F361459
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 129 | 250 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10021772|Ga0070717_100217725 |
| Length | 315 |
| Sequence | VLSRRLKRCSRSAIRRKIDERGDQGSGIRDQDVPWVHLGGSLIAFTKAHACGNDFLIVVEEAAAGRDWAELTRRLCARNSGIGADGIEFFAWTGPKSARIRLHNADGSIAEISGNGTRCVAAWMAEAIGATAGDALEIETDAGMRVCHIDAVRASGEFVIDVTAGMGVPQFAKRTVTIPGGVQMQGVEISTGNPHFVIVVDNAEFTVDGQRWESIGQQICGHPDFPWQTNVEFVRIVKSGEIEIRIFERGVGPTNSSGTGTSACATAALAFNGCVSPLRVVAPGGAQTVAWDGPGTELKLTGPAALIARGEAWDG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 61 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 104 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 114 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 115 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 125 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 126 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 127 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 128 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.4 |
| Rhizosphere | 96.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10174645 | 3300003320 | Bacteria | 3929 |
| 2 | Ga0070658_10084760 | 3300005327 | Unclassified | 2605 |
| 3 | Ga0070658_10564533 | 3300005327 | Bacteria | 985 |
| 4 | Ga0070676_10032956 | 3300005328 | Bacteria | 2970 |
| 5 | Ga0070683_100026457 | 3300005329 | Bacteria | 5225 |
| 6 | Ga0070683_100242422 | 3300005329 | Bacteria | 1715 |
| 7 | Ga0070683_100326431 | 3300005329 | Bacteria | 1461 |
| 8 | Ga0070670_100008990 | 3300005331 | Bacteria | 8533 |
| 9 | Ga0070670_100030783 | 3300005331 | Bacteria | 4622 |
| 10 | Ga0068869_100012689 | 3300005334 | Bacteria | 5573 |
| 11 | Ga0070666_10039680 | 3300005335 | Bacteria | 3139 |
| 12 | Ga0068868_100117438 | 3300005338 | Bacteria | 2167 |
| 13 | Ga0070661_100001401 | 3300005344 | Bacteria | 16842 |
| 14 | Ga0070669_100050733 | 3300005353 | Bacteria | 3031 |
| 15 | Ga0070675_100070861 | 3300005354 | Bacteria | 2890 |
| 16 | Ga0070671_100042699 | 3300005355 | Bacteria | 3769 |
| 17 | Ga0070671_100047032 | 3300005355 | Bacteria | 3589 |
| 18 | Ga0070667_100058772 | 3300005367 | Unclassified | 3251 |
| 19 | Ga0070709_10182082 | 3300005434 | Unclassified | 1476 |
| 20 | Ga0070714_100156819 | 3300005435 | Bacteria | 2056 |
| 21 | Ga0070663_100060727 | 3300005455 | Unclassified | 2720 |
| 22 | Ga0070663_100205841 | 3300005455 | Bacteria | 1538 |
| 23 | Ga0070678_100015046 | 3300005456 | Bacteria | 4902 |
| 24 | Ga0070662_100274735 | 3300005457 | Bacteria | 1362 |
| 25 | Ga0070681_10379791 | 3300005458 | Unclassified | 1324 |
| 26 | Ga0070684_100012893 | 3300005535 | Bacteria | 6720 |
| 27 | Ga0070684_100189339 | 3300005535 | Bacteria | 1872 |
| 28 | Ga0070684_100200272 | 3300005535 | Bacteria | 1818 |
| 29 | Ga0068853_100000207 | 3300005539 | Bacteria | 41660 |
| 30 | Ga0068853_100169558 | 3300005539 | Bacteria | 1974 |
| 31 | Ga0068853_100328691 | 3300005539 | Bacteria | 1418 |
| 32 | Ga0070665_100014542 | 3300005548 | Bacteria | 7896 |
| 33 | Ga0070665_100129490 | 3300005548 | Bacteria | 2525 |
| 34 | Ga0070665_100263261 | 3300005548 | Bacteria | 1725 |
| 35 | Ga0068855_100000390 | 3300005563 | Bacteria | 54007 |
| 36 | Ga0068855_100016729 | 3300005563 | Bacteria | 8821 |
| 37 | Ga0068855_100049614 | 3300005563 | Bacteria | 4950 |
| 38 | Ga0070664_100218279 | 3300005564 | Bacteria | 1706 |
| 39 | Ga0068857_100055913 | 3300005577 | Bacteria | 3501 |
| 40 | Ga0068857_100164810 | 3300005577 | Unclassified | 2012 |
| 41 | Ga0068854_100003431 | 3300005578 | Bacteria | 9880 |
| 42 | Ga0068854_100054517 | 3300005578 | Bacteria | 2876 |
| 43 | Ga0068854_100099847 | 3300005578 | Bacteria | 2174 |
| 44 | Ga0068856_100003145 | 3300005614 | Bacteria | 16830 |
| 45 | Ga0068856_100012039 | 3300005614 | Bacteria | 8380 |
| 46 | Ga0068856_100069429 | 3300005614 | Bacteria | 3484 |
| 47 | Ga0068856_100073896 | 3300005614 | Bacteria | 3375 |
| 48 | Ga0068856_100450385 | 3300005614 | Unclassified | 1308 |
| 49 | Ga0068852_100000014 | 3300005616 | Bacteria | 139457 |
| 50 | Ga0068852_100000018 | 3300005616 | Bacteria | 129976 |
| 51 | Ga0068852_100091903 | 3300005616 | Bacteria | 2717 |
| 52 | Ga0068852_100255635 | 3300005616 | Unclassified | 1680 |
| 53 | Ga0068864_100010101 | 3300005618 | Bacteria | 7794 |
| 54 | Ga0068851_10021398 | 3300005834 | Bacteria | 3140 |
| 55 | Ga0068851_10089442 | 3300005834 | Bacteria | 1619 |
| 56 | Ga0068863_100021156 | 3300005841 | Bacteria | 6212 |
| 57 | Ga0068863_100122651 | 3300005841 | Bacteria | 2479 |
| 58 | Ga0068858_100047044 | 3300005842 | Bacteria | 4000 |
| 59 | Ga0068860_100024780 | 3300005843 | Bacteria | 5795 |
| 60 | Ga0068860_100210775 | 3300005843 | Bacteria | 1885 |
| 61 | Ga0081540_1044643 | 3300005983 | Bacteria | 2260 |
| 62 | Ga0070717_10021772 | 3300006028 | Bacteria | 5057 |
| 63 | Ga0097621_100031388 | 3300006237 | Bacteria | 4216 |
| 64 | Ga0068871_100014459 | 3300006358 | Bacteria | 5887 |
| 65 | Ga0068871_100022004 | 3300006358 | Bacteria | 4911 |
| 66 | Ga0068871_100058542 | 3300006358 | Bacteria | 3137 |
| 67 | Ga0068865_100040623 | 3300006881 | Bacteria | 3163 |
| 68 | Ga0105240_10000144 | 3300009093 | Bacteria | 145748 |
| 69 | Ga0105240_10000177 | 3300009093 | Bacteria | 129109 |
| 70 | Ga0105240_10018454 | 3300009093 | Bacteria | 9366 |
| 71 | Ga0105240_10041415 | 3300009093 | Bacteria | 5878 |
| 72 | Ga0105240_10105551 | 3300009093 | Bacteria | 3420 |
| 73 | Ga0105245_10006979 | 3300009098 | Bacteria | 9903 |
| 74 | Ga0105247_10016249 | 3300009101 | Bacteria | 4458 |
| 75 | Ga0105243_10084235 | 3300009148 | Unclassified | 2603 |
| 76 | Ga0105241_10000044 | 3300009174 | Bacteria | 103625 |
| 77 | Ga0105241_10017339 | 3300009174 | Bacteria | 5290 |
| 78 | Ga0105241_10018564 | 3300009174 | Bacteria | 5117 |
| 79 | Ga0105241_10086991 | 3300009174 | Bacteria | 2459 |
| 80 | Ga0105248_10000027 | 3300009177 | Bacteria | 255822 |
| 81 | Ga0105248_10002615 | 3300009177 | Bacteria | 20040 |
| 82 | Ga0105248_10015194 | 3300009177 | Bacteria | 8484 |
| 83 | Ga0105248_10095938 | 3300009177 | Bacteria | 3339 |
| 84 | Ga0105237_10001603 | 3300009545 | Bacteria | 29367 |
| 85 | Ga0105237_10012717 | 3300009545 | Bacteria | 8855 |
| 86 | Ga0105237_10024414 | 3300009545 | Bacteria | 6185 |
| 87 | Ga0105237_10678136 | 3300009545 | Bacteria | 1037 |
| 88 | Ga0105238_10000056 | 3300009551 | Bacteria | 139227 |
| 89 | Ga0105238_10001314 | 3300009551 | Bacteria | 24934 |
| 90 | Ga0105238_10065396 | 3300009551 | Bacteria | 3637 |
| 91 | Ga0105238_10090784 | 3300009551 | Bacteria | 3042 |
| 92 | Ga0105249_10279918 | 3300009553 | Unclassified | 1665 |
| 93 | Ga0105239_10000957 | 3300010375 | Bacteria | 40687 |
| 94 | Ga0105239_10001272 | 3300010375 | Bacteria | 34028 |
| 95 | Ga0105239_10121975 | 3300010375 | Bacteria | 2895 |
| 96 | Ga0105239_10173628 | 3300010375 | Unclassified | 2411 |
| 97 | Ga0105246_10018517 | 3300011119 | Bacteria | 4441 |
| 98 | Ga0105246_10027234 | 3300011119 | Bacteria | 3743 |
| 99 | Ga0157370_10000007 | 3300013104 | Bacteria | 246747 |
| 100 | Ga0157369_10000052 | 3300013105 | Bacteria | 164801 |
| 101 | Ga0157369_10000292 | 3300013105 | Bacteria | 66845 |
| 102 | Ga0157369_10016074 | 3300013105 | Bacteria | 8420 |
| 103 | Ga0157369_10241721 | 3300013105 | Bacteria | 1886 |
| 104 | Ga0157374_10001090 | 3300013296 | Bacteria | 23365 |
| 105 | Ga0157374_10018321 | 3300013296 | Bacteria | 6177 |
| 106 | Ga0157374_10224750 | 3300013296 | Unclassified | 1843 |
| 107 | Ga0157374_10349256 | 3300013296 | Bacteria | 1470 |
| 108 | Ga0157378_10013480 | 3300013297 | Bacteria | 7149 |
| 109 | Ga0157378_10016735 | 3300013297 | Bacteria | 6424 |
| 110 | Ga0163162_10906986 | 3300013306 | Bacteria | 994 |
| 111 | Ga0157372_10000014 | 3300013307 | Bacteria | 241589 |
| 112 | Ga0157372_10035761 | 3300013307 | Bacteria | 5469 |
| 113 | Ga0157372_10104589 | 3300013307 | Unclassified | 3237 |
| 114 | Ga0157375_10013817 | 3300013308 | Bacteria | 7196 |
| 115 | Ga0163163_10017288 | 3300014325 | Bacteria | 6723 |
| 116 | Ga0163163_10117228 | 3300014325 | Bacteria | 2694 |
| 117 | Ga0157379_10014667 | 3300014968 | Bacteria | 6873 |
| 118 | Ga0157379_10209684 | 3300014968 | Bacteria | 1763 |
| 119 | Ga0157376_10009858 | 3300014969 | Bacteria | 6963 |
| 120 | Ga0157376_10042999 | 3300014969 | Bacteria | 3706 |
| 121 | Ga0157376_10053513 | 3300014969 | Unclassified | 3361 |
| 122 | Ga0157376_10241590 | 3300014969 | Unclassified | 1683 |
| 123 | Ga0157376_10843462 | 3300014969 | Bacteria | 931 |
| 124 | Ga0213872_10017681 | 3300021361 | Bacteria | 3292 |
| 125 | Ga0213872_10066210 | 3300021361 | Bacteria | 1631 |
| 126 | Ga0213872_10076291 | 3300021361 | Bacteria | 1508 |
| 127 | Ga0213872_10100290 | 3300021361 | Unclassified | 1291 |
| 128 | Ga0207697_10028039 | 3300025315 | Bacteria | 2302 |
| 129 | Ga0207656_10029420 | 3300025321 | Bacteria | 2262 |
| 130 | Ga0207656_10032310 | 3300025321 | Bacteria | 2174 |
| 131 | Ga0207710_10010535 | 3300025900 | Bacteria | 3895 |
| 132 | Ga0207680_10063730 | 3300025903 | Unclassified | 2257 |
| 133 | Ga0207645_10008445 | 3300025907 | Bacteria | 7184 |
| 134 | Ga0207654_10000042 | 3300025911 | Bacteria | 102291 |
| 135 | Ga0207654_10000098 | 3300025911 | Bacteria | 57757 |
| 136 | Ga0207654_10028531 | 3300025911 | Bacteria | 3043 |
| 137 | Ga0207654_10041093 | 3300025911 | Unclassified | 2609 |
| 138 | Ga0207707_10117236 | 3300025912 | Unclassified | 2327 |
| 139 | Ga0207695_10000069 | 3300025913 | Bacteria | 319955 |
| 140 | Ga0207695_10000086 | 3300025913 | Bacteria | 278055 |
| 141 | Ga0207695_10000650 | 3300025913 | Bacteria | 68992 |
| 142 | Ga0207695_10025109 | 3300025913 | Bacteria | 6683 |
| 143 | Ga0207695_10094183 | 3300025913 | Bacteria | 3003 |
| 144 | Ga0207671_10000085 | 3300025914 | Bacteria | 142417 |
| 145 | Ga0207671_10025345 | 3300025914 | Bacteria | 4455 |
| 146 | Ga0207671_10227553 | 3300025914 | Unclassified | 1462 |
| 147 | Ga0207671_10273725 | 3300025914 | Bacteria | 1331 |
| 148 | Ga0207649_10001059 | 3300025920 | Bacteria | 16861 |
| 149 | Ga0207694_10000058 | 3300025924 | Bacteria | 144429 |
| 150 | Ga0207694_10002752 | 3300025924 | Bacteria | 14204 |
| 151 | Ga0207694_10145368 | 3300025924 | Bacteria | 1908 |
| 152 | Ga0207650_10041687 | 3300025925 | Unclassified | 3365 |
| 153 | Ga0207687_10033997 | 3300025927 | Bacteria | 3460 |
| 154 | Ga0207700_10016890 | 3300025928 | Bacteria | 4861 |
| 155 | Ga0207664_10080286 | 3300025929 | Bacteria | 2651 |
| 156 | Ga0207644_10044995 | 3300025931 | Unclassified | 3139 |
| 157 | Ga0207706_10063605 | 3300025933 | Bacteria | 3248 |
| 158 | Ga0207704_10062934 | 3300025938 | Bacteria | 2310 |
| 159 | Ga0207691_10013598 | 3300025940 | Bacteria | 7782 |
| 160 | Ga0207711_10000136 | 3300025941 | Bacteria | 77691 |
| 161 | Ga0207711_10002824 | 3300025941 | Bacteria | 15254 |
| 162 | Ga0207711_10008083 | 3300025941 | Bacteria | 8805 |
| 163 | Ga0207711_10073026 | 3300025941 | Bacteria | 2981 |
| 164 | Ga0207711_10258990 | 3300025941 | Bacteria | 1598 |
| 165 | Ga0207689_10084247 | 3300025942 | Bacteria | 2613 |
| 166 | Ga0207661_10032578 | 3300025944 | Bacteria | 4038 |
| 167 | Ga0207667_10000976 | 3300025949 | Bacteria | 36493 |
| 168 | Ga0207667_10009737 | 3300025949 | Bacteria | 11301 |
| 169 | Ga0207640_10002973 | 3300025981 | Bacteria | 9129 |
| 170 | Ga0207658_10124407 | 3300025986 | Bacteria | 2061 |
| 171 | Ga0207677_10064086 | 3300026023 | Unclassified | 2557 |
| 172 | Ga0207677_10249571 | 3300026023 | Bacteria | 1440 |
| 173 | Ga0207703_10045700 | 3300026035 | Bacteria | 3523 |
| 174 | Ga0207703_10107096 | 3300026035 | Unclassified | 2379 |
| 175 | Ga0207639_10000030 | 3300026041 | Bacteria | 172820 |
| 176 | Ga0207639_10324269 | 3300026041 | Bacteria | 1368 |
| 177 | Ga0207678_10104085 | 3300026067 | Unclassified | 2422 |
| 178 | Ga0207702_10002044 | 3300026078 | Bacteria | 19541 |
| 179 | Ga0207641_10008542 | 3300026088 | Bacteria | 8458 |
| 180 | Ga0207641_10060314 | 3300026088 | Bacteria | 3234 |
| 181 | Ga0207676_10097112 | 3300026095 | Unclassified | 2433 |
| 182 | Ga0207674_10021995 | 3300026116 | Bacteria | 6859 |
| 183 | Ga0207674_10030921 | 3300026116 | Bacteria | 5627 |
| 184 | Ga0207674_10165767 | 3300026116 | Bacteria | 2164 |
| 185 | Ga0207683_10002458 | 3300026121 | Bacteria | 16152 |
| 186 | Ga0207698_10000006 | 3300026142 | Bacteria | 291847 |
| 187 | Ga0207698_10000030 | 3300026142 | Bacteria | 114965 |
| 188 | Ga0207698_10060428 | 3300026142 | Bacteria | 2947 |
| 189 | Ga0207698_10244170 | 3300026142 | Unclassified | 1639 |
| 190 | Ga0207698_10707308 | 3300026142 | Bacteria | 1003 |
| 191 | Ga0268266_10066965 | 3300028379 | Unclassified | 3107 |
| 192 | Ga0268264_10006968 | 3300028381 | Bacteria | 9488 |
| 193 | Ga0268264_10101667 | 3300028381 | Bacteria | 2499 |
| 194 | Ga0265336_10001392 | 3300028666 | Bacteria | 11158 |
| 195 | Ga0265338_10009968 | 3300028800 | Bacteria | 11232 |
| 196 | Ga0265338_10074819 | 3300028800 | Bacteria | 2878 |
| 197 | Ga0265338_10109787 | 3300028800 | Unclassified | 2225 |
| 198 | Ga0265324_10008415 | 3300029957 | Bacteria | 4100 |
| 199 | Ga0265760_10036157 | 3300031090 | Bacteria | 1464 |
| 200 | Ga0265328_10009693 | 3300031239 | Unclassified | 3912 |
| 201 | Ga0265340_10032290 | 3300031247 | Unclassified | 2614 |
| 202 | Ga0265339_10000065 | 3300031249 | Bacteria | 92603 |
| 203 | Ga0265339_10000115 | 3300031249 | Bacteria | 65607 |
| 204 | Ga0265339_10024938 | 3300031249 | Bacteria | 3440 |
| 205 | Ga0265316_10000778 | 3300031344 | Bacteria | 35219 |
| 206 | Ga0265316_10009406 | 3300031344 | Bacteria | 9002 |
| 207 | Ga0265316_10027074 | 3300031344 | Bacteria | 4756 |
| 208 | Ga0265316_10052307 | 3300031344 | Unclassified | 3205 |
| 209 | Ga0265316_10108268 | 3300031344 | Bacteria | 2107 |
| 210 | Ga0265313_10007630 | 3300031595 | Bacteria | 7337 |
| 211 | Ga0265313_10073535 | 3300031595 | Unclassified | 1569 |
| 212 | Ga0265314_10007056 | 3300031711 | Bacteria | 9805 |
| 213 | Ga0265314_10100389 | 3300031711 | Unclassified | 1861 |
| 214 | Ga0265314_10167785 | 3300031711 | Bacteria | 1328 |
| 215 | Ga0265314_10288694 | 3300031711 | Unclassified | 925 |
| 216 | Ga0265342_10001563 | 3300031712 | Bacteria | 21180 |
| 217 | Ga0265342_10011399 | 3300031712 | Bacteria | 6089 |
| 218 | Ga0265342_10082143 | 3300031712 | Bacteria | 1859 |
| 219 | Ga0265342_10175208 | 3300031712 | Unclassified | 1177 |
| 220 | Ga0373953_0169013 | 3300035117 | Unclassified | 941 |
| 221 | Ga0373937_0005298 | 3300036401 | Bacteria | 11021 |
| 222 | Ga0373937_0334448 | 3300036401 | Bacteria | 1434 |
| 223 | Ga0395900_0063675 | 3300037418 | Bacteria | 3791 |
| 224 | Ga0395900_0581653 | 3300037418 | Bacteria | 1062 |
| 225 | Ga0395898_0774373 | 3300037466 | Bacteria | 900 |
| 226 | Ga0436360_0061963 | 3300039438 | Unclassified | 2220 |
| 227 | Ga0436361_0397526 | 3300039447 | Bacteria | 13611 |
| 228 | Ga0436361_0512509 | 3300039447 | Bacteria | 2361 |
| 229 | Ga0436361_0684537 | 3300039447 | Bacteria | 3787 |
| 230 | Ga0436361_0982185 | 3300039447 | Unclassified | 1699 |
| 231 | Ga0436361_1039308 | 3300039447 | Bacteria | 1201 |
| 232 | Ga0466969_0034879 | 3300044656 | Bacteria | 2548 |
| 233 | Ga0495592_0085518 | 3300046454 | Bacteria | 2273 |
| 234 | Ga0495629_0033567 | 3300046459 | Bacteria | 3629 |
| 235 | Ga0495587_0019857 | 3300046536 | Bacteria | 4153 |
| 236 | Ga0495645_0001853 | 3300046543 | Bacteria | 14357 |
| 237 | Ga0495634_0240396 | 3300046642 | Bacteria | 1111 |
| 238 | Ga0495613_0248476 | 3300046689 | Bacteria | 1242 |
| 239 | Ga0495684_0272526 | 3300047471 | Bacteria | 1224 |
| 240 | Ga0495602_0018104 | 3300048088 | Bacteria | 7048 |
| 241 | Ga0496104_0154851 | 3300048907 | Unclassified | 2200 |
| 242 | Ga0496104_0192324 | 3300048907 | Bacteria | 1952 |
| 243 | Ga0496105_0434934 | 3300048908 | Bacteria | 1037 |
| 244 | Ga0496115_0036443 | 3300048918 | Bacteria | 3895 |
| 245 | Ga0496115_0075506 | 3300048918 | Bacteria | 2738 |
| 246 | Ga0496115_0264823 | 3300048918 | Bacteria | 1413 |
| 247 | Ga0496126_0144815 | 3300048929 | Unclassified | 2042 |
| 248 | Ga0496126_0314881 | 3300048929 | Unclassified | 1288 |
| 249 | Ga0495601_0013776 | 3300053077 | Bacteria | 4866 |
| 250 | Ga0495595_0092546 | 3300053084 | Bacteria | 1452 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0774373 | Ga0395898_0774373_189_878 | 217 |
| 2 | 3300039447 | Ga0436361_1039308 | Ga0436361_1039308_191_985 | 235 |
| 3 | 3300039438 | Ga0436360_0061963 | Ga0436360_0061963_298_1092 | 236 |
| 4 | 3300046454 | Ga0495592_0085518 | Ga0495592_0085518_1431_2228 | 239 |
| 5 | 3300005353 | Ga0070669_100050733 | Ga0070669_1000507332 | 240 |
| 6 | 3300005983 | Ga0081540_1044643 | Ga0081540_10446433 | 240 |
| 7 | 3300021361 | Ga0213872_10066210 | Ga0213872_100662101 | 241 |
| 8 | 3300021361 | Ga0213872_10076291 | Ga0213872_100762912 | 243 |
| 9 | 3300039447 | Ga0436361_0684537 | Ga0436361_0684537_1722_2534 | 243 |
| 10 | 3300005563 | Ga0068855_100049614 | Ga0068855_1000496144 | 246 |
| 11 | 3300013105 | Ga0157369_10016074 | Ga0157369_100160743 | 246 |
| 12 | 3300021361 | Ga0213872_10017681 | Ga0213872_100176812 | 246 |
| 13 | 3300021361 | Ga0213872_10100290 | Ga0213872_101002902 | 246 |
| 14 | 3300025912 | Ga0207707_10117236 | Ga0207707_101172362 | 246 |
| 15 | 3300037418 | Ga0395900_0063675 | Ga0395900_0063675_2824_3618 | 246 |
| 16 | 3300037418 | Ga0395900_0581653 | Ga0395900_0581653_55_849 | 246 |
| 17 | 3300039447 | Ga0436361_0397526 | Ga0436361_0397526_11979_12773 | 246 |
| 18 | 3300039447 | Ga0436361_0512509 | Ga0436361_0512509_585_1391 | 246 |
| 19 | 3300039447 | Ga0436361_0982185 | Ga0436361_0982185_618_1412 | 246 |
| 20 | 3300005355 | Ga0070671_100042699 | Ga0070671_1000426992 | 247 |
| 21 | 3300005455 | Ga0070663_100060727 | Ga0070663_1000607273 | 247 |
| 22 | 3300005548 | Ga0070665_100014542 | Ga0070665_1000145426 | 247 |
| 23 | 3300005616 | Ga0068852_100255635 | Ga0068852_1002556352 | 247 |
| 24 | 3300006358 | Ga0068871_100014459 | Ga0068871_1000144596 | 247 |
| 25 | 3300009093 | Ga0105240_10000177 | Ga0105240_1000017784 | 247 |
| 26 | 3300009174 | Ga0105241_10017339 | Ga0105241_100173393 | 247 |
| 27 | 3300009177 | Ga0105248_10002615 | Ga0105248_1000261512 | 247 |
| 28 | 3300009551 | Ga0105238_10001314 | Ga0105238_1000131410 | 247 |
| 29 | 3300010375 | Ga0105239_10000957 | Ga0105239_1000095727 | 247 |
| 30 | 3300013296 | Ga0157374_10001090 | Ga0157374_1000109012 | 247 |
| 31 | 3300014969 | Ga0157376_10053513 | Ga0157376_100535133 | 247 |
| 32 | 3300025911 | Ga0207654_10028531 | Ga0207654_100285312 | 247 |
| 33 | 3300025913 | Ga0207695_10000086 | Ga0207695_10000086177 | 247 |
| 34 | 3300025914 | Ga0207671_10227553 | Ga0207671_102275532 | 247 |
| 35 | 3300025924 | Ga0207694_10002752 | Ga0207694_1000275212 | 247 |
| 36 | 3300025931 | Ga0207644_10044995 | Ga0207644_100449953 | 247 |
| 37 | 3300025941 | Ga0207711_10002824 | Ga0207711_1000282410 | 247 |
| 38 | 3300026067 | Ga0207678_10104085 | Ga0207678_101040851 | 247 |
| 39 | 3300026142 | Ga0207698_10244170 | Ga0207698_102441702 | 247 |
| 40 | 3300028379 | Ga0268266_10066965 | Ga0268266_100669652 | 247 |
| 41 | 3300005434 | Ga0070709_10182082 | Ga0070709_101820821 | 248 |
| 42 | 3300005435 | Ga0070714_100156819 | Ga0070714_1001568192 | 248 |
| 43 | 3300013105 | Ga0157369_10241721 | Ga0157369_102417212 | 248 |
| 44 | 3300014969 | Ga0157376_10042999 | Ga0157376_100429994 | 248 |
| 45 | 3300025929 | Ga0207664_10080286 | Ga0207664_100802863 | 248 |
| 46 | 3300031247 | Ga0265340_10032290 | Ga0265340_100322903 | 248 |
| 47 | 3300031249 | Ga0265339_10024938 | Ga0265339_100249382 | 248 |
| 48 | 3300031344 | Ga0265316_10000778 | Ga0265316_100007784 | 248 |
| 49 | 3300031344 | Ga0265316_10027074 | Ga0265316_100270744 | 248 |
| 50 | 3300031712 | Ga0265342_10175208 | Ga0265342_101752081 | 248 |
| 51 | 3300005344 | Ga0070661_100001401 | Ga0070661_1000014019 | 249 |
| 52 | 3300005455 | Ga0070663_100205841 | Ga0070663_1002058412 | 249 |
| 53 | 3300005539 | Ga0068853_100000207 | Ga0068853_10000020713 | 249 |
| 54 | 3300005577 | Ga0068857_100055913 | Ga0068857_1000559132 | 249 |
| 55 | 3300005578 | Ga0068854_100003431 | Ga0068854_1000034314 | 249 |
| 56 | 3300005614 | Ga0068856_100003145 | Ga0068856_1000031457 | 249 |
| 57 | 3300005616 | Ga0068852_100000014 | Ga0068852_10000001475 | 249 |
| 58 | 3300005834 | Ga0068851_10089442 | Ga0068851_100894422 | 249 |
| 59 | 3300009093 | Ga0105240_10018454 | Ga0105240_100184549 | 249 |
| 60 | 3300009093 | Ga0105240_10105551 | Ga0105240_101055512 | 249 |
| 61 | 3300009174 | Ga0105241_10000044 | Ga0105241_1000004476 | 249 |
| 62 | 3300009545 | Ga0105237_10001603 | Ga0105237_100016033 | 249 |
| 63 | 3300009551 | Ga0105238_10000056 | Ga0105238_1000005673 | 249 |
| 64 | 3300010375 | Ga0105239_10001272 | Ga0105239_1000127213 | 249 |
| 65 | 3300013105 | Ga0157369_10000292 | Ga0157369_1000029225 | 249 |
| 66 | 3300013297 | Ga0157378_10016735 | Ga0157378_100167356 | 249 |
| 67 | 3300013307 | Ga0157372_10035761 | Ga0157372_100357613 | 249 |
| 68 | 3300025911 | Ga0207654_10000098 | Ga0207654_1000009821 | 249 |
| 69 | 3300025913 | Ga0207695_10000650 | Ga0207695_1000065027 | 249 |
| 70 | 3300025914 | Ga0207671_10000085 | Ga0207671_1000008527 | 249 |
| 71 | 3300025920 | Ga0207649_10001059 | Ga0207649_100010599 | 249 |
| 72 | 3300025924 | Ga0207694_10000058 | Ga0207694_1000005876 | 249 |
| 73 | 3300025949 | Ga0207667_10009737 | Ga0207667_1000973711 | 249 |
| 74 | 3300025981 | Ga0207640_10002973 | Ga0207640_100029733 | 249 |
| 75 | 3300026041 | Ga0207639_10000030 | Ga0207639_1000003087 | 249 |
| 76 | 3300026078 | Ga0207702_10002044 | Ga0207702_1000204414 | 249 |
| 77 | 3300026116 | Ga0207674_10021995 | Ga0207674_100219953 | 249 |
| 78 | 3300026142 | Ga0207698_10000030 | Ga0207698_1000003013 | 249 |
| 79 | 3300026142 | Ga0207698_10707308 | Ga0207698_107073082 | 249 |
| 80 | 3300035117 | Ga0373953_0169013 | Ga0373953_0169013_95_919 | 249 |
| 81 | 3300036401 | Ga0373937_0005298 | Ga0373937_0005298_8756_9580 | 249 |
| 82 | 3300005329 | Ga0070683_100242422 | Ga0070683_1002424222 | 250 |
| 83 | 3300005535 | Ga0070684_100200272 | Ga0070684_1002002722 | 250 |
| 84 | 3300005539 | Ga0068853_100328691 | Ga0068853_1003286912 | 250 |
| 85 | 3300005563 | Ga0068855_100016729 | Ga0068855_1000167298 | 250 |
| 86 | 3300005614 | Ga0068856_100073896 | Ga0068856_1000738964 | 250 |
| 87 | 3300009148 | Ga0105243_10084235 | Ga0105243_100842352 | 250 |
| 88 | 3300009174 | Ga0105241_10086991 | Ga0105241_100869912 | 250 |
| 89 | 3300009545 | Ga0105237_10678136 | Ga0105237_106781362 | 250 |
| 90 | 3300009551 | Ga0105238_10090784 | Ga0105238_100907842 | 250 |
| 91 | 3300013296 | Ga0157374_10349256 | Ga0157374_103492562 | 250 |
| 92 | 3300014968 | Ga0157379_10209684 | Ga0157379_102096842 | 250 |
| 93 | 3300025321 | Ga0207656_10029420 | Ga0207656_100294201 | 250 |
| 94 | 3300025911 | Ga0207654_10000042 | Ga0207654_1000004245 | 250 |
| 95 | 3300025924 | Ga0207694_10145368 | Ga0207694_101453682 | 250 |
| 96 | 3300028800 | Ga0265338_10109787 | Ga0265338_101097872 | 250 |
| 97 | 3300031239 | Ga0265328_10009693 | Ga0265328_100096933 | 250 |
| 98 | 3300031249 | Ga0265339_10000065 | Ga0265339_1000006538 | 250 |
| 99 | 3300031344 | Ga0265316_10052307 | Ga0265316_100523073 | 250 |
| 100 | 3300031711 | Ga0265314_10100389 | Ga0265314_101003893 | 250 |
| 101 | 3300031712 | Ga0265342_10001563 | Ga0265342_100015633 | 250 |
| 102 | 3300044656 | Ga0466969_0034879 | Ga0466969_0034879_488_1324 | 250 |
| 103 | 3300048929 | Ga0496126_0144815 | Ga0496126_0144815_655_1470 | 250 |
| 104 | 3300048929 | Ga0496126_0314881 | Ga0496126_0314881_47_856 | 250 |
| 105 | 3300005539 | Ga0068853_100169558 | Ga0068853_1001695582 | 251 |
| 106 | 3300005548 | Ga0070665_100129490 | Ga0070665_1001294902 | 251 |
| 107 | 3300005563 | Ga0068855_100000390 | Ga0068855_10000039023 | 251 |
| 108 | 3300005616 | Ga0068852_100000018 | Ga0068852_10000001819 | 251 |
| 109 | 3300009093 | Ga0105240_10000144 | Ga0105240_1000014424 | 251 |
| 110 | 3300013104 | Ga0157370_10000007 | Ga0157370_10000007143 | 251 |
| 111 | 3300013105 | Ga0157369_10000052 | Ga0157369_1000005239 | 251 |
| 112 | 3300013306 | Ga0163162_10906986 | Ga0163162_109069861 | 251 |
| 113 | 3300013307 | Ga0157372_10000014 | Ga0157372_1000001447 | 251 |
| 114 | 3300013307 | Ga0157372_10104589 | Ga0157372_101045893 | 251 |
| 115 | 3300014969 | Ga0157376_10843462 | Ga0157376_108434621 | 251 |
| 116 | 3300025913 | Ga0207695_10000069 | Ga0207695_1000006961 | 251 |
| 117 | 3300025928 | Ga0207700_10016890 | Ga0207700_100168902 | 251 |
| 118 | 3300025949 | Ga0207667_10000976 | Ga0207667_1000097614 | 251 |
| 119 | 3300026116 | Ga0207674_10165767 | Ga0207674_101657673 | 251 |
| 120 | 3300026142 | Ga0207698_10000006 | Ga0207698_10000006215 | 251 |
| 121 | 3300028666 | Ga0265336_10001392 | Ga0265336_100013927 | 251 |
| 122 | 3300028800 | Ga0265338_10009968 | Ga0265338_100099687 | 251 |
| 123 | 3300029957 | Ga0265324_10008415 | Ga0265324_100084153 | 251 |
| 124 | 3300031090 | Ga0265760_10036157 | Ga0265760_100361572 | 251 |
| 125 | 3300031249 | Ga0265339_10000115 | Ga0265339_1000011546 | 251 |
| 126 | 3300031344 | Ga0265316_10009406 | Ga0265316_100094067 | 251 |
| 127 | 3300031711 | Ga0265314_10007056 | Ga0265314_100070565 | 251 |
| 128 | 3300031711 | Ga0265314_10288694 | Ga0265314_102886941 | 251 |
| 129 | 3300031712 | Ga0265342_10011399 | Ga0265342_100113993 | 251 |
| 130 | 3300036401 | Ga0373937_0334448 | Ga0373937_0334448_103_924 | 251 |
| 131 | 3300046459 | Ga0495629_0033567 | Ga0495629_0033567_2762_3586 | 251 |
| 132 | 3300046536 | Ga0495587_0019857 | Ga0495587_0019857_3139_3963 | 251 |
| 133 | 3300046543 | Ga0495645_0001853 | Ga0495645_0001853_3544_4368 | 251 |
| 134 | 3300046642 | Ga0495634_0240396 | Ga0495634_0240396_243_1067 | 251 |
| 135 | 3300046689 | Ga0495613_0248476 | Ga0495613_0248476_387_1211 | 251 |
| 136 | 3300047471 | Ga0495684_0272526 | Ga0495684_0272526_249_1073 | 251 |
| 137 | 3300048088 | Ga0495602_0018104 | Ga0495602_0018104_965_1789 | 251 |
| 138 | 3300048907 | Ga0496104_0154851 | Ga0496104_0154851_1004_1825 | 251 |
| 139 | 3300048907 | Ga0496104_0192324 | Ga0496104_0192324_1097_1921 | 251 |
| 140 | 3300053077 | Ga0495601_0013776 | Ga0495601_0013776_760_1584 | 251 |
| 141 | 3300053084 | Ga0495595_0092546 | Ga0495595_0092546_527_1351 | 251 |
| 142 | 3300005327 | Ga0070658_10084760 | Ga0070658_100847602 | 252 |
| 143 | 3300005329 | Ga0070683_100026457 | Ga0070683_1000264575 | 252 |
| 144 | 3300005331 | Ga0070670_100008990 | Ga0070670_1000089906 | 252 |
| 145 | 3300005335 | Ga0070666_10039680 | Ga0070666_100396803 | 252 |
| 146 | 3300005338 | Ga0068868_100117438 | Ga0068868_1001174383 | 252 |
| 147 | 3300005355 | Ga0070671_100047032 | Ga0070671_1000470323 | 252 |
