F361472

General Info

Members Datasets Scaffolds Average Seq Length
250 182 500 112

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101668750|Ga0070712_1016687501
Length 125
Sequence MSPRIVPGTQTGPTVDEPNTDVIQGTLDLLILKTLSLQPMHGFGIARRVEDISRGVFKVNPGSLLVALQRLERQGWLDAEWRQTENSRRAKFYALTRTGRKQLDVETADWRRRANAVTRLLSAEG

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 1.6
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 32.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_101668750 3300006175 Unclassified 558
2 MRS1b_contig_8836467 2162886011 Unclassified 960
3 LJNas_1000177 3300000546 Bacteria 10627
4 Ga0065704_10217573 3300005289 Bacteria 1086
5 Ga0065712_10205435 3300005290 Unclassified 1092
6 Ga0065715_10150687 3300005293 Bacteria 1733
7 Ga0065715_10261594 3300005293 Bacteria 1136
8 Ga0070683_100009194 3300005329 Bacteria 8439
9 Ga0070683_100541392 3300005329 Bacteria 1113
10 Ga0070670_100095797 3300005331 Bacteria 2553
11 Ga0068869_100609280 3300005334 Bacteria 923
12 Ga0070680_101831709 3300005336 Unclassified 526
13 Ga0070682_100445601 3300005337 Bacteria 990
14 Ga0070660_100694300 3300005339 Bacteria 853
15 Ga0070691_10123848 3300005341 Unclassified 1304
16 Ga0070661_101441218 3300005344 Bacteria 580
17 Ga0070669_100005839 3300005353 Bacteria 8875
18 Ga0070669_100588389 3300005353 Unclassified 931
19 Ga0070675_101024519 3300005354 Unclassified 758
20 Ga0070675_101370773 3300005354 Unclassified 652
21 Ga0070673_101645621 3300005364 Unclassified 607
22 Ga0070688_100045418 3300005365 Unclassified 2714
23 Ga0070688_100737458 3300005365 Archaea 766
24 Ga0070659_100300157 3300005366 Bacteria 1339
25 Ga0070659_101243924 3300005366 Bacteria 659
26 Ga0070714_100383917 3300005435 Bacteria 1325
27 Ga0070713_100533832 3300005436 Bacteria 1110
28 Ga0070710_10111247 3300005437 Bacteria 1645
29 Ga0070711_100041092 3300005439 Bacteria 3122
30 Ga0070662_100173312 3300005457 Bacteria 1696
31 Ga0070681_10508333 3300005458 Bacteria 1118
32 Ga0068867_100271449 3300005459 Unclassified 1387
33 Ga0068867_101094832 3300005459 Bacteria 727
34 Ga0068867_102417643 3300005459 Unclassified 500
35 Ga0070679_100889417 3300005530 Bacteria 834
36 Ga0070684_100006453 3300005535 Bacteria 9079
37 Ga0070684_100025606 3300005535 Bacteria 4962
38 Ga0070672_100063648 3300005543 Bacteria 2913
39 Ga0070672_101797744 3300005543 Unclassified 551
40 Ga0070686_100515249 3300005544 Bacteria 930
41 Ga0070693_100570103 3300005547 Bacteria 813
42 Ga0070665_100036188 3300005548 Bacteria 4966
43 Ga0068855_100034857 3300005563 Bacteria 5997
44 Ga0070664_100086700 3300005564 Unclassified 2705
45 Ga0070664_100099530 3300005564 Bacteria 2527
46 Ga0068857_100123163 3300005577 Bacteria 2336
47 Ga0068856_100004944 3300005614 Bacteria 13199
48 Ga0068856_100527335 3300005614 Bacteria 1202
49 Ga0068866_10102772 3300005718 Bacteria 1580
50 Ga0068866_11248043 3300005718 Unclassified 538
51 Ga0068861_101083185 3300005719 Bacteria 769
52 Ga0068861_101120739 3300005719 Unclassified 757
53 Ga0068860_101217047 3300005843 Unclassified 773
54 Ga0068860_101617663 3300005843 Bacteria 670
55 Ga0081539_10133400 3300005985 Bacteria 1216
56 Ga0070717_10542007 3300006028 Bacteria 1053
57 Ga0070717_11013785 3300006028 Bacteria 756
