F361520
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 175 | 250 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10027709|Ga0114129_100277096 |
| Length | 299 |
| Sequence | MAQLARTSFRERIERLEESLSPLATRSYPADREEPEPDSDHRTPFQRDRDRIVHSKAFRRLKHKTQVFIAPEGDHYRTRLTHTLEACGIARGHPPFGHTGEAVLDECMRERWGSGFRHNEHSLRVVEKIERLNLTAPVRDGILRHTGPEPPGTLEGRIVRLVDRVAYINHDIDDAIRAGVLRFEDLPRAEIELLGHTGSDRIETLVVDVLRHSEDAGDIVQGEEVGAAMLRLREFMFEHVYLGPAAQRERPRIERMLRALFDHYADELGDEQRVVDWLAGMTDRYAIREFENLSAPQGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 85 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 86 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 87 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 90 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 92 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 97 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 98 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 100 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 101 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 102 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 103 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 145 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 154 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 155 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 173 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 174 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0 |
| Rhizoplane | 11.2 |
| Rhizosphere | 83.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1005096 | 3300002074 | Bacteria | 1520 |
| 2 | JGI24034J26672_10000547 | 3300002239 | Bacteria | 4811 |
| 3 | Ga0070658_10054216 | 3300005327 | Bacteria | 3256 |
| 4 | Ga0070683_100060966 | 3300005329 | Bacteria | 3507 |
| 5 | Ga0070683_100062324 | 3300005329 | Bacteria | 3468 |
| 6 | Ga0070683_100195249 | 3300005329 | Bacteria | 1922 |
| 7 | Ga0070677_10000015 | 3300005333 | Bacteria | 52793 |
| 8 | Ga0070680_100186405 | 3300005336 | Bacteria | 1748 |
| 9 | Ga0070682_100000078 | 3300005337 | Bacteria | 87953 |
| 10 | Ga0068868_100000609 | 3300005338 | Bacteria | 24032 |
| 11 | Ga0070674_100000007 | 3300005356 | Bacteria | 145531 |
| 12 | Ga0070673_100024857 | 3300005364 | Bacteria | 4398 |
| 13 | Ga0070667_100026976 | 3300005367 | Bacteria | 4778 |
| 14 | Ga0070711_100017782 | 3300005439 | Bacteria | 4530 |
| 15 | Ga0070700_100107100 | 3300005441 | Bacteria | 1852 |
| 16 | Ga0070663_100012559 | 3300005455 | Bacteria | 5363 |
| 17 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 18 | Ga0070681_10021833 | 3300005458 | Bacteria | 6420 |
| 19 | Ga0068867_100000543 | 3300005459 | Bacteria | 24807 |
| 20 | Ga0070679_100000913 | 3300005530 | Bacteria | 25634 |
| 21 | Ga0070679_100030115 | 3300005530 | Bacteria | 5357 |
| 22 | Ga0070684_100055836 | 3300005535 | Bacteria | 3444 |
| 23 | Ga0068853_100005036 | 3300005539 | Bacteria | 10303 |
| 24 | Ga0070693_100003232 | 3300005547 | Bacteria | 7564 |
| 25 | Ga0070665_100000141 | 3300005548 | Bacteria | 135473 |
| 26 | Ga0070704_100089107 | 3300005549 | Bacteria | 2294 |
| 27 | Ga0068856_100007253 | 3300005614 | Bacteria | 10813 |
| 28 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 29 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 30 | Ga0068863_100000129 | 3300005841 | Bacteria | 79654 |
| 31 | Ga0068863_100010553 | 3300005841 | Bacteria | 8969 |
| 32 | Ga0068858_100000118 | 3300005842 | Bacteria | 83359 |
| 33 | Ga0068858_100000508 | 3300005842 | Bacteria | 40801 |
| 34 | Ga0068860_100005371 | 3300005843 | Bacteria | 12998 |
| 35 | Ga0068860_100353937 | 3300005843 | Bacteria | 1445 |
| 36 | Ga0068862_100001367 | 3300005844 | Bacteria | 22660 |
| 37 | Ga0081455_10005820 | 3300005937 | Bacteria | 13416 |
| 38 | Ga0081455_10066685 | 3300005937 | Bacteria | 3004 |
| 39 | Ga0081538_10018160 | 3300005981 | Bacteria | 5299 |
| 40 | Ga0081540_1039920 | 3300005983 | Bacteria | 2454 |
| 41 | Ga0081540_1109641 | 3300005983 | Bacteria | 1170 |
| 42 | Ga0081539_10007406 | 3300005985 | Bacteria | 10023 |
| 43 | Ga0070712_100102836 | 3300006175 | Bacteria | 2117 |
| 44 | Ga0075430_100135636 | 3300006846 | Bacteria | 2051 |
| 45 | Ga0068865_100150929 | 3300006881 | Bacteria | 1763 |
| 46 | Ga0105245_10000517 | 3300009098 | Bacteria | 35353 |
| 47 | Ga0105245_10006233 | 3300009098 | Bacteria | 10491 |
| 48 | Ga0105247_10002698 | 3300009101 | Bacteria | 11915 |
| 49 | Ga0114129_10027709 | 3300009147 | Bacteria | 8021 |
| 50 | Ga0105242_10000117 | 3300009176 | Bacteria | 57885 |
| 51 | Ga0105242_10000931 | 3300009176 | Bacteria | 22774 |
| 52 | Ga0105242_10082026 | 3300009176 | Bacteria | 2698 |
| 53 | Ga0105249_10000178 | 3300009553 | Bacteria | 74768 |
| 54 | Ga0105249_10027851 | 3300009553 | Bacteria | 5099 |
| 55 | Ga0105249_10214121 | 3300009553 | Bacteria | 1892 |
| 56 | Ga0157370_10016677 | 3300013104 | Bacteria | 7434 |
| 57 | Ga0157374_10000268 | 3300013296 | Bacteria | 48268 |
| 58 | Ga0157374_10348285 | 3300013296 | Bacteria | 1472 |
| 59 | Ga0157375_10074813 | 3300013308 | Bacteria | 3409 |
| 60 | Ga0163163_10086787 | 3300014325 | Bacteria | 3139 |
| 61 | Ga0157380_10000016 | 3300014326 | Bacteria | 126029 |
| 62 | Ga0157380_10001924 | 3300014326 | Bacteria | 13804 |
| 63 | Ga0157379_10015449 | 3300014968 | Bacteria | 6699 |
| 64 | Ga0157376_10016750 | 3300014969 | Bacteria | 5573 |
| 65 | Ga0157376_10049714 | 3300014969 | Bacteria | 3474 |
| 66 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 67 | Ga0206356_10163041 | 3300020070 | Bacteria | 3575 |
| 68 | Ga0207682_10000155 | 3300025893 | Bacteria | 31180 |
| 69 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 70 | Ga0207710_10000179 | 3300025900 | Bacteria | 64100 |
| 71 | Ga0207685_10000031 | 3300025905 | Bacteria | 77451 |
| 72 | Ga0207705_10115676 | 3300025909 | Bacteria | 1985 |
| 73 | Ga0207693_10104979 | 3300025915 | Bacteria | 2216 |
| 74 | Ga0207663_10023521 | 3300025916 | Bacteria | 3537 |
| 75 | Ga0207652_10003179 | 3300025921 | Bacteria | 13657 |
| 76 | Ga0207652_10023407 | 3300025921 | Bacteria | 5117 |
| 77 | Ga0207687_10000085 | 3300025927 | Bacteria | 68919 |
| 78 | Ga0207687_10018529 | 3300025927 | Bacteria | 4598 |
| 79 | Ga0207690_10039597 | 3300025932 | Bacteria | 3076 |
| 80 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 81 | Ga0207686_10000116 | 3300025934 | Bacteria | 64638 |
| 82 | Ga0207686_10002073 | 3300025934 | Bacteria | 11046 |
| 83 | Ga0207686_10091675 | 3300025934 | Bacteria | 2008 |
| 84 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 85 | Ga0207704_10117657 | 3300025938 | Bacteria | 1811 |
| 86 | Ga0207661_10002160 | 3300025944 | Bacteria | 13551 |
| 87 | Ga0207661_10041535 | 3300025944 | Bacteria | 3621 |
| 88 | Ga0207661_10126007 | 3300025944 | Bacteria | 2187 |
| 89 | Ga0207651_10001163 | 3300025960 | Bacteria | 11775 |
| 90 | Ga0207712_10000118 | 3300025961 | Bacteria | 85518 |
| 91 | Ga0207712_10021794 | 3300025961 | Bacteria | 4211 |
| 92 | Ga0207640_10012398 | 3300025981 | Bacteria | 4852 |
| 93 | Ga0207658_10011022 | 3300025986 | Bacteria | 6153 |
| 94 | Ga0207677_10000397 | 3300026023 | Bacteria | 29959 |
| 95 | Ga0207703_10000061 | 3300026035 | Bacteria | 132671 |
| 96 | Ga0207703_10000385 | 3300026035 | Bacteria | 47298 |
| 97 | Ga0207639_10009141 | 3300026041 | Bacteria | 6830 |
| 98 | Ga0207678_10024067 | 3300026067 | Bacteria | 5321 |
| 99 | Ga0207702_10002161 | 3300026078 | Bacteria | 18875 |
| 100 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 101 | Ga0207648_10000499 | 3300026089 | Bacteria | 43734 |
| 102 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 103 | Ga0207675_100145170 | 3300026118 | Bacteria | 2256 |
| 104 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 105 | Ga0268265_10019795 | 3300028380 | Bacteria | 4685 |
| 106 | Ga0268264_10010495 | 3300028381 | Bacteria | 7656 |
| 107 | Ga0268264_10098705 | 3300028381 | Bacteria | 2533 |
| 108 | Ga0265337_1000007 | 3300028556 | Bacteria | 98412 |
| 109 | Ga0265326_10000019 | 3300028558 | Bacteria | 137370 |
| 110 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 111 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 112 | Ga0265336_10008819 | 3300028666 | Bacteria | 3515 |
| 113 | Ga0265336_10025346 | 3300028666 | Bacteria | 1869 |
| 114 | Ga0265338_10000244 | 3300028800 | Bacteria | 100528 |
| 115 | Ga0265338_10138085 | 3300028800 | Bacteria | 1913 |
| 116 | Ga0265324_10000517 | 3300029957 | Bacteria | 26580 |
| 117 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 118 | Ga0265339_10024586 | 3300031249 | Bacteria | 3469 |
| 119 | Ga0265331_10001501 | 3300031250 | Bacteria | 17222 |
| 120 | Ga0265331_10020608 | 3300031250 | Bacteria | 3383 |
| 121 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 122 | Ga0265313_10021688 | 3300031595 | Bacteria | 3506 |
| 123 | Ga0265314_10000513 | 3300031711 | Bacteria | 49998 |
| 124 | Ga0307415_100001185 | 3300032126 | Bacteria | 12191 |
| 125 | Ga0307415_100079849 | 3300032126 | Bacteria | 2332 |
| 126 | Ga0373933_0092404 | 3300035724 | Bacteria | 1869 |
| 127 | Ga0373937_0146251 | 3300036401 | Bacteria | 2212 |
| 128 | Ga0451833_1141119 | 3300041491 | Bacteria | 1329 |
| 129 | Ga0451853_3732269 | 3300041512 | Bacteria | 3040 |
| 130 | Ga0466963_0000004 | 3300044694 | Bacteria | 102526 |
| 131 | Ga0466967_0165829 | 3300045976 | Bacteria | 2076 |
| 132 | Ga0495592_0000078 | 3300046454 | Bacteria | 85591 |
| 133 | Ga0495603_0002937 | 3300046455 | Bacteria | 10079 |
| 134 | Ga0495629_0000260 | 3300046459 | Bacteria | 46062 |
| 135 | Ga0495629_0006194 | 3300046459 | Bacteria | 8884 |
| 136 | Ga0495629_0113469 | 3300046459 | Bacteria | 1889 |
| 137 | Ga0495629_0196482 | 3300046459 | Bacteria | 1395 |
| 138 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 139 | Ga0495641_0036793 | 3300046461 | Bacteria | 2298 |
| 140 | Ga0495651_0048630 | 3300046462 | Bacteria | 3275 |
| 141 | Ga0495653_0058088 | 3300046463 | Bacteria | 2941 |
| 142 | Ga0495653_0147482 | 3300046463 | Bacteria | 1647 |
| 143 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 144 | Ga0495639_0056496 | 3300046475 | Bacteria | 1792 |
| 145 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 146 | Ga0495662_0077307 | 3300046476 | Bacteria | 1616 |
| 147 | Ga0495608_0000284 | 3300046511 | Bacteria | 35636 |
| 148 | Ga0495608_0002626 | 3300046511 | Bacteria | 12905 |
| 149 | Ga0495608_0073817 | 3300046511 | Bacteria | 2224 |
| 150 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 151 | Ga0495620_0067721 | 3300046515 | Bacteria | 1468 |
| 152 | Ga0495628_0012150 | 3300046516 | Bacteria | 7257 |
| 153 | Ga0495628_0031394 | 3300046516 | Bacteria | 4298 |
| 154 | Ga0495628_0165099 | 3300046516 | Bacteria | 1681 |
| 155 | Ga0495628_0173647 | 3300046516 | Bacteria | 1633 |
| 156 | Ga0495628_0216531 | 3300046516 | Bacteria | 1439 |
| 157 | Ga0495630_0003323 | 3300046517 | Bacteria | 11203 |
| 158 | Ga0495630_0004700 | 3300046517 | Bacteria | 9583 |
| 159 | Ga0495630_0111386 | 3300046517 | Bacteria | 2073 |
| 160 | Ga0495630_0255832 | 3300046517 | Bacteria | 1338 |
| 161 | Ga0495644_0004198 | 3300046523 | Bacteria | 5661 |
| 162 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 163 | Ga0495652_0016086 | 3300046529 | Bacteria | 6692 |
| 164 | Ga0495587_0002555 | 3300046536 | Bacteria | 12162 |
| 165 | Ga0495598_0002922 | 3300046537 | Bacteria | 3581 |
| 166 | Ga0495633_0031350 | 3300046558 | Bacteria | 2578 |
| 167 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 168 | Ga0495634_0020489 | 3300046642 | Bacteria | 4689 |
| 169 | Ga0495634_0039388 | 3300046642 | Bacteria | 3218 |
| 170 | Ga0495635_0000031 | 3300046663 | Bacteria | 110244 |
| 171 | Ga0495635_0124415 | 3300046663 | Bacteria | 1758 |
| 172 | Ga0495635_0125971 | 3300046663 | Bacteria | 1747 |
| 173 | Ga0495635_0155435 | 3300046663 | Bacteria | 1557 |
| 174 | Ga0495657_0025476 | 3300046675 | Bacteria | 4199 |
| 175 | Ga0495599_0002353 | 3300046678 | Bacteria | 10976 |
| 176 | Ga0495647_0000350 | 3300046681 | Bacteria | 13029 |
| 177 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 178 | Ga0495669_0000076 | 3300046684 | Bacteria | 65203 |
| 179 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 180 | Ga0495624_0000019 | 3300046690 | Bacteria | 102237 |
| 181 | Ga0495670_0027945 | 3300046691 | Bacteria | 2796 |
| 182 | Ga0495649_0003593 | 3300046694 | Bacteria | 10394 |
| 183 | Ga0495604_0000067 | 3300047317 | Bacteria | 90345 |
| 184 | Ga0495676_0000238 | 3300047321 | Bacteria | 44160 |
| 185 | Ga0495676_0050315 | 3300047321 | Bacteria | 3343 |
| 186 | Ga0495680_0000143 | 3300047322 | Bacteria | 71946 |
| 187 | Ga0495680_0001976 | 3300047322 | Bacteria | 21537 |
| 188 | Ga0495680_0004240 | 3300047322 | Bacteria | 13761 |
| 189 | Ga0495679_012540 | 3300047446 | Bacteria | 3219 |
| 190 | Ga0495614_0091577 | 3300048089 | Bacteria | 1323 |
| 191 | Ga0496100_0000059 | 3300048903 | Bacteria | 65518 |
| 192 | Ga0496101_0000135 | 3300048904 | Bacteria | 65518 |
| 193 | Ga0496102_0000294 | 3300048905 | Bacteria | 64001 |
| 194 | Ga0496102_0227801 | 3300048905 | Bacteria | 1757 |
| 195 | Ga0496103_0000159 | 3300048906 | Bacteria | 71148 |
| 196 | Ga0496103_0213644 | 3300048906 | Bacteria | 1240 |
| 197 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 198 | Ga0496104_0000025 | 3300048907 | Bacteria | 228519 |
| 199 | Ga0496104_0000133 | 3300048907 | Bacteria | 69099 |
| 200 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 201 | Ga0496105_0000023 | 3300048908 | Bacteria | 156126 |
| 202 | Ga0496105_0000595 | 3300048908 | Bacteria | 24079 |
| 203 | Ga0496106_0000030 | 3300048909 | Bacteria | 136804 |
| 204 | Ga0496106_0000252 | 3300048909 | Bacteria | 37666 |
| 205 | Ga0496107_0000054 | 3300048910 | Bacteria | 60902 |
| 206 | Ga0496107_0063938 | 3300048910 | Bacteria | 2667 |
| 207 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 208 | Ga0496108_0000397 | 3300048911 | Bacteria | 35950 |
| 209 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 210 | Ga0496109_0000803 | 3300048912 | Bacteria | 26180 |
| 211 | Ga0496109_0029860 | 3300048912 | Bacteria | 4885 |
| 212 | Ga0496110_0022820 | 3300048913 | Bacteria | 5317 |
| 213 | Ga0496110_0085034 | 3300048913 | Bacteria | 2824 |
| 214 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 215 | Ga0496114_0000800 | 3300048917 | Bacteria | 23530 |
| 216 | Ga0496114_0002880 | 3300048917 | Bacteria | 13188 |
| 217 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 218 | Ga0496115_0000770 | 3300048918 | Bacteria | 23530 |
| 219 | Ga0496116_0000331 | 3300048919 | Bacteria | 76536 |
| 220 | Ga0496117_0001515 | 3300048920 | Bacteria | 33278 |
| 221 | Ga0496118_0001489 | 3300048921 | Bacteria | 34977 |
| 222 | Ga0496119_0007655 | 3300048922 | Bacteria | 9675 |
| 223 | Ga0496119_0040827 | 3300048922 | Bacteria | 2962 |
| 224 | Ga0496121_0008646 | 3300048924 | Bacteria | 11909 |
| 225 | Ga0496126_0023918 | 3300048929 | Bacteria | 5908 |
| 226 | Ga0496126_0072784 | 3300048929 | Bacteria | 3056 |
| 227 | Ga0501040_0286796 | 3300049576 | Bacteria | 1176 |
| 228 | Ga0501042_0096289 | 3300049578 | Bacteria | 2126 |
| 229 | Ga0501070_0003012 | 3300049586 | Bacteria | 14665 |
| 230 | Ga0501074_0179966 | 3300049590 | Bacteria | 1508 |
| 231 | Ga0501075_0012256 | 3300049591 | Bacteria | 6087 |
| 232 | Ga0501083_0082411 | 3300049744 | Bacteria | 2131 |
| 233 | Ga0501044_0056738 | 3300049823 | Bacteria | 4021 |
| 234 | nmdc:mga0a205_4244_c2 | 3300050515 | Bacteria | 9156 |
| 235 | Ga0495601_0000448 | 3300053077 | Bacteria | 21585 |
| 236 | Ga0495601_0004637 | 3300053077 | Bacteria | 7956 |
| 237 | Ga0495601_0007612 | 3300053077 | Bacteria | 6360 |
| 238 | Ga0495612_0000132 | 3300053078 | Bacteria | 31605 |
| 239 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 240 | Ga0495595_0000111 | 3300053084 | Bacteria | 37420 |
| 241 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 242 | Ga0495619_0001017 | 3300053085 | Bacteria | 18372 |
| 243 | Ga0495619_0001398 | 3300053085 | Bacteria | 15882 |
| 244 | Ga0495619_0002624 | 3300053085 | Bacteria | 11739 |
| 245 | Ga0495619_0013611 | 3300053085 | Bacteria | 5126 |
| 246 | Ga0495619_0015227 | 3300053085 | Bacteria | 4863 |
| 247 | Ga0500566_0006069 | 3300053094 | Bacteria | 7182 |
| 248 | Ga0500614_000631 | 3300053123 | Bacteria | 8967 |
| 249 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 250 | Ga0501084_0284001 | 3300054114 | Bacteria | 1398 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10027709 | Ga0114129_100277096 | 296 |
| 2 | 3300025927 | Ga0207687_10018529 | Ga0207687_100185294 | 299 |
| 3 | 3300025944 | Ga0207661_10002160 | Ga0207661_100021608 | 299 |
| 4 | 3300032126 | Ga0307415_100079849 | Ga0307415_1000798492 | 299 |
| 5 | 3300017792 | Ga0163161_10000022 | Ga0163161_1000002247 | 300 |
| 6 | 3300025934 | Ga0207686_10002073 | Ga0207686_100020732 | 300 |
| 7 | 3300009176 | Ga0105242_10082026 | Ga0105242_100820262 | 305 |
| 8 | 3300025934 | Ga0207686_10091675 | Ga0207686_100916752 | 305 |
| 9 | 3300046517 | Ga0495630_0003323 | Ga0495630_0003323_8763_9794 | 307 |
| 10 | 3300046642 | Ga0495634_0020489 | Ga0495634_0020489_3114_4145 | 307 |
| 11 | 3300046663 | Ga0495635_0155435 | Ga0495635_0155435_394_1425 | 307 |
| 12 | 3300046675 | Ga0495657_0025476 | Ga0495657_0025476_753_1784 | 307 |
| 13 | 3300053077 | Ga0495601_0007612 | Ga0495601_0007612_5284_6315 | 307 |
| 14 | 3300053085 | Ga0495619_0002624 | Ga0495619_0002624_3184_4215 | 307 |
| 15 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015147 | 308 |
| 16 | 3300006881 | Ga0068865_100150929 | Ga0068865_1001509292 | 308 |
| 17 | 3300025938 | Ga0207704_10117657 | Ga0207704_101176572 | 308 |
| 18 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018153 | 308 |
| 19 | 3300046517 | Ga0495630_0111386 | Ga0495630_0111386_691_1701 | 308 |
| 20 | 3300049586 | Ga0501070_0003012 | Ga0501070_0003012_12183_13205 | 308 |
| 21 | 3300005329 | Ga0070683_100195249 | Ga0070683_1001952492 | 309 |
| 22 | 3300025944 | Ga0207661_10126007 | Ga0207661_101260072 | 309 |
| 23 | 3300005981 | Ga0081538_10018160 | Ga0081538_100181604 | 310 |
| 24 | 3300013296 | Ga0157374_10000268 | Ga0157374_1000026810 | 313 |
| 25 | 3300013308 | Ga0157375_10074813 | Ga0157375_100748133 | 313 |
| 26 | 3300025932 | Ga0207690_10039597 | Ga0207690_100395973 | 313 |
| 27 | 3300046455 | Ga0495603_0002937 | Ga0495603_0002937_6728_7726 | 313 |
| 28 | 3300046459 | Ga0495629_0196482 | Ga0495629_0196482_282_1280 | 313 |
| 29 | 3300046463 | Ga0495653_0147482 | Ga0495653_0147482_430_1428 | 313 |
| 30 | 3300046475 | Ga0495639_0056496 | Ga0495639_0056496_584_1582 | 313 |
| 31 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_62650_63648 | 313 |
| 32 | 3300046523 | Ga0495644_0004198 | Ga0495644_0004198_1106_2104 | 313 |
| 33 | 3300046690 | Ga0495624_0000019 | Ga0495624_0000019_2882_3880 | 313 |
| 34 | 3300005441 | Ga0070700_100107100 | Ga0070700_1001071001 | 314 |
| 35 | 3300014326 | Ga0157380_10001924 | Ga0157380_1000192413 | 314 |
| 36 | 3300046537 | Ga0495598_0002922 | Ga0495598_0002922_627_1625 | 314 |
| 37 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_144269_145267 | 314 |
| 38 | 3300046463 | Ga0495653_0058088 | Ga0495653_0058088_55_1056 | 315 |
| 39 | 3300048911 | Ga0496108_0000397 | Ga0496108_0000397_12318_13319 | 315 |
| 40 | 3300048912 | Ga0496109_0000803 | Ga0496109_0000803_6332_7333 | 315 |
| 41 | 3300005548 | Ga0070665_100000141 | Ga0070665_10000014183 | 317 |
| 42 | 3300005841 | Ga0068863_100000129 | Ga0068863_10000012914 | 317 |
| 43 | 3300005842 | Ga0068858_100000118 | Ga0068858_10000011834 | 317 |
| 44 | 3300009098 | Ga0105245_10006233 | Ga0105245_1000623310 | 317 |
| 45 | 3300026035 | Ga0207703_10000061 | Ga0207703_1000006152 | 317 |
| 46 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016108 | 317 |
| 47 | 3300028379 | Ga0268266_10000056 | Ga0268266_1000005691 | 317 |
| 48 | 3300046516 | Ga0495628_0165099 | Ga0495628_0165099_384_1394 | 317 |
| 49 | 3300046678 | Ga0495599_0002353 | Ga0495599_0002353_8599_9609 | 317 |
| 50 | 3300048909 | Ga0496106_0000030 | Ga0496106_0000030_41423_42430 | 317 |
| 51 | 3300048910 | Ga0496107_0063938 | Ga0496107_0063938_1641_2648 | 317 |
| 52 | 3300053077 | Ga0495601_0000448 | Ga0495601_0000448_7611_8621 | 317 |
| 53 | 3300053077 | Ga0495601_0004637 | Ga0495601_0004637_3291_4298 | 317 |
| 54 | 3300002074 | JGI24748J21848_1005096 | JGI24748J21848_10050962 | 318 |
| 55 | 3300002239 | JGI24034J26672_10000547 | JGI24034J26672_100005474 | 318 |
| 56 | 3300005327 | Ga0070658_10054216 | Ga0070658_100542161 | 318 |
| 57 | 3300005329 | Ga0070683_100060966 | Ga0070683_1000609661 | 318 |
| 58 | 3300005329 | Ga0070683_100062324 | Ga0070683_1000623244 | 318 |
| 59 | 3300005333 | Ga0070677_10000015 | Ga0070677_1000001525 | 318 |
| 60 | 3300005336 | Ga0070680_100186405 | Ga0070680_1001864052 | 318 |
| 61 | 3300005337 | Ga0070682_100000078 | Ga0070682_10000007877 | 318 |
| 62 | 3300005338 | Ga0068868_100000609 | Ga0068868_10000060911 | 318 |
| 63 | 3300005356 | Ga0070674_100000007 | Ga0070674_100000007106 | 318 |
| 64 | 3300005364 | Ga0070673_100024857 | Ga0070673_1000248574 | 318 |
| 65 | 3300005367 | Ga0070667_100026976 | Ga0070667_1000269762 | 318 |
| 66 | 3300005439 | Ga0070711_100017782 | Ga0070711_1000177822 | 318 |
| 67 | 3300005455 | Ga0070663_100012559 | Ga0070663_1000125593 | 318 |
| 68 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002183 | 318 |
| 69 | 3300005458 | Ga0070681_10021833 | Ga0070681_100218335 | 318 |
| 70 | 3300005459 | Ga0068867_100000543 | Ga0068867_10000054318 | 318 |
| 71 | 3300005530 | Ga0070679_100000913 | Ga0070679_10000091333 | 318 |
| 72 | 3300005530 | Ga0070679_100030115 | Ga0070679_1000301153 | 318 |
| 73 | 3300005535 | Ga0070684_100055836 | Ga0070684_1000558363 | 318 |
| 74 | 3300005539 | Ga0068853_100005036 | Ga0068853_1000050367 | 318 |
| 75 | 3300005547 | Ga0070693_100003232 | Ga0070693_1000032322 | 318 |
| 76 | 3300005549 | Ga0070704_100089107 | Ga0070704_1000891072 | 318 |
| 77 | 3300005614 | Ga0068856_100007253 | Ga0068856_1000072537 | 318 |
| 78 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003248 | 318 |
| 79 | 3300005841 | Ga0068863_100010553 | Ga0068863_1000105532 | 318 |
| 80 | 3300005842 | Ga0068858_100000508 | Ga0068858_10000050837 | 318 |
| 81 | 3300005843 | Ga0068860_100005371 | Ga0068860_10000537112 | 318 |
| 82 | 3300005843 | Ga0068860_100353937 | Ga0068860_1003539372 | 318 |
| 83 | 3300005844 | Ga0068862_100001367 | Ga0068862_10000136722 | 318 |
| 84 | 3300005937 | Ga0081455_10005820 | Ga0081455_1000582011 | 318 |
| 85 | 3300005937 | Ga0081455_10066685 | Ga0081455_100666852 | 318 |
| 86 | 3300005983 | Ga0081540_1039920 | Ga0081540_10399202 | 318 |
| 87 | 3300005983 | Ga0081540_1109641 | Ga0081540_11096411 | 318 |
| 88 | 3300005985 | Ga0081539_10007406 | Ga0081539_100074069 | 318 |
| 89 | 3300006175 | Ga0070712_100102836 | Ga0070712_1001028362 | 318 |
| 90 | 3300006846 | Ga0075430_100135636 | Ga0075430_1001356362 | 318 |
| 91 | 3300009098 | Ga0105245_10000517 | Ga0105245_1000051733 | 318 |
| 92 | 3300009101 | Ga0105247_10002698 | Ga0105247_100026987 | 318 |
| 93 | 3300009176 | Ga0105242_10000117 | Ga0105242_100001174 | 318 |
| 94 | 3300009176 | Ga0105242_10000931 | Ga0105242_1000093128 | 318 |
| 95 | 3300009553 | Ga0105249_10000178 | Ga0105249_1000017822 | 318 |
| 96 | 3300009553 | Ga0105249_10027851 | Ga0105249_100278515 | 318 |
| 97 | 3300009553 | Ga0105249_10214121 | Ga0105249_102141212 | 318 |
| 98 | 3300013104 | Ga0157370_10016677 | Ga0157370_100166777 | 318 |
| 99 | 3300013296 | Ga0157374_10348285 | Ga0157374_103482852 | 318 |
| 100 | 3300014325 | Ga0163163_10086787 | Ga0163163_100867872 | 318 |
| 101 | 3300014326 | Ga0157380_10000016 | Ga0157380_1000001651 | 318 |
| 102 | 3300014968 | Ga0157379_10015449 | Ga0157379_100154493 | 318 |
| 103 | 3300014969 | Ga0157376_10016750 | Ga0157376_100167506 | 318 |
| 104 | 3300014969 | Ga0157376_10049714 | Ga0157376_100497142 | 318 |
| 105 | 3300020070 | Ga0206356_10163041 | Ga0206356_101630412 | 318 |
| 106 | 3300025893 | Ga0207682_10000155 | Ga0207682_1000015535 | 318 |
| 107 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002498 | 318 |
| 108 | 3300025900 | Ga0207710_10000179 | Ga0207710_1000017987 | 318 |
| 109 | 3300025905 | Ga0207685_10000031 | Ga0207685_1000003146 | 318 |
| 110 | 3300025909 | Ga0207705_10115676 | Ga0207705_101156762 | 318 |
| 111 | 3300025915 | Ga0207693_10104979 | Ga0207693_101049793 | 318 |
| 112 | 3300025916 | Ga0207663_10023521 | Ga0207663_100235213 | 318 |
| 113 | 3300025921 | Ga0207652_10003179 | Ga0207652_100031793 | 318 |
| 114 | 3300025921 | Ga0207652_10023407 | Ga0207652_100234073 | 318 |
| 115 | 3300025927 | Ga0207687_10000085 | Ga0207687_1000008536 | 318 |
| 116 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001365 | 318 |
| 117 | 3300025934 | Ga0207686_10000116 | Ga0207686_1000011648 | 318 |
| 118 | 3300025937 | Ga0207669_10000001 | Ga0207669_1000000144 | 318 |
| 119 | 3300025944 | Ga0207661_10041535 | Ga0207661_100415354 | 318 |
| 120 | 3300025960 | Ga0207651_10001163 | Ga0207651_100011634 | 318 |
| 121 | 3300025961 | Ga0207712_10000118 | Ga0207712_1000011856 | 318 |
| 122 | 3300025961 | Ga0207712_10021794 | Ga0207712_100217943 | 318 |
| 123 | 3300025981 | Ga0207640_10012398 | Ga0207640_100123983 | 318 |
| 124 | 3300025986 | Ga0207658_10011022 | Ga0207658_100110224 | 318 |
| 125 | 3300026023 | Ga0207677_10000397 | Ga0207677_100003976 | 318 |
| 126 | 3300026035 | Ga0207703_10000385 | Ga0207703_1000038543 | 318 |
| 127 | 3300026041 | Ga0207639_10009141 | Ga0207639_100091417 | 318 |
| 128 | 3300026067 | Ga0207678_10024067 | Ga0207678_100240673 | 318 |
| 129 | 3300026078 | Ga0207702_10002161 | Ga0207702_1000216115 | 318 |
| 130 | 3300026089 | Ga0207648_10000499 | Ga0207648_1000049929 | 318 |
| 131 | 3300026118 | Ga0207675_100145170 | Ga0207675_1001451702 | 318 |
| 132 | 3300028380 | Ga0268265_10019795 | Ga0268265_100197954 | 318 |
| 133 | 3300028381 | Ga0268264_10010495 | Ga0268264_100104957 | 318 |
| 134 | 3300028381 | Ga0268264_10098705 | Ga0268264_100987052 | 318 |
| 135 | 3300028556 | Ga0265337_1000007 | Ga0265337_100000772 | 318 |
| 136 | 3300028558 | Ga0265326_10000019 | Ga0265326_1000001970 | 318 |
| 137 | 3300028563 | Ga0265319_1000014 | Ga0265319_1000014165 | 318 |
| 138 | 3300028654 | Ga0265322_10000011 | Ga0265322_1000001170 | 318 |
| 139 | 3300028666 | Ga0265336_10008819 | Ga0265336_100088193 | 318 |
| 140 | 3300028666 | Ga0265336_10025346 | Ga0265336_100253461 | 318 |
| 141 | 3300028800 | Ga0265338_10000244 | Ga0265338_1000024441 | 318 |
| 142 | 3300028800 | Ga0265338_10138085 | Ga0265338_101380852 | 318 |
| 143 | 3300029957 | Ga0265324_10000517 | Ga0265324_1000051731 | 318 |
| 144 | 3300031240 | Ga0265320_10000011 | Ga0265320_1000001170 | 318 |
| 145 | 3300031249 | Ga0265339_10024586 | Ga0265339_100245862 | 318 |
| 146 | 3300031250 | Ga0265331_10001501 | Ga0265331_100015018 | 318 |
| 147 | 3300031250 | Ga0265331_10020608 | Ga0265331_100206083 | 318 |
| 148 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015178 | 318 |
| 149 | 3300031595 | Ga0265313_10021688 | Ga0265313_100216884 | 318 |
| 150 | 3300031711 | Ga0265314_10000513 | Ga0265314_1000051349 | 318 |
| 151 | 3300032126 | Ga0307415_100001185 | Ga0307415_10000118511 | 318 |
| 152 | 3300035724 | Ga0373933_0092404 | Ga0373933_0092404_265_1278 | 318 |
| 153 | 3300036401 | Ga0373937_0146251 | Ga0373937_0146251_382_1395 | 318 |
| 154 | 3300041491 | Ga0451833_1141119 | Ga0451833_1141119_134_1144 | 318 |
| 155 | 3300041512 | Ga0451853_3732269 | Ga0451853_3732269_1879_2892 | 318 |
| 156 | 3300044694 | Ga0466963_0000004 | Ga0466963_0000004_75324_76337 | 318 |
| 157 | 3300045976 | Ga0466967_0165829 | Ga0466967_0165829_84_1097 | 318 |
| 158 | 3300046454 | Ga0495592_0000078 | Ga0495592_0000078_9906_10916 | 318 |
| 159 | 3300046459 | Ga0495629_0000260 | Ga0495629_0000260_14755_15765 | 318 |
| 160 | 3300046459 | Ga0495629_0006194 | Ga0495629_0006194_6414_7424 | 318 |
| 161 | 3300046459 | Ga0495629_0113469 | Ga0495629_0113469_821_1831 | 318 |
| 162 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_97306_98319 | 318 |
| 163 | 3300046461 | Ga0495641_0036793 | Ga0495641_0036793_327_1394 | 318 |
| 164 | 3300046462 | Ga0495651_0048630 | Ga0495651_0048630_2005_3015 | 318 |
| 165 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_30973_31986 | 318 |
| 166 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_59131_60141 | 318 |
| 167 | 3300046476 | Ga0495662_0077307 | Ga0495662_0077307_582_1592 | 318 |
| 168 | 3300046511 | Ga0495608_0000284 | Ga0495608_0000284_19800_20810 | 318 |
| 169 | 3300046511 | Ga0495608_0002626 | Ga0495608_0002626_1372_2382 | 318 |
| 170 | 3300046511 | Ga0495608_0073817 | Ga0495608_0073817_106_1119 | 318 |
| 171 | 3300046515 | Ga0495620_0067721 | Ga0495620_0067721_380_1390 | 318 |
| 172 | 3300046516 | Ga0495628_0012150 | Ga0495628_0012150_1872_2882 | 318 |
| 173 | 3300046516 | Ga0495628_0031394 | Ga0495628_0031394_1000_2010 | 318 |
| 174 | 3300046516 | Ga0495628_0173647 | Ga0495628_0173647_337_1392 | 318 |
| 175 | 3300046516 | Ga0495628_0216531 | Ga0495628_0216531_320_1330 | 318 |
| 176 | 3300046517 | Ga0495630_0004700 | Ga0495630_0004700_6439_7449 | 318 |
| 177 | 3300046517 | Ga0495630_0255832 | Ga0495630_0255832_95_1105 | 318 |
| 178 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_220952_221962 | 318 |
| 179 | 3300046529 | Ga0495652_0016086 | Ga0495652_0016086_5595_6650 | 318 |
| 180 | 3300046536 | Ga0495587_0002555 | Ga0495587_0002555_2804_3814 | 318 |
| 181 | 3300046558 | Ga0495633_0031350 | Ga0495633_0031350_1236_2246 | 318 |
| 182 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_17008_18018 | 318 |
| 183 | 3300046642 | Ga0495634_0039388 | Ga0495634_0039388_1557_2567 | 318 |
| 184 | 3300046663 | Ga0495635_0000031 | Ga0495635_0000031_60540_61550 | 318 |
| 185 | 3300046663 | Ga0495635_0124415 | Ga0495635_0124415_409_1419 | 318 |
| 186 | 3300046663 | Ga0495635_0125971 | Ga0495635_0125971_38_1060 | 318 |
| 187 | 3300046681 | Ga0495647_0000350 | Ga0495647_0000350_9459_10469 | 318 |
| 188 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_154579_155592 | 318 |
| 189 | 3300046684 | Ga0495669_0000076 | Ga0495669_0000076_51572_52585 | 318 |
| 190 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_151554_152564 | 318 |
| 191 | 3300046691 | Ga0495670_0027945 | Ga0495670_0027945_1246_2256 | 318 |
| 192 | 3300046694 | Ga0495649_0003593 | Ga0495649_0003593_1905_2918 | 318 |
| 193 | 3300047317 | Ga0495604_0000067 | Ga0495604_0000067_62815_63825 | 318 |
| 194 | 3300047321 | Ga0495676_0000238 | Ga0495676_0000238_30770_31783 | 318 |
| 195 | 3300047321 | Ga0495676_0050315 | Ga0495676_0050315_1272_2282 | 318 |
| 196 | 3300047322 | Ga0495680_0000143 | Ga0495680_0000143_57552_58562 | 318 |
| 197 | 3300047322 | Ga0495680_0001976 | Ga0495680_0001976_7108_8121 | 318 |
| 198 | 3300047322 | Ga0495680_0004240 | Ga0495680_0004240_1277_2287 | 318 |
| 199 | 3300047446 | Ga0495679_012540 | Ga0495679_012540_1694_2707 | 318 |
| 200 | 3300048089 | Ga0495614_0091577 | Ga0495614_0091577_259_1269 | 318 |
| 201 | 3300048903 | Ga0496100_0000059 | Ga0496100_0000059_41020_42033 | 318 |
| 202 | 3300048904 | Ga0496101_0000135 | Ga0496101_0000135_23486_24499 | 318 |
| 203 | 3300048905 | Ga0496102_0000294 | Ga0496102_0000294_24680_25690 | 318 |
| 204 | 3300048905 | Ga0496102_0227801 | Ga0496102_0227801_191_1213 | 318 |
| 205 | 3300048906 | Ga0496103_0000159 | Ga0496103_0000159_38499_39509 | 318 |
| 206 | 3300048906 | Ga0496103_0213644 | Ga0496103_0213644_77_1099 | 318 |
| 207 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_179344_180354 | 318 |
| 208 | 3300048907 | Ga0496104_0000025 | Ga0496104_0000025_56737_57750 | 318 |
| 209 | 3300048907 | Ga0496104_0000133 | Ga0496104_0000133_50288_51298 | 318 |
| 210 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_295445_296455 | 318 |
| 211 | 3300048908 | Ga0496105_0000023 | Ga0496105_0000023_56737_57750 | 318 |
| 212 | 3300048908 | Ga0496105_0000595 | Ga0496105_0000595_13913_14923 | 318 |
| 213 | 3300048909 | Ga0496106_0000252 | Ga0496106_0000252_36358_37371 | 318 |
| 214 | 3300048910 | Ga0496107_0000054 | Ga0496107_0000054_23486_24499 | 318 |
| 215 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_445283_446296 | 318 |
| 216 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_212371_213384 | 318 |
| 217 | 3300048912 | Ga0496109_0029860 | Ga0496109_0029860_1721_2782 | 318 |
| 218 | 3300048913 | Ga0496110_0022820 | Ga0496110_0022820_197_1207 | 318 |
| 219 | 3300048913 | Ga0496110_0085034 | Ga0496110_0085034_810_1823 | 318 |
| 220 | 3300048917 | Ga0496114_0000800 | Ga0496114_0000800_13778_14788 | 318 |
| 221 | 3300048917 | Ga0496114_0002880 | Ga0496114_0002880_8684_9697 | 318 |
| 222 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_140277_141317 | 318 |
| 223 | 3300048918 | Ga0496115_0000770 | Ga0496115_0000770_13778_14788 | 318 |
| 224 | 3300048919 | Ga0496116_0000331 | Ga0496116_0000331_39459_40505 | 318 |
| 225 | 3300048920 | Ga0496117_0001515 | Ga0496117_0001515_310_1332 | 318 |
| 226 | 3300048921 | Ga0496118_0001489 | Ga0496118_0001489_13777_14799 | 318 |
| 227 | 3300048922 | Ga0496119_0007655 | Ga0496119_0007655_1776_2822 | 318 |
| 228 | 3300048922 | Ga0496119_0040827 | Ga0496119_0040827_810_1820 | 318 |
| 229 | 3300048924 | Ga0496121_0008646 | Ga0496121_0008646_602_1618 | 318 |
| 230 | 3300048929 | Ga0496126_0023918 | Ga0496126_0023918_1951_2964 | 318 |
| 231 | 3300048929 | Ga0496126_0072784 | Ga0496126_0072784_114_1127 | 318 |
| 232 | 3300049576 | Ga0501040_0286796 | Ga0501040_0286796_103_1113 | 318 |
| 233 | 3300049578 | Ga0501042_0096289 | Ga0501042_0096289_1003_2013 | 318 |
| 234 | 3300049590 | Ga0501074_0179966 | Ga0501074_0179966_44_1057 | 318 |
| 235 | 3300049591 | Ga0501075_0012256 | Ga0501075_0012256_2351_3361 | 318 |
| 236 | 3300049744 | Ga0501083_0082411 | Ga0501083_0082411_235_1311 | 318 |
| 237 | 3300049823 | Ga0501044_0056738 | Ga0501044_0056738_1047_2123 | 318 |
| 238 | 3300050515 | nmdc:mga0a205_4244_c2 | nmdc:mga0a205_4244_c2_2699_3712 | 318 |
| 239 | 3300053078 | Ga0495612_0000132 | Ga0495612_0000132_17838_18848 | 318 |
| 240 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_77969_78979 | 318 |
| 241 | 3300053084 | Ga0495595_0000111 | Ga0495595_0000111_1883_2893 | 318 |
| 242 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_138659_139669 | 318 |
| 243 | 3300053085 | Ga0495619_0001017 | Ga0495619_0001017_6666_7676 | 318 |
| 244 | 3300053085 | Ga0495619_0001398 | Ga0495619_0001398_13411_14421 | 318 |
| 245 | 3300053085 | Ga0495619_0013611 | Ga0495619_0013611_3220_4233 | 318 |
| 246 | 3300053085 | Ga0495619_0015227 | Ga0495619_0015227_3602_4612 | 318 |
| 247 | 3300053094 | Ga0500566_0006069 | Ga0500566_0006069_1286_2296 | 318 |
| 248 | 3300053123 | Ga0500614_000631 | Ga0500614_000631_1248_2261 | 318 |
| 249 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_166639_167649 | 318 |
| 250 | 3300054114 | Ga0501084_0284001 | Ga0501084_0284001_223_1233 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dqb-assembly1.cif.gz_E | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.7392 | 8 | 312 |
| 2dqb-assembly1.cif.gz_B | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.739 | 6 | 312 |
| 2dqb-assembly1.cif.gz_A | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.7388 | 5 | 312 |
| 2dqb-assembly1.cif.gz_C | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.7315 | 6 | 312 |
| 2dqb-assembly1.cif.gz_F | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.7254 | 8 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dqbE00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7043 | 8 | 312 | 1.10.3210.10 |
| 2dqbE00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6769 | 8 | 312 | 1.10.3210.10 |
| af_P9WNY7_7_418_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6755 | 29 | 305 | 1.10.3210.10 |
| af_P9WNY7_7_418_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5963 | 29 | 305 | 1.10.3210.10 |
| af_Q4DB46_214_548_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.558 | 48 | 317 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7UHM1-F1-model_v4 | HD domain-containing protein | 0.9391 | 95 | 310 |
|
| AF-A0A357CYY6-F1-model_v4 | Deoxyguanosinetriphosphate triphosphohydrolase | 0.928 | 151 | 236 |
GO:0016787
|
| AF-A0A538HMG7-F1-model_v4 | Deoxyguanosinetriphosphate triphosphohydrolase | 0.9264 | 172 | 309 |
GO:0016787
|
| AF-A0A1Q7UHM1-F1-model_v4 | HD domain-containing protein | 0.9258 | 95 | 310 |
|
| AF-A0A7W0A8L9-F1-model_v4 | deleted | 0.9236 | 227 | 313 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar