 3300025273 Bacteria 10655
45 Ga0209130_1001073 3300025284 Bacteria 20515
46 Ga0209130_1001554 3300025284 Bacteria 14588
47 Ga0209676_1000607 3300025292 Bacteria 52454
48 Ga0209676_1000808 3300025292 Bacteria 40975
49 Ga0209676_1003902 3300025292 Bacteria 8685
50 Ga0209676_1017164 3300025292 Bacteria 2575
51 Ga0209025_1000041 3300025294 Bacteria 373694
52 Ga0209025_1000258 3300025294 Bacteria 124837
53 Ga0209025_1000578 3300025294 Bacteria 66380
54 Ga0209025_1001044 3300025294 Bacteria 40695
55 Ga0209025_1001434 3300025294 Bacteria 31435
56 Ga0209025_1001651 3300025294 Bacteria 27521
57 Ga0209025_1002123 3300025294 Bacteria 22319
58 Ga0209025_1008446 3300025294 Bacteria 7410
59 Ga0209025_1009071 3300025294 Bacteria 7012
60 Ga0209025_1012797 3300025294 Bacteria 5339
61 Ga0209025_1015497 3300025294 Bacteria 4588
62 Ga0209025_1016476 3300025294 Bacteria 4355
63 Ga0209025_1017080 3300025294 Bacteria 4221
64 Ga0209025_1019452 3300025294 Bacteria 3776
65 Ga0209025_1034065 3300025294 Bacteria 2336
66 Ga0209025_1051512 3300025294 Bacteria 1634
67 Ga0207426_1006314 3300025302 Bacteria 5177
68 Ga0207696_1001789 3300025711 Bacteria 11098
69 Ga0207696_1005198 3300025711 Bacteria 5447
70 Ga0207696_1014857 3300025711 Bacteria 2656
71 Ga0207655_1010417 3300025728 Bacteria 5638
72 Ga0207655_1010812 3300025728 Bacteria 5501
73 Ga0207655_1062540 3300025728 Bacteria 1431
74 Ga0207713_1001862 3300025735 Bacteria 16044
75 Ga0207713_1018006 3300025735 Bacteria 3514
76 Ga0207650_10026527 3300025925 Bacteria 4134
77 Ga0207687_10112264 3300025927 Bacteria 2025
78 Ga0207686_10004787 3300025934 Bacteria 7265
79 Ga0207691_10194638 3300025940 Bacteria 1767
80 Ga0207428_10204572 3300027907 Unclassified 1485
81 Ga0237817_10690 3300030083 Bacteria 2945
82 Ga0237817_10877 3300030083 Bacteria 2056
83 Ga0307409_100011432 3300031995 Bacteria 5597
84 Ga0307416_100016355 3300032002 Bacteria 5154
85 Ga0237819_01779 3300038705 Bacteria 5043
86 Ga0237819_02215 3300038705 Bacteria 4096
87 Ga0237819_09658 3300038705 Bacteria 1285
88 Ga0466966_0019897 3300044684 Bacteria 4414
89 Ga0466966_0039225 3300044684 Bacteria 3051
90 Ga0466959_0004696 3300045049 Bacteria 9201
91 Ga0466958_0021900 3300045836 Bacteria 3738
92 Ga0466967_0001369 3300045976 Bacteria 14046
93 Ga0495605_0111527 3300046474 Bacteria 1248
94 Ga0495584_0016137 3300046491 Bacteria 3810
95 Ga0495585_0020944 3300046492 Bacteria 3757
96 Ga0495622_0021172 3300046557 Bacteria 3030
97 Ga0495661_0018166 3300046665 Bacteria 4630
98 Ga0495660_0022536 3300046810 Bacteria 3595
99 Ga0495683_0018046 3300047323 Bacteria 3652
100 Ga0496100_0003500 3300048903 Bacteria 8199
101 Ga0496101_0007114 3300048904 Bacteria 7236
102 Ga0496102_0011060 3300048905 Bacteria 7773
103 Ga0496103_0006909 3300048906 Bacteria 6778
104 Ga0496104_0104688 3300048907 Bacteria 2711
105 Ga0496105_0000623 3300048908 Bacteria 23715
106 Ga0496106_0000867 3300048909 Bacteria 22000
107 Ga0496107_0002789 3300048910 Bacteria 11527
108 Ga0496108_0110733 3300048911 Bacteria 2347
109 Ga0496109_0008358 3300048912 Bacteria 8793
110 Ga0496110_0020665 3300048913 Bacteria 5561
111 Ga0496111_0006869 3300048914 Bacteria 7427
112 Ga0496112_0004674 3300048915 Bacteria 11641
113 Ga0496112_0064693 3300048915 Bacteria 3609
114 Ga0496113_0074348 3300048916 Bacteria 2591
115 Ga0496116_0009978 3300048919 Bacteria 8023
116 Ga0496117_0012269 3300048920 Bacteria 7576
117 Ga0496119_0003143 3300048922 Bacteria 17366
118 Ga0496122_0056803 3300048925 Bacteria 2913
119 Ga0496125_0005263 3300048928 Bacteria 14485
120 Ga0496126_0092364 3300048929 Bacteria 2659
121 Ga0501341_00399 3300049131 Bacteria 1785
122 Ga0501343_000201 3300049132 Bacteria 3091
123 Ga0501344_00124 3300049133 Bacteria 2621
124 Ga0501345_00126 3300049134 Bacteria 2030
125 Ga0501305_005438 3300049161 Bacteria 1543
126 Ga0501311_001701 3300049527 Bacteria 1983
127 Ga0501312_004154 3300049528 Bacteria 1690
128 Ga0501315_000199 3300049531 Bacteria 3601
129 Ga0501315_001621 3300049531 Bacteria 1969
130 Ga0501316_000218 3300049532 Bacteria 3498
131 Ga0501318_001895 3300049534 Bacteria 1734
132 Ga0501319_000870 3300049535 Bacteria 1600
133 Ga0501320_000292 3300049536 Bacteria 2738
134 Ga0501321_002008 3300049537 Bacteria 1708
135 Ga0501327_00441 3300049543 Bacteria 1645
136 Ga0501330_000825 3300049546 Bacteria 1466
137 Ga0501331_00216 3300049547 Bacteria 2190
138 Ga0501332_00190 3300049548 Bacteria 2309
139 Ga0501333_000028 3300049549 Bacteria 4059
140 Ga0501334_00048 3300049550 Bacteria 3661
141 Ga0501335_001166 3300049551 Bacteria 1963
142 Ga0501338_00077 3300049554 Bacteria 2971
143 Ga0501031_0033725 3300049568 Bacteria 3341
144 Ga0501035_0048161 3300049822 Bacteria 3823
145 2511177109 2510917027 Bacteria 5287437
146 2511699459 2511231119 Bacteria 4019861
147 2512637853 2512564013 Bacteria 6286191
148 2540606689 2540341094 Bacteria 4061186
149 2545556328 2545555800 Bacteria 4222588
150 2553391763 2551306519 Bacteria 5465154
151 2578929761 2576861599 Bacteria 4217202
152 2595091618 2593339131 Bacteria 5116855
153 2631984148 2630968484 Bacteria 3876276
154 2644703916 2643221729 Bacteria 6621700
155 2644708609 2643221730 Bacteria 6523787
156 2644720212 2643221731 Bacteria 5623886
157 2644726708 2643221732 Bacteria 5756404
158 2651532870 2648501850 Bacteria 3975476
159 2672336217 2671180330 Bacteria 5521719
160 2674419762 2671180844 Bacteria 4164150
161 2685149345 2684622632 Bacteria 5380049
162 2695627409 2695420354 Bacteria 3922431
163 2698323834 2695420987 Bacteria 6152737
164 2705993392 2703719227 Bacteria 5631989
165 2717916797 2716884898 Bacteria 3928789
166 2721504725 2718218445 Bacteria 5113413
167 2738813440 2738541295 Bacteria 5730091
168 2738816684 2738541295 Bacteria 5730091
169 2739156305 2738541358 Bacteria 5932299
170 2739210755 2738543006 Bacteria 5904091
171 2739270339 2738543017 Bacteria 4271950
172 2745165688 2744054657 Bacteria 5016802
173 2757568013 2757320391 Bacteria 4746095
174 2777760983 2775507177 Bacteria 4384303
175 2777838783 2775507192 Bacteria 4622234
176 2808868920 2808606364 Bacteria 4465927
177 2816864604 2816332186 Bacteria 5331395
178 2817479821 2816332295 Bacteria 4352468
179 2817617355 2816332336 Bacteria 5207640
180 2819569833 2818991441 Bacteria 5062707
181 2819579507 2818991443 Bacteria 6598732
182 2819711293 2818991465 Bacteria 5388835
183 2831905390 2831905167 Bacteria 3319172
184 2842683436 2842682962 Bacteria 5589973
185 2842886146 2842882022 Bacteria 6158489
186 2849144084 2849139964 Bacteria 5613304
187 2852675566 2852673933 Bacteria 3347676
188 2857469577 2857465823 Bacteria 6772595
189 2857581345 2857581216 Bacteria 5522813
190 2857590535 2857586860 Bacteria 4354574
191 2857595045 2857591370 Bacteria 6569758
192 2877770237 2877768649 Bacteria 3957164
193 2880171240 2880169592 Bacteria 3900066
194 2897111257 2897109615 Bacteria 4009619
195 2898909385 2898907183 Bacteria 4067722
196 2904528561 2904524088 Bacteria 5887454
197 2904560779 2904560550 Bacteria 4029838
198 2904610198 2904606771 Bacteria 4684500
199 2915603021 2915597211 Bacteria 6475886
200 2915611814 2915606848 Bacteria 6032732
201 2916972885 2916971899 Bacteria 4250608
202 2919148191 2919143609 Bacteria 6219228
203 2919414281 2919414237 Bacteria 5429133
204 2919522041 2919517244 Bacteria 5858162
205 2919725176 2919720352 Bacteria 5986006
206 2928098470 2928093941 Bacteria 5965005
207 2928512441 2928510474 Bacteria 4815308
208 2929007899 2929004312 Bacteria 5678476
209 2929188082 2929183550 Bacteria 6377511
210 2929234617 2929233124 Bacteria 5948380
211 2936341292 2936340661 Bacteria 5139038
212 2936362781 2936361878 Bacteria 5632809
213 2938918793 2938917290 Bacteria 5914775
214 2939595972 2939593269 Bacteria 4798695
215 2947428163 2947426588 Bacteria 5357194
216 2956899051 2956897341 Bacteria 5447711
217 2956899433 2956897341 Bacteria 5447711
218 2960321125 2960319331 Bacteria 5502575
219 2960378373 2960375949 Bacteria 5361395
220 2964375991 2964375228 Bacteria 4909004
221 2965762655 2965761152 Bacteria 5806513
222 2969142685 2969141011 Bacteria 4118468
223 2971895006 2971893375 Bacteria 3929648
224 2977257771 2977254563 Bacteria 4828420
225 2979085086 2979083700 Bacteria 5894929
226 2990278795 2990275345 Bacteria 4887158
227 3001268662 3001267043 Bacteria 4823521
228 3001271770 3001267043 Bacteria 4823521
229 3001276909 3001272096 Bacteria 4729684
230 3001893190 3001892409 Bacteria 6328293
231 3001893200 3001892409 Bacteria 6328293
232 3006860160 3006858327 Bacteria 4317835
233 3006984926 3006984091 Bacteria 4207523
234 3006985036 3006984091 Bacteria 4207523
235 3006988714 3006988479 Bacteria 4767936
236 3006992821 3006988479 Bacteria 4767936
237 8022622581 8022621104 Bacteria 5241040
238 8022630861 8022630665 Bacteria 3886130
239 8022798205 8022792930 Bacteria 5693794
240 8022894175 8022893055 Bacteria 5300455
241 8022918714 8022914991 Bacteria 5584517
242 8023442529 8023438354 Bacteria 5779374
243 8023444425 8023438354 Bacteria 5779374
244 8023447875 8023444577 Bacteria 5661597
245 8051952867 8051952484 Bacteria 3926774
246 8052174637 8052174270 Bacteria 3881265
247 8054281969 8054280661 Bacteria 4232245
248 8055536116 8055531788 Bacteria 5249694
249 8057584170 8057582654 Bacteria 5218944
250 8057633341 8057632132 Bacteria 4726859
251 Ga0209147_100014
252 JGI25159J45721_1002495
253 JGI25159J45721_1010480
254 JGI25151J46595_10000509
255 JGI25151J46595_10001168
256 JGI25151J46595_10001653
257 JGI25151J46595_10004437
258 JGI25151J46595_10008263
259 JGI25151J46595_10014685
260 JGI25151J46595_10016285
261 JGI25151J46595_10018860
262 JGI25151J46595_10020098
263 JGI25151J46595_10020283
264 JGI25151J46595_10034351
265 JGI25151J46595_10040111
266 rootH1_10001505
267 rootH1_10232753
268 Ga0006562J51391_1003962
269 Ga0055532_1000046
270 Ga0055536_1017003
271 Ga0055528_1003645
272 Ga0070676_10146046
273 Ga0070671_100129661
274 Ga0070672_100224825
275 Ga0075428_100145649
276 Ga0075431_100080464
277 Ga0105251_10010749
278 Ga0105251_10049535
279 Ga0105244_10006993
280 Ga0105250_10003751
281 Ga0105250_10005759
282 Ga0105250_10007189
283 Ga0105250_10022472
284 Ga0105245_10105397
285 Ga0105247_10061752
286 Ga0105242_10017036
287 Ga0105246_10012743
288 Ga0157337_1000003
289 Ga0157329_1000793
290 Ga0157378_10012893
291 Ga0157377_10002022
292 Ga0209147_100585
293 Ga0209147_102285
294 Ga0209673_1002953
295 Ga0209130_1001073
296 Ga0209130_1001554
297 Ga0209676_1000607
298 Ga0209676_1000808
299 Ga0209676_1003902
300 Ga0209676_1017164
301 Ga0209025_1000041
302 Ga0209025_1000258
303 Ga0209025_1000578
304 Ga0209025_1001044
305 Ga0209025_1001434
306 Ga0209025_1001651
307 Ga0209025_1002123
308 Ga0209025_1008446
309 Ga0209025_1009071
310 Ga0209025_1012797
311 Ga0209025_1015497
312 Ga0209025_1016476
313 Ga0209025_1017080
314 Ga0209025_1019452
315 Ga0209025_1034065
316 Ga0209025_1051512
317 Ga0207426_1006314
318 Ga0207696_1001789
319 Ga0207696_1005198
320 Ga0207696_1014857
321 Ga0207655_1010417
322 Ga0207655_1010812
323 Ga0207655_1062540
324 Ga0207713_1001862
325 Ga0207713_1018006
326 Ga0207650_10026527
327 Ga0207687_10112264
328 Ga0207686_10004787
329 Ga0207691_10194638
330 Ga0207428_10204572
331 Ga0237817_10690
332 Ga0237817_10877
333 Ga0307409_100011432
334 Ga0307416_100016355
335 Ga0237819_01779
336 Ga0237819_02215
337 Ga0237819_09658
338 Ga0466966_0019897
339 Ga0466966_0039225
340 Ga0466959_0004696
341 Ga0466958_0021900
342 Ga0466967_0001369
343 Ga0495605_0111527
344 Ga0495584_0016137
345 Ga0495585_0020944
346 Ga0495622_0021172
347 Ga0495661_0018166
348 Ga0495660_0022536
349 Ga0495683_0018046
350 Ga0496100_0003500
351 Ga0496101_0007114
352 Ga0496102_0011060
353 Ga0496103_0006909
354 Ga0496104_0104688
355 Ga0496105_0000623
356 Ga0496106_0000867
357 Ga0496107_0002789
358 Ga0496108_0110733
359 Ga0496109_0008358
360 Ga0496110_0020665
361 Ga0496111_0006869
362 Ga0496112_0004674
363 Ga0496112_0064693
364 Ga0496113_0074348
365 Ga0496116_0009978
366 Ga0496117_0012269
367 Ga0496119_0003143
368 Ga0496122_0056803
369 Ga0496125_0005263
370 Ga0496126_0092364
371 Ga0501341_00399
372 Ga0501343_000201
373 Ga0501344_00124
374 Ga0501345_00126
375 Ga0501305_005438
376 Ga0501311_001701
377 Ga0501312_004154
378 Ga0501315_000199
379 Ga0501315_001621
380 Ga0501316_000218
381 Ga0501318_001895
382 Ga0501319_000870
383 Ga0501320_000292
384 Ga0501321_002008
385 Ga0501327_00441
386 Ga0501330_000825
387 Ga0501331_00216
388 Ga0501332_00190
389 Ga0501333_000028
390 Ga0501334_00048
391 Ga0501335_001166
392 Ga0501338_00077
393 Ga0501031_0033725
394 Ga0501035_0048161
395 2511177109
396 2511699459
397 2512637853
398 2540606689
399 2545556328
400 2553391763
401 2578929761
402 2595091618
403 2631984148
404 2644703916
405 2644708609
406 2644720212
407 2644726708
408 2651532870
409 2672336217
410 2674419762
411 2685149345
412 2695627409
413 2698323834
414 2705993392
415 2717916797
416 2721504725
417 2738813440
418 2738816684
419 2739156305
420 2739210755
421 2739270339
422 2745165688
423 2757568013
424 2777760983
425 2777838783
426 2808868920
427 2816864604
428 2817479821
429 2817617355
430 2819569833
431 2819579507
432 2819711293
433 2831905390
434 2842683436
435 2842886146
436 2849144084
437 2852675566
438 2857469577
439 2857581345
440 2857590535
441 2857595045
442 2877770237
443 2880171240
444 2897111257
445 2898909385
446 2904528561
447 2904560779
448 2904610198
449 2915603021
450 2915611814
451 2916972885
452 2919148191
453 2919414281
454 2919522041
455 2919725176
456 2928098470
457 2928512441
458 2929007899
459 2929188082
460 2929234617
461 2936341292
462 2936362781
463 2938918793
464 2939595972
465 2947428163
466 2956899051
467 2956899433
468 2960321125
469 2960378373
470 2964375991
471 2965762655
472 2969142685
473 2971895006
474 2977257771
475 2979085086
476 2990278795
477 3001268662
478 3001271770
479 3001276909
480 3001893190
481 3001893200
482 3006860160
483 3006984926
484 3006985036
485 3006988714
486 3006992821
487 8022622581
488 8022630861
489 8022798205
490 8022894175
491 8022918714
492 8023442529
493 8023444425
494 8023447875
495 8051952867
496 8052174637
497 8054281969
498 8055536116
499 8057584170
500 8057633341

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01747

ATP-sulfurylase

ATP-sulfurylase

183

395

0.98

PF14306

PUA_2

PUA-like domain

25

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v47-assembly1.cif.gz_B crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.9699 21 368
1v47-assembly1.cif.gz_A crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.9678 21 370
1v47-assembly1.cif.gz_B crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.9616 21 368
1v47-assembly1.cif.gz_A crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.9596 21 370
1i2d-assembly1.cif.gz_A crystal structure of atp sulfurylase from penicillium chrysogenum 0.9469 21 369
ID Description Score Start End Superfamily
2gksA01 Alpha Beta;Roll;Sulfate adenylyltransferase;Sulfate adenylyltransferase 0.9734 21 150 3.10.400.10
1v47B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.964 159 368 3.40.50.620
1v47B01 Alpha Beta;Roll;Sulfate adenylyltransferase;Sulfate adenylyltransferase 0.9638 21 154 3.10.400.10
1r6xA01 Alpha Beta;Roll;Sulfate adenylyltransferase;Sulfate adenylyltransferase 0.9524 18 150 3.10.400.10
1v47B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9506 159 368 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A5M8TBM5-F1-model_v4 deleted 0.998 6 94
AF-A0A2M7WEW6-F1-model_v4 Adenylyltransferase (EC 2.7.1.25, EC 2.7.7.4) 0.9921 22 142 GO:0004020
GO:0004781
GO:0005524
GO:0005737
GO:0010134
GO:0019379
AF-A0A7V5CBC6-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9919 21 125 GO:0004781
GO:0005524
GO:0005737
GO:0010134
GO:0019379
AF-A0A5C8MNA6-F1-model_v4 Sulfate adenylyltransferase (EC 2.7.7.4) 0.9914 6 190 GO:0004781
GO:0005524
AF-A0A4V5TXN0-F1-model_v4 deleted 0.9909 1 244

Map