58 Ga0075363_100753409 3300006048 Bacteria 590
59 Ga0075364_10556558 3300006051 Bacteria 784
60 Ga0070712_100160458 3300006175 Bacteria 1736
61 Ga0097621_100346271 3300006237 Unclassified 1320
62 Ga0068871_100204554 3300006358 Bacteria 1706
63 Ga0075428_100521709 3300006844 Bacteria 1271
64 Ga0075430_100003203 3300006846 Bacteria 13709
65 Ga0075431_100454151 3300006847 Bacteria 1277
66 Ga0075434_100731098 3300006871 Bacteria 1007
67 Ga0068865_100058814 3300006881 Bacteria 2686
68 Ga0105240_10691545 3300009093 Bacteria 1114
69 Ga0111539_10001319 3300009094 Bacteria 33146
70 Ga0111539_10070057 3300009094 Bacteria 4139
71 Ga0111539_10880153 3300009094 Bacteria 1042
72 Ga0105245_10541660 3300009098 Bacteria 1185
73 Ga0105245_11479689 3300009098 Unclassified 730
74 Ga0105247_10498831 3300009101 Bacteria 886
75 Ga0114129_11227144 3300009147 Bacteria 933
76 Ga0114129_12402106 3300009147 Unclassified 631
77 Ga0105242_10003788 3300009176 Bacteria 11754
78 Ga0105242_10436981 3300009176 Unclassified 1230
79 Ga0105242_10461655 3300009176 Archaea 1199
80 Ga0105242_12632846 3300009176 Unclassified 552
81 Ga0105248_11024988 3300009177 Archaea 932
82 Ga0105248_11354624 3300009177 Bacteria 805
83 Ga0105237_10163720 3300009545 Unclassified 2223
84 Ga0105238_10093483 3300009551 Bacteria 2995
85 Ga0105238_12144921 3300009551 Unclassified 593
86 Ga0105249_10000493 3300009553 Bacteria 36447
87 Ga0105249_10067613 3300009553 Bacteria 3293
88 Ga0105239_12976922 3300010375 Unclassified 552
89 Ga0157370_10041733 3300013104 Unclassified 4424
90 Ga0157369_10206072 3300013105 Unclassified 2062
91 Ga0157369_10376616 3300013105 Unclassified 1473
92 Ga0163162_11626836 3300013306 Unclassified 737
93 Ga0157372_10036609 3300013307 Bacteria 5409
94 Ga0157375_10278274 3300013308 Bacteria 1836
95 Ga0163163_11401702 3300014325 Bacteria 760
96 Ga0157380_11735298 3300014326 Bacteria 682
97 Ga0157380_13072509 3300014326 Unclassified 532
98 Ga0157376_12830207 3300014969 Unclassified 525
99 Ga0213876_10678215 3300021384 Bacteria 548
100 Ga0207666_1061487 3300025271 Bacteria 601
101 Ga0207697_10052321 3300025315 Bacteria 1689
102 Ga0207692_10324786 3300025898 Unclassified 943
103 Ga0207692_10370884 3300025898 Bacteria 886
104 Ga0207647_10535294 3300025904 Bacteria 651
105 Ga0207699_10013147 3300025906 Unclassified 4227
106 Ga0207699_10223438 3300025906 Bacteria 1286
107 Ga0207645_10253919 3300025907 Bacteria 1164
108 Ga0207705_11332551 3300025909 Bacteria 547
109 Ga0207684_10840130 3300025910 Bacteria 775
110 Ga0207684_11203583 3300025910 Unclassified 627
111 Ga0207707_10499114 3300025912 Bacteria 1038
112 Ga0207695_10048249 3300025913 Unclassified 4499
113 Ga0207671_10163195 3300025914 Unclassified 1726
114 Ga0207671_11291480 3300025914 Unclassified 568
115 Ga0207693_10153842 3300025915 Bacteria 1809
116 Ga0207660_11211955 3300025917 Unclassified 614
117 Ga0207652_10461290 3300025921 Bacteria 1145
118 Ga0207681_10104700 3300025923 Bacteria 2047
119 Ga0207681_11481124 3300025923 Bacteria 569
120 Ga0207694_10058653 3300025924 Bacteria 2994
121 Ga0207659_11106315 3300025926 Unclassified 682
122 Ga0207700_10465250 3300025928 Bacteria 1116
123 Ga0207700_10973153 3300025928 Unclassified 759
124 Ga0207664_10553306 3300025929 Bacteria 1032
125 Ga0207706_10539293 3300025933 Bacteria 1005
126 Ga0207706_11140703 3300025933 Unclassified 650
127 Ga0207704_10011349 3300025938 Bacteria 4383
128 Ga0207665_10463140 3300025939 Bacteria 974
129 Ga0207665_10746868 3300025939 Bacteria 771
130 Ga0207691_10210739 3300025940 Bacteria 1688
131 Ga0207711_11046676 3300025941 Bacteria 756
132 Ga0207711_11878058 3300025941 Bacteria 542
133 Ga0207661_10478483 3300025944 Unclassified 1136
134 Ga0207661_10601955 3300025944 Bacteria 1009
135 Ga0207679_10065581 3300025945 Unclassified 2718
136 Ga0207679_10794799 3300025945 Bacteria 862
137 Ga0207651_11327062 3300025960 Bacteria 647
138 Ga0207712_10018852 3300025961 Bacteria 4499
139 Ga0207640_11825189 3300025981 Unclassified 550
140 Ga0207702_10074405 3300026078 Bacteria 2932
141 Ga0207702_10277276 3300026078 Bacteria 1584
142 Ga0207648_10438827 3300026089 Bacteria 1187
143 Ga0207674_10041043 3300026116 Bacteria 4788
144 Ga0207428_10145275 3300027907 Bacteria 1808
145 Ga0268266_10226265 3300028379 Bacteria 1721
146 Ga0268264_12507494 3300028381 Bacteria 521
147 Ga0265327_10052301 3300031251 Bacteria 2127
148 Ga0265314_10031245 3300031711 Bacteria 3934
149 Ga0307411_10859832 3300032005 Bacteria 803
150 Ga0373934_0023414 3300035086 Bacteria 2386
151 Ga0373944_0134595 3300035089 Bacteria 861
152 Ga0373923_0038306 3300035111 Unclassified 1964
153 Ga0373956_0288054 3300035119 Bacteria 782
154 Ga0373957_0124634 3300035120 Bacteria 1045
155 Ga0373955_0658133 3300035172 Bacteria 642
156 Ga0373927_0536927 3300035695 Unclassified 773
157 Ga0373933_0016954 3300035724 Bacteria 4083
158 Ga0373947_0119780 3300035725 Bacteria 1671
159 Ga0373947_0290251 3300035725 Bacteria 1089
160 Ga0373937_0019368 3300036401 Bacteria 6091
161 Ga0373937_0521914 3300036401 Unclassified 1128
162 Ga0373925_0067632 3300037068 Bacteria 2695
163 Ga0373925_0591517 3300037068 Bacteria 914
164 Ga0373925_1284115 3300037068 Bacteria 601
165 Ga0395905_0088902 3300037471 Bacteria 2895
166 Ga0395905_1056252 3300037471 Bacteria 715
167 Ga0395905_1067665 3300037471 Unclassified 711
168 Ga0395905_1321044 3300037471 Unclassified 625
169 Ga0436365_1279258 3300039437 Bacteria 1515
170 Ga0451793_0815871 3300041452 Unclassified 611
171 Ga0451843_1001000 3300041509 Bacteria 747
172 Ga0439459_0116313 3300042438 Bacteria 670
173 Ga0466957_0491839 3300044842 Unclassified 849
174 Ga0495592_0119394 3300046454 Unclassified 1857
175 Ga0495592_0761601 3300046454 Unclassified 578
176 Ga0495603_0079823 3300046455 Unclassified 1918
177 Ga0495651_0013601 3300046462 Bacteria 6291
178 Ga0495653_0042086 3300046463 Bacteria 3560
179 Ga0495580_0017112 3300046472 Bacteria 5429
180 Ga0495580_0199736 3300046472 Unclassified 1378
181 Ga0495582_0111576 3300046473 Unclassified 1536
182 Ga0495639_0054879 3300046475 Bacteria 1816
183 Ga0495639_0234129 3300046475 Unclassified 905
184 Ga0495664_0028771 3300046477 Unclassified 3246
185 Ga0495664_0102262 3300046477 Bacteria 1727
186 Ga0495594_0014488 3300046499 Bacteria 4133
187 Ga0495594_0128504 3300046499 Unclassified 1434
188 Ga0495594_0635403 3300046499 Unclassified 605
189 Ga0495608_0042316 3300046511 Bacteria 3046
190 Ga0495608_0057658 3300046511 Bacteria 2562
191 Ga0495608_0410167 3300046511 Unclassified 828
192 Ga0495618_0022129 3300046514 Bacteria 3924
193 Ga0495628_0013499 3300046516 Bacteria 6872
194 Ga0495628_0165984 3300046516 Bacteria 1676
195 Ga0495630_0020760 3300046517 Bacteria 4846
196 Ga0495666_0009006 3300046526 Bacteria 4993
197 Ga0495652_0079016 3300046529 Bacteria 2721
198 Ga0495665_0319844 3300046531 Unclassified 792
199 Ga0495640_0028123 3300046533 Bacteria 4050
200 Ga0495640_0349978 3300046533 Unclassified 912
201 Ga0495587_0056131 3300046536 Bacteria 2317
202 Ga0495645_0005533 3300046543 Bacteria 8685
203 Ga0495667_0000838 3300046559 Bacteria 19846
204 Ga0495656_0445337 3300046615 Bacteria 682
205 Ga0495634_0042417 3300046642 Bacteria 3086
206 Ga0495611_0275143 3300046648 Bacteria 778
207 Ga0495635_0186413 3300046663 Bacteria 1409
208 Ga0495657_0028228 3300046675 Bacteria 3950
209 Ga0495599_0027831 3300046678 Bacteria 3541
210 Ga0495599_0688585 3300046678 Unclassified 590
211 Ga0495623_0072743 3300046679 Unclassified 2137
212 Ga0495646_0239161 3300046680 Bacteria 976
213 Ga0495658_0208783 3300046683 Unclassified 1219
214 Ga0495613_0224551 3300046689 Bacteria 1317
215 Ga0495624_0470623 3300046690 Unclassified 753
216 Ga0495600_0225203 3300046809 Unclassified 1199
217 Ga0495581_0181534 3300047315 Unclassified 1231
218 Ga0495604_0024312 3300047317 Bacteria 4833
219 Ga0495674_0035871 3300047319 Bacteria 4470
220 Ga0495674_0087213 3300047319 Bacteria 2671
221 Ga0495674_0151965 3300047319 Unclassified 1941
222 Ga0495676_0210748 3300047321 Unclassified 1344
223 Ga0495680_0037965 3300047322 Bacteria 3854
224 Ga0495675_0091592 3300047444 Bacteria 1908
225 Ga0495675_0238446 3300047444 Bacteria 1095
226 Ga0495684_0009899 3300047471 Bacteria 7360
227 Ga0495684_0049214 3300047471 Bacteria 3221
228 Ga0495684_0052638 3300047471 Bacteria 3106
229 Ga0495593_0593003 3300047673 Unclassified 556
230 Ga0495602_0096280 3300048088 Unclassified 2441
231 Ga0495602_0103357 3300048088 Unclassified 2332
232 Ga0496105_0409835 3300048908 Unclassified 1075
233 Ga0496109_0170449 3300048912 Unclassified 2042
234 Ga0496112_1170591 3300048915 Unclassified 686
235 nmdc:mga03n38_589228_c1 3300050490 Bacteria 632
236 nmdc:mga00v17_182622_c1 3300050491 Bacteria 1353
237 nmdc:mga0yw44_62243_c1 3300050492 Bacteria 2291
238 nmdc:mga05p37_1183872_c1 3300050507 Bacteria 791
239 nmdc:mga09592_455691_c1 3300050508 Unclassified 1103
240 nmdc:mga09592_555504_c1 3300050508 Bacteria 986
241 nmdc:mga0qj67_384838_c1 3300050509 Bacteria 1133
242 nmdc:mga06r32_300766_c1 3300050510 Unclassified 1590
243 nmdc:mga08y16_110558_c1 3300050511 Bacteria 2862
244 nmdc:mga0n895_826003_c1 3300050512 Bacteria 916
245 Ga0495601_0364634 3300053077 Unclassified 939
246 Ga0495601_0421763 3300053077 Bacteria 864
247 Ga0495612_0166105 3300053078 Bacteria 965
248 Ga0495595_0267930 3300053084 Bacteria 856
249 Ga0495619_0154200 3300053085 Unclassified 1585
250 Ga0495619_0158386 3300053085 Bacteria 1563
251 Ga0070712_101668750
252 MRS1b_contig_8836467
253 LJNas_1000177
254 Ga0065704_10217573
255 Ga0065712_10205435
256 Ga0065715_10150687
257 Ga0065715_10261594
258 Ga0070683_100009194
259 Ga0070683_100541392
260 Ga0070670_100095797
261 Ga0068869_100609280
262 Ga0070680_101831709
263 Ga0070682_100445601
264 Ga0070660_100694300
265 Ga0070691_10123848
266 Ga0070661_101441218
267 Ga0070669_100005839
268 Ga0070669_100588389
269 Ga0070675_101024519
270 Ga0070675_101370773
271 Ga0070673_101645621
272 Ga0070688_100045418
273 Ga0070688_100737458
274 Ga0070659_100300157
275 Ga0070659_101243924
276 Ga0070714_100383917
277 Ga0070713_100533832
278 Ga0070710_10111247
279 Ga0070711_100041092
280 Ga0070662_100173312
281 Ga0070681_10508333
282 Ga0068867_100271449
283 Ga0068867_101094832
284 Ga0068867_102417643
285 Ga0070679_100889417
286 Ga0070684_100006453
287 Ga0070684_100025606
288 Ga0070672_100063648
289 Ga0070672_101797744
290 Ga0070686_100515249
291 Ga0070693_100570103
292 Ga0070665_100036188
293 Ga0068855_100034857
294 Ga0070664_100086700
295 Ga0070664_100099530
296 Ga0068857_100123163
297 Ga0068856_100004944
298 Ga0068856_100527335
299 Ga0068866_10102772
300 Ga0068866_11248043
301 Ga0068861_101083185
302 Ga0068861_101120739
303 Ga0068860_101217047
304 Ga0068860_101617663
305 Ga0081539_10133400
306 Ga0070717_10542007
307 Ga0070717_11013785
308 Ga0075363_100753409
309 Ga0075364_10556558
310 Ga0070712_100160458
311 Ga0097621_100346271
312 Ga0068871_100204554
313 Ga0075428_100521709
314 Ga0075430_100003203
315 Ga0075431_100454151
316 Ga0075434_100731098
317 Ga0068865_100058814
318 Ga0105240_10691545
319 Ga0111539_10001319
320 Ga0111539_10070057
321 Ga0111539_10880153
322 Ga0105245_10541660
323 Ga0105245_11479689
324 Ga0105247_10498831
325 Ga0114129_11227144
326 Ga0114129_12402106
327 Ga0105242_10003788
328 Ga0105242_10436981
329 Ga0105242_10461655
330 Ga0105242_12632846
331 Ga0105248_11024988
332 Ga0105248_11354624
333 Ga0105237_10163720
334 Ga0105238_10093483
335 Ga0105238_12144921
336 Ga0105249_10000493
337 Ga0105249_10067613
338 Ga0105239_12976922
339 Ga0157370_10041733
340 Ga0157369_10206072
341 Ga0157369_10376616
342 Ga0163162_11626836
343 Ga0157372_10036609
344 Ga0157375_10278274
345 Ga0163163_11401702
346 Ga0157380_11735298
347 Ga0157380_13072509
348 Ga0157376_12830207
349 Ga0213876_10678215
350 Ga0207666_1061487
351 Ga0207697_10052321
352 Ga0207692_10324786
353 Ga0207692_10370884
354 Ga0207647_10535294
355 Ga0207699_10013147
356 Ga0207699_10223438
357 Ga0207645_10253919
358 Ga0207705_11332551
359 Ga0207684_10840130
360 Ga0207684_11203583
361 Ga0207707_10499114
362 Ga0207695_10048249
363 Ga0207671_10163195
364 Ga0207671_11291480
365 Ga0207693_10153842
366 Ga0207660_11211955
367 Ga0207652_10461290
368 Ga0207681_10104700
369 Ga0207681_11481124
370 Ga0207694_10058653
371 Ga0207659_11106315
372 Ga0207700_10465250
373 Ga0207700_10973153
374 Ga0207664_10553306
375 Ga0207706_10539293
376 Ga0207706_11140703
377 Ga0207704_10011349
378 Ga0207665_10463140
379 Ga0207665_10746868
380 Ga0207691_10210739
381 Ga0207711_11046676
382 Ga0207711_11878058
383 Ga0207661_10478483
384 Ga0207661_10601955
385 Ga0207679_10065581
386 Ga0207679_10794799
387 Ga0207651_11327062
388 Ga0207712_10018852
389 Ga0207640_11825189
390 Ga0207702_10074405
391 Ga0207702_10277276
392 Ga0207648_10438827
393 Ga0207674_10041043
394 Ga0207428_10145275
395 Ga0268266_10226265
396 Ga0268264_12507494
397 Ga0265327_10052301
398 Ga0265314_10031245
399 Ga0307411_10859832
400 Ga0373934_0023414
401 Ga0373944_0134595
402 Ga0373923_0038306
403 Ga0373956_0288054
404 Ga0373957_0124634
405 Ga0373955_0658133
406 Ga0373927_0536927
407 Ga0373933_0016954
408 Ga0373947_0119780
409 Ga0373947_0290251
410 Ga0373937_0019368
411 Ga0373937_0521914
412 Ga0373925_0067632
413 Ga0373925_0591517
414 Ga0373925_1284115
415 Ga0395905_0088902
416 Ga0395905_1056252
417 Ga0395905_1067665
418 Ga0395905_1321044
419 Ga0436365_1279258
420 Ga0451793_0815871
421 Ga0451843_1001000
422 Ga0439459_0116313
423 Ga0466957_0491839
424 Ga0495592_0119394
425 Ga0495592_0761601
426 Ga0495603_0079823
427 Ga0495651_0013601
428 Ga0495653_0042086
429 Ga0495580_0017112
430 Ga0495580_0199736
431 Ga0495582_0111576
432 Ga0495639_0054879
433 Ga0495639_0234129
434 Ga0495664_0028771
435 Ga0495664_0102262
436 Ga0495594_0014488
437 Ga0495594_0128504
438 Ga0495594_0635403
439 Ga0495608_0042316
440 Ga0495608_0057658
441 Ga0495608_0410167
442 Ga0495618_0022129
443 Ga0495628_0013499
444 Ga0495628_0165984
445 Ga0495630_0020760
446 Ga0495666_0009006
447 Ga0495652_0079016
448 Ga0495665_0319844
449 Ga0495640_0028123
450 Ga0495640_0349978
451 Ga0495587_0056131
452 Ga0495645_0005533
453 Ga0495667_0000838
454 Ga0495656_0445337
455 Ga0495634_0042417
456 Ga0495611_0275143
457 Ga0495635_0186413
458 Ga0495657_0028228
459 Ga0495599_0027831
460 Ga0495599_0688585
461 Ga0495623_0072743
462 Ga0495646_0239161
463 Ga0495658_0208783
464 Ga0495613_0224551
465 Ga0495624_0470623
466 Ga0495600_0225203
467 Ga0495581_0181534
468 Ga0495604_0024312
469 Ga0495674_0035871
470 Ga0495674_0087213
471 Ga0495674_0151965
472 Ga0495676_0210748
473 Ga0495680_0037965
474 Ga0495675_0091592
475 Ga0495675_0238446
476 Ga0495684_0009899
477 Ga0495684_0049214
478 Ga0495684_0052638
479 Ga0495593_0593003
480 Ga0495602_0096280
481 Ga0495602_0103357
482 Ga0496105_0409835
483 Ga0496109_0170449
484 Ga0496112_1170591
485 nmdc:mga03n38_589228_c1
486 nmdc:mga00v17_182622_c1
487 nmdc:mga0yw44_62243_c1
488 nmdc:mga05p37_1183872_c1
489 nmdc:mga09592_455691_c1
490 nmdc:mga09592_555504_c1
491 nmdc:mga0qj67_384838_c1
492 nmdc:mga06r32_300766_c1
493 nmdc:mga08y16_110558_c1
494 nmdc:mga0n895_826003_c1
495 Ga0495601_0364634
496 Ga0495601_0421763
497 Ga0495612_0166105
498 Ga0495595_0267930
499 Ga0495619_0154200
500 Ga0495619_0158386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

31

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9276 10 106
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9202 4 108
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9178 10 108
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9102 8 105
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8988 8 105
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 11 111 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9264 13 108 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9023 17 82 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8988 8 105 1.10.10.10
4esbA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8882 10 110 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N9MU15-F1-model_v4 Transcriptional regulator, PadR family 0.9907 16 110
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.99 11 88
AF-A0A1F2TUG0-F1-model_v4 PadR family transcriptional regulator 0.987 10 107
AF-A0A4V2G1F2-F1-model_v4 PadR family transcriptional regulator 0.9862 10 107
AF-A0A2V8YVR9-F1-model_v4 PadR family transcriptional regulator 0.9859 10 107

Map