| 148 | 3300005367 | Ga0070667_100058772 | Ga0070667_1000587722 | 252 |
| 149 | 3300005535 | Ga0070684_100012893 | Ga0070684_1000128933 | 252 |
| 150 | 3300005577 | Ga0068857_100164810 | Ga0068857_1001648103 | 252 |
| 151 | 3300005578 | Ga0068854_100099847 | Ga0068854_1000998472 | 252 |
| 152 | 3300005614 | Ga0068856_100012039 | Ga0068856_1000120395 | 252 |
| 153 | 3300005614 | Ga0068856_100450385 | Ga0068856_1004503852 | 252 |
| 154 | 3300005618 | Ga0068864_100010101 | Ga0068864_1000101014 | 252 |
| 155 | 3300005841 | Ga0068863_100021156 | Ga0068863_1000211565 | 252 |
| 156 | 3300005842 | Ga0068858_100047044 | Ga0068858_1000470443 | 252 |
| 157 | 3300005843 | Ga0068860_100024780 | Ga0068860_1000247806 | 252 |
| 158 | 3300006237 | Ga0097621_100031388 | Ga0097621_1000313882 | 252 |
| 159 | 3300006358 | Ga0068871_100022004 | Ga0068871_1000220044 | 252 |
| 160 | 3300009093 | Ga0105240_10041415 | Ga0105240_100414152 | 252 |
| 161 | 3300009098 | Ga0105245_10006979 | Ga0105245_100069797 | 252 |
| 162 | 3300009101 | Ga0105247_10016249 | Ga0105247_100162493 | 252 |
| 163 | 3300009174 | Ga0105241_10018564 | Ga0105241_100185643 | 252 |
| 164 | 3300009177 | Ga0105248_10095938 | Ga0105248_100959382 | 252 |
| 165 | 3300009545 | Ga0105237_10024414 | Ga0105237_100244146 | 252 |
| 166 | 3300009551 | Ga0105238_10065396 | Ga0105238_100653963 | 252 |
| 167 | 3300009553 | Ga0105249_10279918 | Ga0105249_102799182 | 252 |
| 168 | 3300010375 | Ga0105239_10173628 | Ga0105239_101736283 | 252 |
| 169 | 3300011119 | Ga0105246_10018517 | Ga0105246_100185172 | 252 |
| 170 | 3300013296 | Ga0157374_10224750 | Ga0157374_102247502 | 252 |
| 171 | 3300013297 | Ga0157378_10013480 | Ga0157378_100134803 | 252 |
| 172 | 3300013308 | Ga0157375_10013817 | Ga0157375_100138172 | 252 |
| 173 | 3300014325 | Ga0163163_10017288 | Ga0163163_100172886 | 252 |
| 174 | 3300014968 | Ga0157379_10014667 | Ga0157379_100146676 | 252 |
| 175 | 3300014969 | Ga0157376_10009858 | Ga0157376_100098582 | 252 |
| 176 | 3300014969 | Ga0157376_10241590 | Ga0157376_102415902 | 252 |
| 177 | 3300025900 | Ga0207710_10010535 | Ga0207710_100105354 | 252 |
| 178 | 3300025903 | Ga0207680_10063730 | Ga0207680_100637302 | 252 |
| 179 | 3300025911 | Ga0207654_10041093 | Ga0207654_100410933 | 252 |
| 180 | 3300025913 | Ga0207695_10025109 | Ga0207695_100251093 | 252 |
| 181 | 3300025914 | Ga0207671_10025345 | Ga0207671_100253452 | 252 |
| 182 | 3300025925 | Ga0207650_10041687 | Ga0207650_100416873 | 252 |
| 183 | 3300025927 | Ga0207687_10033997 | Ga0207687_100339972 | 252 |
| 184 | 3300025941 | Ga0207711_10258990 | Ga0207711_102589902 | 252 |
| 185 | 3300025944 | Ga0207661_10032578 | Ga0207661_100325782 | 252 |
| 186 | 3300026023 | Ga0207677_10064086 | Ga0207677_100640862 | 252 |
| 187 | 3300026035 | Ga0207703_10107096 | Ga0207703_101070963 | 252 |
| 188 | 3300026041 | Ga0207639_10324269 | Ga0207639_103242692 | 252 |
| 189 | 3300026088 | Ga0207641_10008542 | Ga0207641_100085427 | 252 |
| 190 | 3300026095 | Ga0207676_10097112 | Ga0207676_100971122 | 252 |
| 191 | 3300026116 | Ga0207674_10030921 | Ga0207674_100309212 | 252 |
| 192 | 3300028381 | Ga0268264_10006968 | Ga0268264_100069683 | 252 |
| 193 | 3300048908 | Ga0496105_0434934 | Ga0496105_0434934_91_912 | 252 |
| 194 | 3300048918 | Ga0496115_0036443 | Ga0496115_0036443_2326_3150 | 252 |
| 195 | 3300048918 | Ga0496115_0264823 | Ga0496115_0264823_310_1131 | 252 |
| 196 | 3300005328 | Ga0070676_10032956 | Ga0070676_100329563 | 253 |
| 197 | 3300005329 | Ga0070683_100326431 | Ga0070683_1003264312 | 253 |
| 198 | 3300005331 | Ga0070670_100030783 | Ga0070670_1000307834 | 253 |
| 199 | 3300005334 | Ga0068869_100012689 | Ga0068869_1000126892 | 253 |
| 200 | 3300005354 | Ga0070675_100070861 | Ga0070675_1000708612 | 253 |
| 201 | 3300005456 | Ga0070678_100015046 | Ga0070678_1000150463 | 253 |
| 202 | 3300005457 | Ga0070662_100274735 | Ga0070662_1002747352 | 253 |
| 203 | 3300005535 | Ga0070684_100189339 | Ga0070684_1001893392 | 253 |
| 204 | 3300005548 | Ga0070665_100263261 | Ga0070665_1002632612 | 253 |
| 205 | 3300005564 | Ga0070664_100218279 | Ga0070664_1002182792 | 253 |
| 206 | 3300005578 | Ga0068854_100054517 | Ga0068854_1000545173 | 253 |
| 207 | 3300005614 | Ga0068856_100069429 | Ga0068856_1000694293 | 253 |
| 208 | 3300005616 | Ga0068852_100091903 | Ga0068852_1000919033 | 253 |
| 209 | 3300005834 | Ga0068851_10021398 | Ga0068851_100213983 | 253 |
| 210 | 3300005841 | Ga0068863_100122651 | Ga0068863_1001226513 | 253 |
| 211 | 3300005843 | Ga0068860_100210775 | Ga0068860_1002107752 | 253 |
| 212 | 3300006358 | Ga0068871_100058542 | Ga0068871_1000585423 | 253 |
| 213 | 3300006881 | Ga0068865_100040623 | Ga0068865_1000406233 | 253 |
| 214 | 3300009545 | Ga0105237_10012717 | Ga0105237_100127172 | 253 |
| 215 | 3300010375 | Ga0105239_10121975 | Ga0105239_101219752 | 253 |
| 216 | 3300013296 | Ga0157374_10018321 | Ga0157374_100183212 | 253 |
| 217 | 3300014325 | Ga0163163_10117228 | Ga0163163_101172283 | 253 |
| 218 | 3300025315 | Ga0207697_10028039 | Ga0207697_100280392 | 253 |
| 219 | 3300025321 | Ga0207656_10032310 | Ga0207656_100323103 | 253 |
| 220 | 3300025907 | Ga0207645_10008445 | Ga0207645_100084453 | 253 |
| 221 | 3300025914 | Ga0207671_10273725 | Ga0207671_102737252 | 253 |
| 222 | 3300025933 | Ga0207706_10063605 | Ga0207706_100636053 | 253 |
| 223 | 3300025938 | Ga0207704_10062934 | Ga0207704_100629342 | 253 |
| 224 | 3300025940 | Ga0207691_10013598 | Ga0207691_100135982 | 253 |
| 225 | 3300025941 | Ga0207711_10073026 | Ga0207711_100730262 | 253 |
| 226 | 3300025986 | Ga0207658_10124407 | Ga0207658_101244072 | 253 |
| 227 | 3300026023 | Ga0207677_10249571 | Ga0207677_102495712 | 253 |
| 228 | 3300026035 | Ga0207703_10045700 | Ga0207703_100457003 | 253 |
| 229 | 3300026088 | Ga0207641_10060314 | Ga0207641_100603142 | 253 |
| 230 | 3300026121 | Ga0207683_10002458 | Ga0207683_100024583 | 253 |
| 231 | 3300026142 | Ga0207698_10060428 | Ga0207698_100604282 | 253 |
| 232 | 3300028381 | Ga0268264_10101667 | Ga0268264_101016672 | 253 |
| 233 | 3300031595 | Ga0265313_10073535 | Ga0265313_100735352 | 253 |
| 234 | 3300048918 | Ga0496115_0075506 | Ga0496115_0075506_1474_2298 | 253 |
| 235 | 3300003320 | rootH2_10174645 | rootH2_101746453 | 254 |
| 236 | 3300005327 | Ga0070658_10564533 | Ga0070658_105645331 | 254 |
| 237 | 3300005458 | Ga0070681_10379791 | Ga0070681_103797912 | 254 |
| 238 | 3300006028 | Ga0070717_10021772 | Ga0070717_100217725 | 254 |
| 239 | 3300009177 | Ga0105248_10000027 | Ga0105248_1000002752 | 254 |
| 240 | 3300009177 | Ga0105248_10015194 | Ga0105248_100151946 | 254 |
| 241 | 3300011119 | Ga0105246_10027234 | Ga0105246_100272341 | 254 |
| 242 | 3300025913 | Ga0207695_10094183 | Ga0207695_100941832 | 254 |
| 243 | 3300025941 | Ga0207711_10000136 | Ga0207711_1000013613 | 254 |
| 244 | 3300025941 | Ga0207711_10008083 | Ga0207711_100080835 | 254 |
| 245 | 3300025942 | Ga0207689_10084247 | Ga0207689_100842472 | 254 |
| 246 | 3300028800 | Ga0265338_10074819 | Ga0265338_100748192 | 254 |
| 247 | 3300031344 | Ga0265316_10108268 | Ga0265316_101082682 | 254 |
| 248 | 3300031595 | Ga0265313_10007630 | Ga0265313_100076303 | 254 |
| 249 | 3300031711 | Ga0265314_10167785 | Ga0265314_101677852 | 254 |
| 250 | 3300031712 | Ga0265342_10082143 | Ga0265342_100821432 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.8149 | 2 | 251 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.8119 | 3 | 251 |
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.7998 | 2 | 251 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.7942 | 3 | 251 |
| 2q9h-assembly1.cif.gz_A | crystal structure of the c73s mutant of diaminopimelate epimerase | 0.7676 | 3 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1NA10_49_204_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8007 | 1 | 103 | 3.10.310.10 |
| 3ejxA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.7964 | 2 | 103 | 3.10.310.10 |
| af_Q8K284_174_250_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7948 | 121 | 142 | 1.10.10.10 |
| 3ejxD01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.7712 | 1 | 103 | 3.10.310.10 |
| af_P91147_2_338_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.7711 | 84 | 118 | 3.90.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B9EDN9-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.8945 | 1 | 254 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A5B9EDN9-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.8911 | 1 | 254 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-W0B653-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.8877 | 114 | 254 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A6L8GNA1-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.8782 | 2 | 205 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A2V9ZAQ8-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.8653 | 1 | 210 |
GO:0005829
GO:0008837 GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar