F361520

General Info

Members Datasets Scaffolds Average Seq Length
250 175 250 321

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10027709|Ga0114129_100277096
Length 299
Sequence MAQLARTSFRERIERLEESLSPLATRSYPADREEPEPDSDHRTPFQRDRDRIVHSKAFRRLKHKTQVFIAPEGDHYRTRLTHTLEACGIARGHPPFGHTGEAVLDECMRERWGSGFRHNEHSLRVVEKIERLNLTAPVRDGILRHTGPEPPGTLEGRIVRLVDRVAYINHDIDDAIRAGVLRFEDLPRAEIELLGHTGSDRIETLVVDVLRHSEDAGDIVQGEEVGAAMLRLREFMFEHVYLGPAAQRERPRIERMLRALFDHYADELGDEQRVVDWLAGMTDRYAIREFENLSAPQGF

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
84 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
174 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 11.2
Rhizosphere 83.6
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1005096 3300002074 Bacteria 1520
2 JGI24034J26672_10000547 3300002239 Bacteria 4811
3 Ga0070658_10054216 3300005327 Bacteria 3256
4 Ga0070683_100060966 3300005329 Bacteria 3507
5 Ga0070683_100062324 3300005329 Bacteria 3468
6 Ga0070683_100195249 3300005329 Bacteria 1922
7 Ga0070677_10000015 3300005333 Bacteria 52793
8 Ga0070680_100186405 3300005336 Bacteria 1748
9 Ga0070682_100000078 3300005337 Bacteria 87953
10 Ga0068868_100000609 3300005338 Bacteria 24032
11 Ga0070674_100000007 3300005356 Bacteria 145531
12 Ga0070673_100024857 3300005364 Bacteria 4398
13 Ga0070667_100026976 3300005367 Bacteria 4778
14 Ga0070711_100017782 3300005439 Bacteria 4530
15 Ga0070700_100107100 3300005441 Bacteria 1852
16 Ga0070663_100012559 3300005455 Bacteria 5363
17 Ga0070662_100000002 3300005457 Bacteria 253208
18 Ga0070681_10021833 3300005458 Bacteria 6420
19 Ga0068867_100000543 3300005459 Bacteria 24807
20 Ga0070679_100000913 3300005530 Bacteria 25634
21 Ga0070679_100030115 3300005530 Bacteria 5357
22 Ga0070684_100055836 3300005535 Bacteria 3444
23 Ga0068853_100005036 3300005539 Bacteria 10303
24 Ga0070693_100003232 3300005547 Bacteria 7564
25 Ga0070665_100000141 3300005548 Bacteria 135473
26 Ga0070704_100089107 3300005549 Bacteria 2294
27 Ga0068856_100007253 3300005614 Bacteria 10813
28 Ga0068864_100000015 3300005618 Bacteria 303368
29 Ga0068866_10000003 3300005718 Bacteria 281675
30 Ga0068863_100000129 3300005841 Bacteria 79654
31 Ga0068863_100010553 3300005841 Bacteria 8969
32 Ga0068858_100000118 3300005842 Bacteria 83359
33 Ga0068858_100000508 3300005842 Bacteria 40801
34 Ga0068860_100005371 3300005843 Bacteria 12998
35 Ga0068860_100353937 3300005843 Bacteria 1445
36 Ga0068862_100001367 3300005844 Bacteria 22660
37 Ga0081455_10005820 3300005937 Bacteria 13416
38 Ga0081455_10066685 3300005937 Bacteria 3004
39 Ga0081538_10018160 3300005981 Bacteria 5299
40 Ga0081540_1039920 3300005983 Bacteria 2454
41 Ga0081540_1109641 3300005983 Bacteria 1170
42 Ga0081539_10007406 3300005985 Bacteria 10023
43 Ga0070712_100102836 3300006175 Bacteria 2117
44 Ga0075430_100135636 3300006846 Bacteria 2051
45 Ga0068865_100150929 3300006881 Bacteria 1763
46 Ga0105245_10000517 3300009098 Bacteria 35353
47 Ga0105245_10006233 3300009098 Bacteria 10491
48 Ga0105247_10002698 3300009101 Bacteria 11915
49 Ga0114129_10027709 3300009147 Bacteria 8021
50 Ga0105242_10000117 3300009176 Bacteria 57885
51 Ga0105242_10000931 3300009176 Bacteria 22774
52 Ga0105242_10082026 3300009176 Bacteria 2698
53 Ga0105249_10000178 3300009553 Bacteria 74768
54 Ga0105249_10027851 3300009553 Bacteria 5099
55 Ga0105249_10214121 3300009553 Bacteria 1892
56 Ga0157370_10016677 3300013104 Bacteria 7434
57 Ga0157374_10000268 3300013296 Bacteria 48268
58 Ga0157374_10348285 3300013296 Bacteria 1472
59 Ga0157375_10074813 3300013308 Bacteria 3409
60 Ga0163163_10086787 3300014325 Bacteria 3139
61 Ga0157380_10000016 3300014326 Bacteria 126029
62 Ga0157380_10001924 3300014326 Bacteria 13804
63 Ga0157379_10015449 3300014968 Bacteria 6699
64 Ga0157376_10016750 3300014969 Bacteria 5573
65 Ga0157376_10049714 3300014969 Bacteria 3474
66 Ga0163161_10000022 3300017792 Bacteria 207890
67 Ga0206356_10163041 3300020070 Bacteria 3575
68 Ga0207682_10000155 3300025893 Bacteria 31180
69 Ga0207642_10000002 3300025899 Bacteria 658166
70 Ga0207710_10000179 3300025900 Bacteria 64100
71 Ga0207685_10000031 3300025905 Bacteria 77451
72 Ga0207705_10115676 3300025909 Bacteria 1985
73 Ga0207693_10104979 3300025915 Bacteria 2216
74 Ga0207663_10023521 3300025916 Bacteria 3537
75 Ga0207652_10003179 3300025921 Bacteria 13657
76 Ga0207652_10023407 3300025921 Bacteria 5117
77 Ga0207687_10000085 3300025927 Bacteria 68919
78 Ga0207687_10018529 3300025927 Bacteria 4598
79 Ga0207690_10039597 3300025932 Bacteria 3076
80 Ga0207706_10000001 3300025933 Bacteria 423014
81 Ga0207686_10000116 3300025934 Bacteria 64638
82 Ga0207686_10002073 3300025934 Bacteria 11046
83 Ga0207686_10091675 3300025934 Bacteria 2008
84 Ga0207669_10000001 3300025937 Bacteria 377747
85 Ga0207704_10117657 3300025938 Bacteria 1811
86 Ga0207661_10002160 3300025944 Bacteria 13551
87 Ga0207661_10041535 3300025944 Bacteria 3621
88 Ga0207661_10126007 3300025944 Bacteria 2187
89 Ga0207651_10001163 3300025960 Bacteria 11775
90 Ga0207712_10000118 3300025961 Bacteria 85518
91 Ga0207712_10021794 3300025961 Bacteria 4211
92 Ga0207640_10012398 3300025981 Bacteria 4852
93 Ga0207658_10011022 3300025986 Bacteria 6153
94 Ga0207677_10000397 3300026023 Bacteria 29959
95 Ga0207703_10000061 3300026035 Bacteria 132671
96 Ga0207703_10000385 3300026035 Bacteria 47298
97 Ga0207639_10009141 3300026041 Bacteria 6830
98 Ga0207678_10024067 3300026067 Bacteria 5321
99 Ga0207702_10002161 3300026078 Bacteria 18875
100 Ga0207641_10000016 3300026088 Bacteria 307363
101 Ga0207648_10000499 3300026089 Bacteria 43734
102 Ga0207676_10000018 3300026095 Bacteria 306375
103 Ga0207675_100145170 3300026118 Bacteria 2256
104 Ga0268266_10000056 3300028379 Bacteria 289176
105 Ga0268265_10019795 3300028380 Bacteria 4685
106 Ga0268264_10010495 3300028381 Bacteria 7656
107 Ga0268264_10098705 3300028381 Bacteria 2533
108 Ga0265337_1000007 3300028556 Bacteria 98412
109 Ga0265326_10000019 3300028558 Bacteria 137370
110 Ga0265319_1000014 3300028563 Bacteria 177623
111 Ga0265322_10000011 3300028654 Bacteria 167597
112 Ga0265336_10008819 3300028666 Bacteria 3515
113 Ga0265336_10025346 3300028666 Bacteria 1869
114 Ga0265338_10000244 3300028800 Bacteria 100528
115 Ga0265338_10138085 3300028800 Bacteria 1913
116 Ga0265324_10000517 3300029957 Bacteria 26580
117 Ga0265320_10000011 3300031240 Bacteria 249534
118 Ga0265339_10024586 3300031249 Bacteria 3469
119 Ga0265331_10001501 3300031250 Bacteria 17222
120 Ga0265331_10020608 3300031250 Bacteria 3383
121 Ga0265327_10000015 3300031251 Bacteria 496677
122 Ga0265313_10021688 3300031595 Bacteria 3506
123 Ga0265314_10000513 3300031711 Bacteria 49998
124 Ga0307415_100001185 3300032126 Bacteria 12191
125 Ga0307415_100079849 3300032126 Bacteria 2332
126 Ga0373933_0092404 3300035724 Bacteria 1869
127 Ga0373937_0146251 3300036401 Bacteria 2212
128 Ga0451833_1141119 3300041491 Bacteria 1329
129 Ga0451853_3732269 3300041512 Bacteria 3040
130 Ga0466963_0000004 3300044694 Bacteria 102526
131 Ga0466967_0165829 3300045976 Bacteria 2076
132 Ga0495592_0000078 3300046454 Bacteria 85591
133 Ga0495603_0002937 3300046455 Bacteria 10079
134 Ga0495629_0000260 3300046459 Bacteria 46062
135 Ga0495629_0006194 3300046459 Bacteria 8884
136 Ga0495629_0113469 3300046459 Bacteria 1889
137 Ga0495629_0196482 3300046459 Bacteria 1395
138 Ga0495641_0000005 3300046461 Bacteria 206626
139 Ga0495641_0036793 3300046461 Bacteria 2298
140 Ga0495651_0048630 3300046462 Bacteria 3275
141 Ga0495653_0058088 3300046463 Bacteria 2941
142 Ga0495653_0147482 3300046463 Bacteria 1647
143 Ga0495582_0000001 3300046473 Bacteria 252434
144 Ga0495639_0056496 3300046475 Bacteria 1792
145 Ga0495662_0000001 3300046476 Bacteria 179185
146 Ga0495662_0077307 3300046476 Bacteria 1616
147 Ga0495608_0000284 3300046511 Bacteria 35636
148 Ga0495608_0002626 3300046511 Bacteria 12905
149 Ga0495608_0073817 3300046511 Bacteria 2224
150 Ga0495618_0000014 3300046514 Bacteria 163136
151 Ga0495620_0067721 3300046515 Bacteria 1468
152 Ga0495628_0012150 3300046516 Bacteria 7257
153 Ga0495628_0031394 3300046516 Bacteria 4298
154 Ga0495628_0165099 3300046516 Bacteria 1681
155 Ga0495628_0173647 3300046516 Bacteria 1633
156 Ga0495628_0216531 3300046516 Bacteria 1439
157 Ga0495630_0003323 3300046517 Bacteria 11203
158 Ga0495630_0004700 3300046517 Bacteria 9583
159 Ga0495630_0111386 3300046517 Bacteria 2073
160 Ga0495630_0255832 3300046517 Bacteria 1338
161 Ga0495644_0004198 3300046523 Bacteria 5661
162 Ga0495652_0000010 3300046529 Bacteria 261584
163 Ga0495652_0016086 3300046529 Bacteria 6692
164 Ga0495587_0002555 3300046536 Bacteria 12162
165 Ga0495598_0002922 3300046537 Bacteria 3581
166 Ga0495633_0031350 3300046558 Bacteria 2578
167 Ga0495667_0000020 3300046559 Bacteria 180876
168 Ga0495634_0020489 3300046642 Bacteria 4689
169 Ga0495634_0039388 3300046642 Bacteria 3218
170 Ga0495635_0000031 3300046663 Bacteria 110244
171 Ga0495635_0124415 3300046663 Bacteria 1758
172 Ga0495635_0125971 3300046663 Bacteria 1747
173 Ga0495635_0155435 3300046663 Bacteria 1557
174 Ga0495657_0025476 3300046675 Bacteria 4199
175 Ga0495599_0002353 3300046678 Bacteria 10976
176 Ga0495647_0000350 3300046681 Bacteria 13029
177 Ga0495658_0000002 3300046683 Bacteria 309651
178 Ga0495669_0000076 3300046684 Bacteria 65203
179 Ga0495613_0000005 3300046689 Bacteria 222558
180 Ga0495624_0000019 3300046690 Bacteria 102237
181 Ga0495670_0027945 3300046691 Bacteria 2796
182 Ga0495649_0003593 3300046694 Bacteria 10394
183 Ga0495604_0000067 3300047317 Bacteria 90345
184 Ga0495676_0000238 3300047321 Bacteria 44160
185 Ga0495676_0050315 3300047321 Bacteria 3343
186 Ga0495680_0000143 3300047322 Bacteria 71946
187 Ga0495680_0001976 3300047322 Bacteria 21537
188 Ga0495680_0004240 3300047322 Bacteria 13761
189 Ga0495679_012540 3300047446 Bacteria 3219
190 Ga0495614_0091577 3300048089 Bacteria 1323
191 Ga0496100_0000059 3300048903 Bacteria 65518
192 Ga0496101_0000135 3300048904 Bacteria 65518
193 Ga0496102_0000294 3300048905 Bacteria 64001
194 Ga0496102_0227801 3300048905 Bacteria 1757
195 Ga0496103_0000159 3300048906 Bacteria 71148
196 Ga0496103_0213644 3300048906 Bacteria 1240
197 Ga0496104_0000015 3300048907 Bacteria 374530
198 Ga0496104_0000025 3300048907 Bacteria 228519
199 Ga0496104_0000133 3300048907 Bacteria 69099
200 Ga0496105_0000004 3300048908 Bacteria 475798
201 Ga0496105_0000023 3300048908 Bacteria 156126
202 Ga0496105_0000595 3300048908 Bacteria 24079
203 Ga0496106_0000030 3300048909 Bacteria 136804
204 Ga0496106_0000252 3300048909 Bacteria 37666
205 Ga0496107_0000054 3300048910 Bacteria 60902
206 Ga0496107_0063938 3300048910 Bacteria 2667
207 Ga0496108_0000006 3300048911 Bacteria 469473
208 Ga0496108_0000397 3300048911 Bacteria 35950
209 Ga0496109_0000009 3300048912 Bacteria 236561
210 Ga0496109_0000803 3300048912 Bacteria 26180
211 Ga0496109_0029860 3300048912 Bacteria 4885
212 Ga0496110_0022820 3300048913 Bacteria 5317
213 Ga0496110_0085034 3300048913 Bacteria 2824
214 Ga0496112_0000025 3300048915 Bacteria 146197
215 Ga0496114_0000800 3300048917 Bacteria 23530
216 Ga0496114_0002880 3300048917 Bacteria 13188
217 Ga0496115_0000011 3300048918 Bacteria 222529
218 Ga0496115_0000770 3300048918 Bacteria 23530
219 Ga0496116_0000331 3300048919 Bacteria 76536
220 Ga0496117_0001515 3300048920 Bacteria 33278
221 Ga0496118_0001489 3300048921 Bacteria 34977
222 Ga0496119_0007655 3300048922 Bacteria 9675
223 Ga0496119_0040827 3300048922 Bacteria 2962
224 Ga0496121_0008646 3300048924 Bacteria 11909
225 Ga0496126_0023918 3300048929 Bacteria 5908
226 Ga0496126_0072784 3300048929 Bacteria 3056
227 Ga0501040_0286796 3300049576 Bacteria 1176
228 Ga0501042_0096289 3300049578 Bacteria 2126
229 Ga0501070_0003012 3300049586 Bacteria 14665
230 Ga0501074_0179966 3300049590 Bacteria 1508
231 Ga0501075_0012256 3300049591 Bacteria 6087
232 Ga0501083_0082411 3300049744 Bacteria 2131
233 Ga0501044_0056738 3300049823 Bacteria 4021
234 nmdc:mga0a205_4244_c2 3300050515 Bacteria 9156
235 Ga0495601_0000448 3300053077 Bacteria 21585
236 Ga0495601_0004637 3300053077 Bacteria 7956
237 Ga0495601_0007612 3300053077 Bacteria 6360
238 Ga0495612_0000132 3300053078 Bacteria 31605
239 Ga0495655_0000002 3300053083 Bacteria 312752
240 Ga0495595_0000111 3300053084 Bacteria 37420
241 Ga0495619_0000008 3300053085 Bacteria 305999
242 Ga0495619_0001017 3300053085 Bacteria 18372
243 Ga0495619_0001398 3300053085 Bacteria 15882
244 Ga0495619_0002624 3300053085 Bacteria 11739
245 Ga0495619_0013611 3300053085 Bacteria 5126
246 Ga0495619_0015227 3300053085 Bacteria 4863
247 Ga0500566_0006069 3300053094 Bacteria 7182
248 Ga0500614_000631 3300053123 Bacteria 8967
249 Ga0500628_000001 3300053129 Bacteria 564074
250 Ga0501084_0284001 3300054114 Bacteria 1398

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10027709 Ga0114129_100277096 296
2 3300025927 Ga0207687_10018529 Ga0207687_100185294 299
3 3300025944 Ga0207661_10002160 Ga0207661_100021608 299
4 3300032126 Ga0307415_100079849 Ga0307415_1000798492 299
5 3300017792 Ga0163161_10000022 Ga0163161_1000002247 300
6 3300025934 Ga0207686_10002073 Ga0207686_100020732 300
7 3300009176 Ga0105242_10082026 Ga0105242_100820262 305
8 3300025934 Ga0207686_10091675 Ga0207686_100916752 305
9 3300046517 Ga0495630_0003323 Ga0495630_0003323_8763_9794 307
10 3300046642 Ga0495634_0020489 Ga0495634_0020489_3114_4145 307
11 3300046663 Ga0495635_0155435 Ga0495635_0155435_394_1425 307
12 3300046675 Ga0495657_0025476 Ga0495657_0025476_753_1784 307
13 3300053077 Ga0495601_0007612 Ga0495601_0007612_5284_6315 307
14 3300053085 Ga0495619_0002624 Ga0495619_0002624_3184_4215 307
15 3300005618 Ga0068864_100000015 Ga0068864_100000015147 308
16 3300006881 Ga0068865_100150929 Ga0068865_1001509292 308
17 3300025938 Ga0207704_10117657 Ga0207704_101176572 308
18 3300026095 Ga0207676_10000018 Ga0207676_10000018153 308
19 3300046517 Ga0495630_0111386 Ga0495630_0111386_691_1701 308
20 3300049586 Ga0501070_0003012 Ga0501070_0003012_12183_13205 308
21 3300005329 Ga0070683_100195249 Ga0070683_1001952492 309
22 3300025944 Ga0207661_10126007 Ga0207661_101260072 309
23 3300005981 Ga0081538_10018160 Ga0081538_100181604 310
24 3300013296 Ga0157374_10000268 Ga0157374_1000026810 313
25 3300013308 Ga0157375_10074813 Ga0157375_100748133 313
26 3300025932 Ga0207690_10039597 Ga0207690_100395973 313
27 3300046455 Ga0495603_0002937 Ga0495603_0002937_6728_7726 313
28 3300046459 Ga0495629_0196482 Ga0495629_0196482_282_1280 313
29 3300046463 Ga0495653_0147482 Ga0495653_0147482_430_1428 313
30 3300046475 Ga0495639_0056496 Ga0495639_0056496_584_1582 313
31 3300046514 Ga0495618_0000014 Ga0495618_0000014_62650_63648 313
32 3300046523 Ga0495644_0004198 Ga0495644_0004198_1106_2104 313
33 3300046690 Ga0495624_0000019 Ga0495624_0000019_2882_3880 313
34 3300005441 Ga0070700_100107100 Ga0070700_1001071001 314
35 3300014326 Ga0157380_10001924 Ga0157380_1000192413 314
36 3300046537 Ga0495598_0002922 Ga0495598_0002922_627_1625 314
37 3300048915 Ga0496112_0000025 Ga0496112_0000025_144269_145267 314
38 3300046463 Ga0495653_0058088 Ga0495653_0058088_55_1056 315
39 3300048911 Ga0496108_0000397 Ga0496108_0000397_12318_13319 315
40 3300048912 Ga0496109_0000803 Ga0496109_0000803_6332_7333 315
41 3300005548 Ga0070665_100000141 Ga0070665_10000014183 317
42 3300005841 Ga0068863_100000129 Ga0068863_10000012914 317
43 3300005842 Ga0068858_100000118 Ga0068858_10000011834 317
44 3300009098 Ga0105245_10006233 Ga0105245_1000623310 317
45 3300026035 Ga0207703_10000061 Ga0207703_1000006152 317
46 3300026088 Ga0207641_10000016 Ga0207641_10000016108 317
47 3300028379 Ga0268266_10000056 Ga0268266_1000005691 317
48 3300046516 Ga0495628_0165099 Ga0495628_0165099_384_1394 317
49 3300046678 Ga0495599_0002353 Ga0495599_0002353_8599_9609 317
50 3300048909 Ga0496106_0000030 Ga0496106_0000030_41423_42430 317
51 3300048910 Ga0496107_0063938 Ga0496107_0063938_1641_2648 317
52 3300053077 Ga0495601_0000448 Ga0495601_0000448_7611_8621 317
53 3300053077 Ga0495601_0004637 Ga0495601_0004637_3291_4298 317
54 3300002074 JGI24748J21848_1005096 JGI24748J21848_10050962 318
55 3300002239 JGI24034J26672_10000547 JGI24034J26672_100005474 318
56 3300005327 Ga0070658_10054216 Ga0070658_100542161 318
57 3300005329 Ga0070683_100060966 Ga0070683_1000609661 318
58 3300005329 Ga0070683_100062324 Ga0070683_1000623244 318
59 3300005333 Ga0070677_10000015 Ga0070677_1000001525 318
60 3300005336 Ga0070680_100186405 Ga0070680_1001864052 318
61 3300005337 Ga0070682_100000078 Ga0070682_10000007877 318
62 3300005338 Ga0068868_100000609 Ga0068868_10000060911 318
63 3300005356 Ga0070674_100000007 Ga0070674_100000007106 318
64 3300005364 Ga0070673_100024857 Ga0070673_1000248574 318
65 3300005367 Ga0070667_100026976 Ga0070667_1000269762 318
66 3300005439 Ga0070711_100017782 Ga0070711_1000177822 318
67 3300005455 Ga0070663_100012559 Ga0070663_1000125593 318
68 3300005457 Ga0070662_100000002 Ga0070662_100000002183 318
69 3300005458 Ga0070681_10021833 Ga0070681_100218335 318
70 3300005459 Ga0068867_100000543 Ga0068867_10000054318 318
71 3300005530 Ga0070679_100000913 Ga0070679_10000091333 318
72 3300005530 Ga0070679_100030115 Ga0070679_1000301153 318
73 3300005535 Ga0070684_100055836 Ga0070684_1000558363 318
74 3300005539 Ga0068853_100005036 Ga0068853_1000050367 318
75 3300005547 Ga0070693_100003232 Ga0070693_1000032322 318
76 3300005549 Ga0070704_100089107 Ga0070704_1000891072 318
77 3300005614 Ga0068856_100007253 Ga0068856_1000072537 318
78 3300005718 Ga0068866_10000003 Ga0068866_10000003248 318
79 3300005841 Ga0068863_100010553 Ga0068863_1000105532 318
80 3300005842 Ga0068858_100000508 Ga0068858_10000050837 318
81 3300005843 Ga0068860_100005371 Ga0068860_10000537112 318
82 3300005843 Ga0068860_100353937 Ga0068860_1003539372 318
83 3300005844 Ga0068862_100001367 Ga0068862_10000136722 318
84 3300005937 Ga0081455_10005820 Ga0081455_1000582011 318
85 3300005937 Ga0081455_10066685 Ga0081455_100666852 318
86 3300005983 Ga0081540_1039920 Ga0081540_10399202 318
87 3300005983 Ga0081540_1109641 Ga0081540_11096411 318
88 3300005985 Ga0081539_10007406 Ga0081539_100074069 318
89 3300006175 Ga0070712_100102836 Ga0070712_1001028362 318
90 3300006846 Ga0075430_100135636 Ga0075430_1001356362 318
91 3300009098 Ga0105245_10000517 Ga0105245_1000051733 318
92 3300009101 Ga0105247_10002698 Ga0105247_100026987 318
93 3300009176 Ga0105242_10000117 Ga0105242_100001174 318
94 3300009176 Ga0105242_10000931 Ga0105242_1000093128 318
95 3300009553 Ga0105249_10000178 Ga0105249_1000017822 318
96 3300009553 Ga0105249_10027851 Ga0105249_100278515 318
97 3300009553 Ga0105249_10214121 Ga0105249_102141212 318
98 3300013104 Ga0157370_10016677 Ga0157370_100166777 318
99 3300013296 Ga0157374_10348285 Ga0157374_103482852 318
100 3300014325 Ga0163163_10086787 Ga0163163_100867872 318
101 3300014326 Ga0157380_10000016 Ga0157380_1000001651 318
102 3300014968 Ga0157379_10015449 Ga0157379_100154493 318
103 3300014969 Ga0157376_10016750 Ga0157376_100167506 318
104 3300014969 Ga0157376_10049714 Ga0157376_100497142 318
105 3300020070 Ga0206356_10163041 Ga0206356_101630412 318
106 3300025893 Ga0207682_10000155 Ga0207682_1000015535 318
107 3300025899 Ga0207642_10000002 Ga0207642_10000002498 318
108 3300025900 Ga0207710_10000179 Ga0207710_1000017987 318
109 3300025905 Ga0207685_10000031 Ga0207685_1000003146 318
110 3300025909 Ga0207705_10115676 Ga0207705_101156762 318
111 3300025915 Ga0207693_10104979 Ga0207693_101049793 318
112 3300025916 Ga0207663_10023521 Ga0207663_100235213 318
113 3300025921 Ga0207652_10003179 Ga0207652_100031793 318
114 3300025921 Ga0207652_10023407 Ga0207652_100234073 318
115 3300025927 Ga0207687_10000085 Ga0207687_1000008536 318
116 3300025933 Ga0207706_10000001 Ga0207706_10000001365 318
117 3300025934 Ga0207686_10000116 Ga0207686_1000011648 318
118 3300025937 Ga0207669_10000001 Ga0207669_1000000144 318
119 3300025944 Ga0207661_10041535 Ga0207661_100415354 318
120 3300025960 Ga0207651_10001163 Ga0207651_100011634 318
121 3300025961 Ga0207712_10000118 Ga0207712_1000011856 318
122 3300025961 Ga0207712_10021794 Ga0207712_100217943 318
123 3300025981 Ga0207640_10012398 Ga0207640_100123983 318
124 3300025986 Ga0207658_10011022 Ga0207658_100110224 318
125 3300026023 Ga0207677_10000397 Ga0207677_100003976 318
126 3300026035 Ga0207703_10000385 Ga0207703_1000038543 318
127 3300026041 Ga0207639_10009141 Ga0207639_100091417 318
128 3300026067 Ga0207678_10024067 Ga0207678_100240673 318
129 3300026078 Ga0207702_10002161 Ga0207702_1000216115 318
130 3300026089 Ga0207648_10000499 Ga0207648_1000049929 318
131 3300026118 Ga0207675_100145170 Ga0207675_1001451702 318
132 3300028380 Ga0268265_10019795 Ga0268265_100197954 318
133 3300028381 Ga0268264_10010495 Ga0268264_100104957 318
134 3300028381 Ga0268264_10098705 Ga0268264_100987052 318
135 3300028556 Ga0265337_1000007 Ga0265337_100000772 318
136 3300028558 Ga0265326_10000019 Ga0265326_1000001970 318
137 3300028563 Ga0265319_1000014 Ga0265319_1000014165 318
138 3300028654 Ga0265322_10000011 Ga0265322_1000001170 318
139 3300028666 Ga0265336_10008819 Ga0265336_100088193 318
140 3300028666 Ga0265336_10025346 Ga0265336_100253461 318
141 3300028800 Ga0265338_10000244 Ga0265338_1000024441 318
142 3300028800 Ga0265338_10138085 Ga0265338_101380852 318
143 3300029957 Ga0265324_10000517 Ga0265324_1000051731 318
144 3300031240 Ga0265320_10000011 Ga0265320_1000001170 318
145 3300031249 Ga0265339_10024586 Ga0265339_100245862 318
146 3300031250 Ga0265331_10001501 Ga0265331_100015018 318
147 3300031250 Ga0265331_10020608 Ga0265331_100206083 318
148 3300031251 Ga0265327_10000015 Ga0265327_10000015178 318
149 3300031595 Ga0265313_10021688 Ga0265313_100216884 318
150 3300031711 Ga0265314_10000513 Ga0265314_1000051349 318
151 3300032126 Ga0307415_100001185 Ga0307415_10000118511 318
152 3300035724 Ga0373933_0092404 Ga0373933_0092404_265_1278 318
153 3300036401 Ga0373937_0146251 Ga0373937_0146251_382_1395 318
154 3300041491 Ga0451833_1141119 Ga0451833_1141119_134_1144 318
155 3300041512 Ga0451853_3732269 Ga0451853_3732269_1879_2892 318
156 3300044694 Ga0466963_0000004 Ga0466963_0000004_75324_76337 318
157 3300045976 Ga0466967_0165829 Ga0466967_0165829_84_1097 318
158 3300046454 Ga0495592_0000078 Ga0495592_0000078_9906_10916 318
159 3300046459 Ga0495629_0000260 Ga0495629_0000260_14755_15765 318
160 3300046459 Ga0495629_0006194 Ga0495629_0006194_6414_7424 318
161 3300046459 Ga0495629_0113469 Ga0495629_0113469_821_1831 318
162 3300046461 Ga0495641_0000005 Ga0495641_0000005_97306_98319 318
163 3300046461 Ga0495641_0036793 Ga0495641_0036793_327_1394 318
164 3300046462 Ga0495651_0048630 Ga0495651_0048630_2005_3015 318
165 3300046473 Ga0495582_0000001 Ga0495582_0000001_30973_31986 318
166 3300046476 Ga0495662_0000001 Ga0495662_0000001_59131_60141 318
167 3300046476 Ga0495662_0077307 Ga0495662_0077307_582_1592 318
168 3300046511 Ga0495608_0000284 Ga0495608_0000284_19800_20810 318
169 3300046511 Ga0495608_0002626 Ga0495608_0002626_1372_2382 318
170 3300046511 Ga0495608_0073817 Ga0495608_0073817_106_1119 318
171 3300046515 Ga0495620_0067721 Ga0495620_0067721_380_1390 318
172 3300046516 Ga0495628_0012150 Ga0495628_0012150_1872_2882 318
173 3300046516 Ga0495628_0031394 Ga0495628_0031394_1000_2010 318
174 3300046516 Ga0495628_0173647 Ga0495628_0173647_337_1392 318
175 3300046516 Ga0495628_0216531 Ga0495628_0216531_320_1330 318
176 3300046517 Ga0495630_0004700 Ga0495630_0004700_6439_7449 318
177 3300046517 Ga0495630_0255832 Ga0495630_0255832_95_1105 318
178 3300046529 Ga0495652_0000010 Ga0495652_0000010_220952_221962 318
179 3300046529 Ga0495652_0016086 Ga0495652_0016086_5595_6650 318
180 3300046536 Ga0495587_0002555 Ga0495587_0002555_2804_3814 318
181 3300046558 Ga0495633_0031350 Ga0495633_0031350_1236_2246 318
182 3300046559 Ga0495667_0000020 Ga0495667_0000020_17008_18018 318
183 3300046642 Ga0495634_0039388 Ga0495634_0039388_1557_2567 318
184 3300046663 Ga0495635_0000031 Ga0495635_0000031_60540_61550 318
185 3300046663 Ga0495635_0124415 Ga0495635_0124415_409_1419 318
186 3300046663 Ga0495635_0125971 Ga0495635_0125971_38_1060 318
187 3300046681 Ga0495647_0000350 Ga0495647_0000350_9459_10469 318
188 3300046683 Ga0495658_0000002 Ga0495658_0000002_154579_155592 318
189 3300046684 Ga0495669_0000076 Ga0495669_0000076_51572_52585 318
190 3300046689 Ga0495613_0000005 Ga0495613_0000005_151554_152564 318
191 3300046691 Ga0495670_0027945 Ga0495670_0027945_1246_2256 318
192 3300046694 Ga0495649_0003593 Ga0495649_0003593_1905_2918 318
193 3300047317 Ga0495604_0000067 Ga0495604_0000067_62815_63825 318
194 3300047321 Ga0495676_0000238 Ga0495676_0000238_30770_31783 318
195 3300047321 Ga0495676_0050315 Ga0495676_0050315_1272_2282 318
196 3300047322 Ga0495680_0000143 Ga0495680_0000143_57552_58562 318
197 3300047322 Ga0495680_0001976 Ga0495680_0001976_7108_8121 318
198 3300047322 Ga0495680_0004240 Ga0495680_0004240_1277_2287 318
199 3300047446 Ga0495679_012540 Ga0495679_012540_1694_2707 318
200 3300048089 Ga0495614_0091577 Ga0495614_0091577_259_1269 318
201 3300048903 Ga0496100_0000059 Ga0496100_0000059_41020_42033 318
202 3300048904 Ga0496101_0000135 Ga0496101_0000135_23486_24499 318
203 3300048905 Ga0496102_0000294 Ga0496102_0000294_24680_25690 318
204 3300048905 Ga0496102_0227801 Ga0496102_0227801_191_1213 318
205 3300048906 Ga0496103_0000159 Ga0496103_0000159_38499_39509 318
206 3300048906 Ga0496103_0213644 Ga0496103_0213644_77_1099 318
207 3300048907 Ga0496104_0000015 Ga0496104_0000015_179344_180354 318
208 3300048907 Ga0496104_0000025 Ga0496104_0000025_56737_57750 318
209 3300048907 Ga0496104_0000133 Ga0496104_0000133_50288_51298 318
210 3300048908 Ga0496105_0000004 Ga0496105_0000004_295445_296455 318
211 3300048908 Ga0496105_0000023 Ga0496105_0000023_56737_57750 318
212 3300048908 Ga0496105_0000595 Ga0496105_0000595_13913_14923 318
213 3300048909 Ga0496106_0000252 Ga0496106_0000252_36358_37371 318
214 3300048910 Ga0496107_0000054 Ga0496107_0000054_23486_24499 318
215 3300048911 Ga0496108_0000006 Ga0496108_0000006_445283_446296 318
216 3300048912 Ga0496109_0000009 Ga0496109_0000009_212371_213384 318
217 3300048912 Ga0496109_0029860 Ga0496109_0029860_1721_2782 318
218 3300048913 Ga0496110_0022820 Ga0496110_0022820_197_1207 318
219 3300048913 Ga0496110_0085034 Ga0496110_0085034_810_1823 318
220 3300048917 Ga0496114_0000800 Ga0496114_0000800_13778_14788 318
221 3300048917 Ga0496114_0002880 Ga0496114_0002880_8684_9697 318
222 3300048918 Ga0496115_0000011 Ga0496115_0000011_140277_141317 318
223 3300048918 Ga0496115_0000770 Ga0496115_0000770_13778_14788 318
224 3300048919 Ga0496116_0000331 Ga0496116_0000331_39459_40505 318
225 3300048920 Ga0496117_0001515 Ga0496117_0001515_310_1332 318
226 3300048921 Ga0496118_0001489 Ga0496118_0001489_13777_14799 318
227 3300048922 Ga0496119_0007655 Ga0496119_0007655_1776_2822 318
228 3300048922 Ga0496119_0040827 Ga0496119_0040827_810_1820 318
229 3300048924 Ga0496121_0008646 Ga0496121_0008646_602_1618 318
230 3300048929 Ga0496126_0023918 Ga0496126_0023918_1951_2964 318
231 3300048929 Ga0496126_0072784 Ga0496126_0072784_114_1127 318
232 3300049576 Ga0501040_0286796 Ga0501040_0286796_103_1113 318
233 3300049578 Ga0501042_0096289 Ga0501042_0096289_1003_2013 318
234 3300049590 Ga0501074_0179966 Ga0501074_0179966_44_1057 318
235 3300049591 Ga0501075_0012256 Ga0501075_0012256_2351_3361 318
236 3300049744 Ga0501083_0082411 Ga0501083_0082411_235_1311 318
237 3300049823 Ga0501044_0056738 Ga0501044_0056738_1047_2123 318
238 3300050515 nmdc:mga0a205_4244_c2 nmdc:mga0a205_4244_c2_2699_3712 318
239 3300053078 Ga0495612_0000132 Ga0495612_0000132_17838_18848 318
240 3300053083 Ga0495655_0000002 Ga0495655_0000002_77969_78979 318
241 3300053084 Ga0495595_0000111 Ga0495595_0000111_1883_2893 318
242 3300053085 Ga0495619_0000008 Ga0495619_0000008_138659_139669 318
243 3300053085 Ga0495619_0001017 Ga0495619_0001017_6666_7676 318
244 3300053085 Ga0495619_0001398 Ga0495619_0001398_13411_14421 318
245 3300053085 Ga0495619_0013611 Ga0495619_0013611_3220_4233 318
246 3300053085 Ga0495619_0015227 Ga0495619_0015227_3602_4612 318
247 3300053094 Ga0500566_0006069 Ga0500566_0006069_1286_2296 318
248 3300053123 Ga0500614_000631 Ga0500614_000631_1248_2261 318
249 3300053129 Ga0500628_000001 Ga0500628_000001_166639_167649 318
250 3300054114 Ga0501084_0284001 Ga0501084_0284001_223_1233 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13286

HD_assoc

Phosphohydrolase-associated domain

219

271

0.93

PF13286

HD_assoc

Phosphohydrolase-associated domain

265

292

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dqb-assembly1.cif.gz_E crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.7392 8 312
2dqb-assembly1.cif.gz_B crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.739 6 312
2dqb-assembly1.cif.gz_A crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.7388 5 312
2dqb-assembly1.cif.gz_C crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.7315 6 312
2dqb-assembly1.cif.gz_F crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.7254 8 312
ID Description Score Start End Superfamily
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7043 8 312 1.10.3210.10
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6769 8 312 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6755 29 305 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5963 29 305 1.10.3210.10
af_Q4DB46_214_548_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.558 48 317 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1Q7UHM1-F1-model_v4 HD domain-containing protein 0.9391 95 310
AF-A0A357CYY6-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.928 151 236 GO:0016787
AF-A0A538HMG7-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9264 172 309 GO:0016787
AF-A0A1Q7UHM1-F1-model_v4 HD domain-containing protein 0.9258 95 310
AF-A0A7W0A8L9-F1-model_v4 deleted 0.9236 227 313

Feature Viewer

pLDDT pTM Quality
76.66 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map