F361459

General Info

Members Datasets Scaffolds Average Seq Length
250 129 250 260

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10021772|Ga0070717_100217725
Length 315
Sequence VLSRRLKRCSRSAIRRKIDERGDQGSGIRDQDVPWVHLGGSLIAFTKAHACGNDFLIVVEEAAAGRDWAELTRRLCARNSGIGADGIEFFAWTGPKSARIRLHNADGSIAEISGNGTRCVAAWMAEAIGATAGDALEIETDAGMRVCHIDAVRASGEFVIDVTAGMGVPQFAKRTVTIPGGVQMQGVEISTGNPHFVIVVDNAEFTVDGQRWESIGQQICGHPDFPWQTNVEFVRIVKSGEIEIRIFERGVGPTNSSGTGTSACATAALAFNGCVSPLRVVAPGGAQTVAWDGPGTELKLTGPAALIARGEAWDG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.4
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10174645 3300003320 Bacteria 3929
2 Ga0070658_10084760 3300005327 Unclassified 2605
3 Ga0070658_10564533 3300005327 Bacteria 985
4 Ga0070676_10032956 3300005328 Bacteria 2970
5 Ga0070683_100026457 3300005329 Bacteria 5225
6 Ga0070683_100242422 3300005329 Bacteria 1715
7 Ga0070683_100326431 3300005329 Bacteria 1461
8 Ga0070670_100008990 3300005331 Bacteria 8533
9 Ga0070670_100030783 3300005331 Bacteria 4622
10 Ga0068869_100012689 3300005334 Bacteria 5573
11 Ga0070666_10039680 3300005335 Bacteria 3139
12 Ga0068868_100117438 3300005338 Bacteria 2167
13 Ga0070661_100001401 3300005344 Bacteria 16842
14 Ga0070669_100050733 3300005353 Bacteria 3031
15 Ga0070675_100070861 3300005354 Bacteria 2890
16 Ga0070671_100042699 3300005355 Bacteria 3769
17 Ga0070671_100047032 3300005355 Bacteria 3589
18 Ga0070667_100058772 3300005367 Unclassified 3251
19 Ga0070709_10182082 3300005434 Unclassified 1476
20 Ga0070714_100156819 3300005435 Bacteria 2056
21 Ga0070663_100060727 3300005455 Unclassified 2720
22 Ga0070663_100205841 3300005455 Bacteria 1538
23 Ga0070678_100015046 3300005456 Bacteria 4902
24 Ga0070662_100274735 3300005457 Bacteria 1362
25 Ga0070681_10379791 3300005458 Unclassified 1324
26 Ga0070684_100012893 3300005535 Bacteria 6720
27 Ga0070684_100189339 3300005535 Bacteria 1872
28 Ga0070684_100200272 3300005535 Bacteria 1818
29 Ga0068853_100000207 3300005539 Bacteria 41660
30 Ga0068853_100169558 3300005539 Bacteria 1974
31 Ga0068853_100328691 3300005539 Bacteria 1418
32 Ga0070665_100014542 3300005548 Bacteria 7896
33 Ga0070665_100129490 3300005548 Bacteria 2525
34 Ga0070665_100263261 3300005548 Bacteria 1725
35 Ga0068855_100000390 3300005563 Bacteria 54007
36 Ga0068855_100016729 3300005563 Bacteria 8821
37 Ga0068855_100049614 3300005563 Bacteria 4950
38 Ga0070664_100218279 3300005564 Bacteria 1706
39 Ga0068857_100055913 3300005577 Bacteria 3501
40 Ga0068857_100164810 3300005577 Unclassified 2012
41 Ga0068854_100003431 3300005578 Bacteria 9880
42 Ga0068854_100054517 3300005578 Bacteria 2876
43 Ga0068854_100099847 3300005578 Bacteria 2174
44 Ga0068856_100003145 3300005614 Bacteria 16830
45 Ga0068856_100012039 3300005614 Bacteria 8380
46 Ga0068856_100069429 3300005614 Bacteria 3484
47 Ga0068856_100073896 3300005614 Bacteria 3375
48 Ga0068856_100450385 3300005614 Unclassified 1308
49 Ga0068852_100000014 3300005616 Bacteria 139457
50 Ga0068852_100000018 3300005616 Bacteria 129976
51 Ga0068852_100091903 3300005616 Bacteria 2717
52 Ga0068852_100255635 3300005616 Unclassified 1680
53 Ga0068864_100010101 3300005618 Bacteria 7794
54 Ga0068851_10021398 3300005834 Bacteria 3140
55 Ga0068851_10089442 3300005834 Bacteria 1619
56 Ga0068863_100021156 3300005841 Bacteria 6212
57 Ga0068863_100122651 3300005841 Bacteria 2479
58 Ga0068858_100047044 3300005842 Bacteria 4000
59 Ga0068860_100024780 3300005843 Bacteria 5795
60 Ga0068860_100210775 3300005843 Bacteria 1885
61 Ga0081540_1044643 3300005983 Bacteria 2260
62 Ga0070717_10021772 3300006028 Bacteria 5057
63 Ga0097621_100031388 3300006237 Bacteria 4216
64 Ga0068871_100014459 3300006358 Bacteria 5887
65 Ga0068871_100022004 3300006358 Bacteria 4911
66 Ga0068871_100058542 3300006358 Bacteria 3137
67 Ga0068865_100040623 3300006881 Bacteria 3163
68 Ga0105240_10000144 3300009093 Bacteria 145748
69 Ga0105240_10000177 3300009093 Bacteria 129109
70 Ga0105240_10018454 3300009093 Bacteria 9366
71 Ga0105240_10041415 3300009093 Bacteria 5878
72 Ga0105240_10105551 3300009093 Bacteria 3420
73 Ga0105245_10006979 3300009098 Bacteria 9903
74 Ga0105247_10016249 3300009101 Bacteria 4458
75 Ga0105243_10084235 3300009148 Unclassified 2603
76 Ga0105241_10000044 3300009174 Bacteria 103625
77 Ga0105241_10017339 3300009174 Bacteria 5290
78 Ga0105241_10018564 3300009174 Bacteria 5117
79 Ga0105241_10086991 3300009174 Bacteria 2459
80 Ga0105248_10000027 3300009177 Bacteria 255822
81 Ga0105248_10002615 3300009177 Bacteria 20040
82 Ga0105248_10015194 3300009177 Bacteria 8484
83 Ga0105248_10095938 3300009177 Bacteria 3339
84 Ga0105237_10001603 3300009545 Bacteria 29367
85 Ga0105237_10012717 3300009545 Bacteria 8855
86 Ga0105237_10024414 3300009545 Bacteria 6185
87 Ga0105237_10678136 3300009545 Bacteria 1037
88 Ga0105238_10000056 3300009551 Bacteria 139227
89 Ga0105238_10001314 3300009551 Bacteria 24934
90 Ga0105238_10065396 3300009551 Bacteria 3637
91 Ga0105238_10090784 3300009551 Bacteria 3042
92 Ga0105249_10279918 3300009553 Unclassified 1665
93 Ga0105239_10000957 3300010375 Bacteria 40687
94 Ga0105239_10001272 3300010375 Bacteria 34028
95 Ga0105239_10121975 3300010375 Bacteria 2895
96 Ga0105239_10173628 3300010375 Unclassified 2411
97 Ga0105246_10018517 3300011119 Bacteria 4441
98 Ga0105246_10027234 3300011119 Bacteria 3743
99 Ga0157370_10000007 3300013104 Bacteria 246747
100 Ga0157369_10000052 3300013105 Bacteria 164801
101 Ga0157369_10000292 3300013105 Bacteria 66845
102 Ga0157369_10016074 3300013105 Bacteria 8420
103 Ga0157369_10241721 3300013105 Bacteria 1886
104 Ga0157374_10001090 3300013296 Bacteria 23365
105 Ga0157374_10018321 3300013296 Bacteria 6177
106 Ga0157374_10224750 3300013296 Unclassified 1843
107 Ga0157374_10349256 3300013296 Bacteria 1470
108 Ga0157378_10013480 3300013297 Bacteria 7149
109 Ga0157378_10016735 3300013297 Bacteria 6424
110 Ga0163162_10906986 3300013306 Bacteria 994
111 Ga0157372_10000014 3300013307 Bacteria 241589
112 Ga0157372_10035761 3300013307 Bacteria 5469
113 Ga0157372_10104589 3300013307 Unclassified 3237
114 Ga0157375_10013817 3300013308 Bacteria 7196
115 Ga0163163_10017288 3300014325 Bacteria 6723
116 Ga0163163_10117228 3300014325 Bacteria 2694
117 Ga0157379_10014667 3300014968 Bacteria 6873
118 Ga0157379_10209684 3300014968 Bacteria 1763
119 Ga0157376_10009858 3300014969 Bacteria 6963
120 Ga0157376_10042999 3300014969 Bacteria 3706
121 Ga0157376_10053513 3300014969 Unclassified 3361
122 Ga0157376_10241590 3300014969 Unclassified 1683
123 Ga0157376_10843462 3300014969 Bacteria 931
124 Ga0213872_10017681 3300021361 Bacteria 3292
125 Ga0213872_10066210 3300021361 Bacteria 1631
126 Ga0213872_10076291 3300021361 Bacteria 1508
127 Ga0213872_10100290 3300021361 Unclassified 1291
128 Ga0207697_10028039 3300025315 Bacteria 2302
129 Ga0207656_10029420 3300025321 Bacteria 2262
130 Ga0207656_10032310 3300025321 Bacteria 2174
131 Ga0207710_10010535 3300025900 Bacteria 3895
132 Ga0207680_10063730 3300025903 Unclassified 2257
133 Ga0207645_10008445 3300025907 Bacteria 7184
134 Ga0207654_10000042 3300025911 Bacteria 102291
135 Ga0207654_10000098 3300025911 Bacteria 57757
136 Ga0207654_10028531 3300025911 Bacteria 3043
137 Ga0207654_10041093 3300025911 Unclassified 2609
138 Ga0207707_10117236 3300025912 Unclassified 2327
139 Ga0207695_10000069 3300025913 Bacteria 319955
140 Ga0207695_10000086 3300025913 Bacteria 278055
141 Ga0207695_10000650 3300025913 Bacteria 68992
142 Ga0207695_10025109 3300025913 Bacteria 6683
143 Ga0207695_10094183 3300025913 Bacteria 3003
144 Ga0207671_10000085 3300025914 Bacteria 142417
145 Ga0207671_10025345 3300025914 Bacteria 4455
146 Ga0207671_10227553 3300025914 Unclassified 1462
147 Ga0207671_10273725 3300025914 Bacteria 1331
148 Ga0207649_10001059 3300025920 Bacteria 16861
149 Ga0207694_10000058 3300025924 Bacteria 144429
150 Ga0207694_10002752 3300025924 Bacteria 14204
151 Ga0207694_10145368 3300025924 Bacteria 1908
152 Ga0207650_10041687 3300025925 Unclassified 3365
153 Ga0207687_10033997 3300025927 Bacteria 3460
154 Ga0207700_10016890 3300025928 Bacteria 4861
155 Ga0207664_10080286 3300025929 Bacteria 2651
156 Ga0207644_10044995 3300025931 Unclassified 3139
157 Ga0207706_10063605 3300025933 Bacteria 3248
158 Ga0207704_10062934 3300025938 Bacteria 2310
159 Ga0207691_10013598 3300025940 Bacteria 7782
160 Ga0207711_10000136 3300025941 Bacteria 77691
161 Ga0207711_10002824 3300025941 Bacteria 15254
162 Ga0207711_10008083 3300025941 Bacteria 8805
163 Ga0207711_10073026 3300025941 Bacteria 2981
164 Ga0207711_10258990 3300025941 Bacteria 1598
165 Ga0207689_10084247 3300025942 Bacteria 2613
166 Ga0207661_10032578 3300025944 Bacteria 4038
167 Ga0207667_10000976 3300025949 Bacteria 36493
168 Ga0207667_10009737 3300025949 Bacteria 11301
169 Ga0207640_10002973 3300025981 Bacteria 9129
170 Ga0207658_10124407 3300025986 Bacteria 2061
171 Ga0207677_10064086 3300026023 Unclassified 2557
172 Ga0207677_10249571 3300026023 Bacteria 1440
173 Ga0207703_10045700 3300026035 Bacteria 3523
174 Ga0207703_10107096 3300026035 Unclassified 2379
175 Ga0207639_10000030 3300026041 Bacteria 172820
176 Ga0207639_10324269 3300026041 Bacteria 1368
177 Ga0207678_10104085 3300026067 Unclassified 2422
178 Ga0207702_10002044 3300026078 Bacteria 19541
179 Ga0207641_10008542 3300026088 Bacteria 8458
180 Ga0207641_10060314 3300026088 Bacteria 3234
181 Ga0207676_10097112 3300026095 Unclassified 2433
182 Ga0207674_10021995 3300026116 Bacteria 6859
183 Ga0207674_10030921 3300026116 Bacteria 5627
184 Ga0207674_10165767 3300026116 Bacteria 2164
185 Ga0207683_10002458 3300026121 Bacteria 16152
186 Ga0207698_10000006 3300026142 Bacteria 291847
187 Ga0207698_10000030 3300026142 Bacteria 114965
188 Ga0207698_10060428 3300026142 Bacteria 2947
189 Ga0207698_10244170 3300026142 Unclassified 1639
190 Ga0207698_10707308 3300026142 Bacteria 1003
191 Ga0268266_10066965 3300028379 Unclassified 3107
192 Ga0268264_10006968 3300028381 Bacteria 9488
193 Ga0268264_10101667 3300028381 Bacteria 2499
194 Ga0265336_10001392 3300028666 Bacteria 11158
195 Ga0265338_10009968 3300028800 Bacteria 11232
196 Ga0265338_10074819 3300028800 Bacteria 2878
197 Ga0265338_10109787 3300028800 Unclassified 2225
198 Ga0265324_10008415 3300029957 Bacteria 4100
199 Ga0265760_10036157 3300031090 Bacteria 1464
200 Ga0265328_10009693 3300031239 Unclassified 3912
201 Ga0265340_10032290 3300031247 Unclassified 2614
202 Ga0265339_10000065 3300031249 Bacteria 92603
203 Ga0265339_10000115 3300031249 Bacteria 65607
204 Ga0265339_10024938 3300031249 Bacteria 3440
205 Ga0265316_10000778 3300031344 Bacteria 35219
206 Ga0265316_10009406 3300031344 Bacteria 9002
207 Ga0265316_10027074 3300031344 Bacteria 4756
208 Ga0265316_10052307 3300031344 Unclassified 3205
209 Ga0265316_10108268 3300031344 Bacteria 2107
210 Ga0265313_10007630 3300031595 Bacteria 7337
211 Ga0265313_10073535 3300031595 Unclassified 1569
212 Ga0265314_10007056 3300031711 Bacteria 9805
213 Ga0265314_10100389 3300031711 Unclassified 1861
214 Ga0265314_10167785 3300031711 Bacteria 1328
215 Ga0265314_10288694 3300031711 Unclassified 925
216 Ga0265342_10001563 3300031712 Bacteria 21180
217 Ga0265342_10011399 3300031712 Bacteria 6089
218 Ga0265342_10082143 3300031712 Bacteria 1859
219 Ga0265342_10175208 3300031712 Unclassified 1177
220 Ga0373953_0169013 3300035117 Unclassified 941
221 Ga0373937_0005298 3300036401 Bacteria 11021
222 Ga0373937_0334448 3300036401 Bacteria 1434
223 Ga0395900_0063675 3300037418 Bacteria 3791
224 Ga0395900_0581653 3300037418 Bacteria 1062
225 Ga0395898_0774373 3300037466 Bacteria 900
226 Ga0436360_0061963 3300039438 Unclassified 2220
227 Ga0436361_0397526 3300039447 Bacteria 13611
228 Ga0436361_0512509 3300039447 Bacteria 2361
229 Ga0436361_0684537 3300039447 Bacteria 3787
230 Ga0436361_0982185 3300039447 Unclassified 1699
231 Ga0436361_1039308 3300039447 Bacteria 1201
232 Ga0466969_0034879 3300044656 Bacteria 2548
233 Ga0495592_0085518 3300046454 Bacteria 2273
234 Ga0495629_0033567 3300046459 Bacteria 3629
235 Ga0495587_0019857 3300046536 Bacteria 4153
236 Ga0495645_0001853 3300046543 Bacteria 14357
237 Ga0495634_0240396 3300046642 Bacteria 1111
238 Ga0495613_0248476 3300046689 Bacteria 1242
239 Ga0495684_0272526 3300047471 Bacteria 1224
240 Ga0495602_0018104 3300048088 Bacteria 7048
241 Ga0496104_0154851 3300048907 Unclassified 2200
242 Ga0496104_0192324 3300048907 Bacteria 1952
243 Ga0496105_0434934 3300048908 Bacteria 1037
244 Ga0496115_0036443 3300048918 Bacteria 3895
245 Ga0496115_0075506 3300048918 Bacteria 2738
246 Ga0496115_0264823 3300048918 Bacteria 1413
247 Ga0496126_0144815 3300048929 Unclassified 2042
248 Ga0496126_0314881 3300048929 Unclassified 1288
249 Ga0495601_0013776 3300053077 Bacteria 4866
250 Ga0495595_0092546 3300053084 Bacteria 1452

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0774373 Ga0395898_0774373_189_878 217
2 3300039447 Ga0436361_1039308 Ga0436361_1039308_191_985 235
3 3300039438 Ga0436360_0061963 Ga0436360_0061963_298_1092 236
4 3300046454 Ga0495592_0085518 Ga0495592_0085518_1431_2228 239
5 3300005353 Ga0070669_100050733 Ga0070669_1000507332 240
6 3300005983 Ga0081540_1044643 Ga0081540_10446433 240
7 3300021361 Ga0213872_10066210 Ga0213872_100662101 241
8 3300021361 Ga0213872_10076291 Ga0213872_100762912 243
9 3300039447 Ga0436361_0684537 Ga0436361_0684537_1722_2534 243
10 3300005563 Ga0068855_100049614 Ga0068855_1000496144 246
11 3300013105 Ga0157369_10016074 Ga0157369_100160743 246
12 3300021361 Ga0213872_10017681 Ga0213872_100176812 246
13 3300021361 Ga0213872_10100290 Ga0213872_101002902 246
14 3300025912 Ga0207707_10117236 Ga0207707_101172362 246
15 3300037418 Ga0395900_0063675 Ga0395900_0063675_2824_3618 246
16 3300037418 Ga0395900_0581653 Ga0395900_0581653_55_849 246
17 3300039447 Ga0436361_0397526 Ga0436361_0397526_11979_12773 246
18 3300039447 Ga0436361_0512509 Ga0436361_0512509_585_1391 246
19 3300039447 Ga0436361_0982185 Ga0436361_0982185_618_1412 246
20 3300005355 Ga0070671_100042699 Ga0070671_1000426992 247
21 3300005455 Ga0070663_100060727 Ga0070663_1000607273 247
22 3300005548 Ga0070665_100014542 Ga0070665_1000145426 247
23 3300005616 Ga0068852_100255635 Ga0068852_1002556352 247
24 3300006358 Ga0068871_100014459 Ga0068871_1000144596 247
25 3300009093 Ga0105240_10000177 Ga0105240_1000017784 247
26 3300009174 Ga0105241_10017339 Ga0105241_100173393 247
27 3300009177 Ga0105248_10002615 Ga0105248_1000261512 247
28 3300009551 Ga0105238_10001314 Ga0105238_1000131410 247
29 3300010375 Ga0105239_10000957 Ga0105239_1000095727 247
30 3300013296 Ga0157374_10001090 Ga0157374_1000109012 247
31 3300014969 Ga0157376_10053513 Ga0157376_100535133 247
32 3300025911 Ga0207654_10028531 Ga0207654_100285312 247
33 3300025913 Ga0207695_10000086 Ga0207695_10000086177 247
34 3300025914 Ga0207671_10227553 Ga0207671_102275532 247
35 3300025924 Ga0207694_10002752 Ga0207694_1000275212 247
36 3300025931 Ga0207644_10044995 Ga0207644_100449953 247
37 3300025941 Ga0207711_10002824 Ga0207711_1000282410 247
38 3300026067 Ga0207678_10104085 Ga0207678_101040851 247
39 3300026142 Ga0207698_10244170 Ga0207698_102441702 247
40 3300028379 Ga0268266_10066965 Ga0268266_100669652 247
41 3300005434 Ga0070709_10182082 Ga0070709_101820821 248
42 3300005435 Ga0070714_100156819 Ga0070714_1001568192 248
43 3300013105 Ga0157369_10241721 Ga0157369_102417212 248
44 3300014969 Ga0157376_10042999 Ga0157376_100429994 248
45 3300025929 Ga0207664_10080286 Ga0207664_100802863 248
46 3300031247 Ga0265340_10032290 Ga0265340_100322903 248
47 3300031249 Ga0265339_10024938 Ga0265339_100249382 248
48 3300031344 Ga0265316_10000778 Ga0265316_100007784 248
49 3300031344 Ga0265316_10027074 Ga0265316_100270744 248
50 3300031712 Ga0265342_10175208 Ga0265342_101752081 248
51 3300005344 Ga0070661_100001401 Ga0070661_1000014019 249
52 3300005455 Ga0070663_100205841 Ga0070663_1002058412 249
53 3300005539 Ga0068853_100000207 Ga0068853_10000020713 249
54 3300005577 Ga0068857_100055913 Ga0068857_1000559132 249
55 3300005578 Ga0068854_100003431 Ga0068854_1000034314 249
56 3300005614 Ga0068856_100003145 Ga0068856_1000031457 249
57 3300005616 Ga0068852_100000014 Ga0068852_10000001475 249
58 3300005834 Ga0068851_10089442 Ga0068851_100894422 249
59 3300009093 Ga0105240_10018454 Ga0105240_100184549 249
60 3300009093 Ga0105240_10105551 Ga0105240_101055512 249
61 3300009174 Ga0105241_10000044 Ga0105241_1000004476 249
62 3300009545 Ga0105237_10001603 Ga0105237_100016033 249
63 3300009551 Ga0105238_10000056 Ga0105238_1000005673 249
64 3300010375 Ga0105239_10001272 Ga0105239_1000127213 249
65 3300013105 Ga0157369_10000292 Ga0157369_1000029225 249
66 3300013297 Ga0157378_10016735 Ga0157378_100167356 249
67 3300013307 Ga0157372_10035761 Ga0157372_100357613 249
68 3300025911 Ga0207654_10000098 Ga0207654_1000009821 249
69 3300025913 Ga0207695_10000650 Ga0207695_1000065027 249
70 3300025914 Ga0207671_10000085 Ga0207671_1000008527 249
71 3300025920 Ga0207649_10001059 Ga0207649_100010599 249
72 3300025924 Ga0207694_10000058 Ga0207694_1000005876 249
73 3300025949 Ga0207667_10009737 Ga0207667_1000973711 249
74 3300025981 Ga0207640_10002973 Ga0207640_100029733 249
75 3300026041 Ga0207639_10000030 Ga0207639_1000003087 249
76 3300026078 Ga0207702_10002044 Ga0207702_1000204414 249
77 3300026116 Ga0207674_10021995 Ga0207674_100219953 249
78 3300026142 Ga0207698_10000030 Ga0207698_1000003013 249
79 3300026142 Ga0207698_10707308 Ga0207698_107073082 249
80 3300035117 Ga0373953_0169013 Ga0373953_0169013_95_919 249
81 3300036401 Ga0373937_0005298 Ga0373937_0005298_8756_9580 249
82 3300005329 Ga0070683_100242422 Ga0070683_1002424222 250
83 3300005535 Ga0070684_100200272 Ga0070684_1002002722 250
84 3300005539 Ga0068853_100328691 Ga0068853_1003286912 250
85 3300005563 Ga0068855_100016729 Ga0068855_1000167298 250
86 3300005614 Ga0068856_100073896 Ga0068856_1000738964 250
87 3300009148 Ga0105243_10084235 Ga0105243_100842352 250
88 3300009174 Ga0105241_10086991 Ga0105241_100869912 250
89 3300009545 Ga0105237_10678136 Ga0105237_106781362 250
90 3300009551 Ga0105238_10090784 Ga0105238_100907842 250
91 3300013296 Ga0157374_10349256 Ga0157374_103492562 250
92 3300014968 Ga0157379_10209684 Ga0157379_102096842 250
93 3300025321 Ga0207656_10029420 Ga0207656_100294201 250
94 3300025911 Ga0207654_10000042 Ga0207654_1000004245 250
95 3300025924 Ga0207694_10145368 Ga0207694_101453682 250
96 3300028800 Ga0265338_10109787 Ga0265338_101097872 250
97 3300031239 Ga0265328_10009693 Ga0265328_100096933 250
98 3300031249 Ga0265339_10000065 Ga0265339_1000006538 250
99 3300031344 Ga0265316_10052307 Ga0265316_100523073 250
100 3300031711 Ga0265314_10100389 Ga0265314_101003893 250
101 3300031712 Ga0265342_10001563 Ga0265342_100015633 250
102 3300044656 Ga0466969_0034879 Ga0466969_0034879_488_1324 250
103 3300048929 Ga0496126_0144815 Ga0496126_0144815_655_1470 250
104 3300048929 Ga0496126_0314881 Ga0496126_0314881_47_856 250
105 3300005539 Ga0068853_100169558 Ga0068853_1001695582 251
106 3300005548 Ga0070665_100129490 Ga0070665_1001294902 251
107 3300005563 Ga0068855_100000390 Ga0068855_10000039023 251
108 3300005616 Ga0068852_100000018 Ga0068852_10000001819 251
109 3300009093 Ga0105240_10000144 Ga0105240_1000014424 251
110 3300013104 Ga0157370_10000007 Ga0157370_10000007143 251
111 3300013105 Ga0157369_10000052 Ga0157369_1000005239 251
112 3300013306 Ga0163162_10906986 Ga0163162_109069861 251
113 3300013307 Ga0157372_10000014 Ga0157372_1000001447 251
114 3300013307 Ga0157372_10104589 Ga0157372_101045893 251
115 3300014969 Ga0157376_10843462 Ga0157376_108434621 251
116 3300025913 Ga0207695_10000069 Ga0207695_1000006961 251
117 3300025928 Ga0207700_10016890 Ga0207700_100168902 251
118 3300025949 Ga0207667_10000976 Ga0207667_1000097614 251
119 3300026116 Ga0207674_10165767 Ga0207674_101657673 251
120 3300026142 Ga0207698_10000006 Ga0207698_10000006215 251
121 3300028666 Ga0265336_10001392 Ga0265336_100013927 251
122 3300028800 Ga0265338_10009968 Ga0265338_100099687 251
123 3300029957 Ga0265324_10008415 Ga0265324_100084153 251
124 3300031090 Ga0265760_10036157 Ga0265760_100361572 251
125 3300031249 Ga0265339_10000115 Ga0265339_1000011546 251
126 3300031344 Ga0265316_10009406 Ga0265316_100094067 251
127 3300031711 Ga0265314_10007056 Ga0265314_100070565 251
128 3300031711 Ga0265314_10288694 Ga0265314_102886941 251
129 3300031712 Ga0265342_10011399 Ga0265342_100113993 251
130 3300036401 Ga0373937_0334448 Ga0373937_0334448_103_924 251
131 3300046459 Ga0495629_0033567 Ga0495629_0033567_2762_3586 251
132 3300046536 Ga0495587_0019857 Ga0495587_0019857_3139_3963 251
133 3300046543 Ga0495645_0001853 Ga0495645_0001853_3544_4368 251
134 3300046642 Ga0495634_0240396 Ga0495634_0240396_243_1067 251
135 3300046689 Ga0495613_0248476 Ga0495613_0248476_387_1211 251
136 3300047471 Ga0495684_0272526 Ga0495684_0272526_249_1073 251
137 3300048088 Ga0495602_0018104 Ga0495602_0018104_965_1789 251
138 3300048907 Ga0496104_0154851 Ga0496104_0154851_1004_1825 251
139 3300048907 Ga0496104_0192324 Ga0496104_0192324_1097_1921 251
140 3300053077 Ga0495601_0013776 Ga0495601_0013776_760_1584 251
141 3300053084 Ga0495595_0092546 Ga0495595_0092546_527_1351 251
142 3300005327 Ga0070658_10084760 Ga0070658_100847602 252
143 3300005329 Ga0070683_100026457 Ga0070683_1000264575 252
144 3300005331 Ga0070670_100008990 Ga0070670_1000089906 252
145 3300005335 Ga0070666_10039680 Ga0070666_100396803 252
146 3300005338 Ga0068868_100117438 Ga0068868_1001174383 252
147 3300005355 Ga0070671_100047032 Ga0070671_1000470323 252
148 3300005367 Ga0070667_100058772 Ga0070667_1000587722 252
149 3300005535 Ga0070684_100012893 Ga0070684_1000128933 252
150 3300005577 Ga0068857_100164810 Ga0068857_1001648103 252
151 3300005578 Ga0068854_100099847 Ga0068854_1000998472 252
152 3300005614 Ga0068856_100012039 Ga0068856_1000120395 252
153 3300005614 Ga0068856_100450385 Ga0068856_1004503852 252
154 3300005618 Ga0068864_100010101 Ga0068864_1000101014 252
155 3300005841 Ga0068863_100021156 Ga0068863_1000211565 252
156 3300005842 Ga0068858_100047044 Ga0068858_1000470443 252
157 3300005843 Ga0068860_100024780 Ga0068860_1000247806 252
158 3300006237 Ga0097621_100031388 Ga0097621_1000313882 252
159 3300006358 Ga0068871_100022004 Ga0068871_1000220044 252
160 3300009093 Ga0105240_10041415 Ga0105240_100414152 252
161 3300009098 Ga0105245_10006979 Ga0105245_100069797 252
162 3300009101 Ga0105247_10016249 Ga0105247_100162493 252
163 3300009174 Ga0105241_10018564 Ga0105241_100185643 252
164 3300009177 Ga0105248_10095938 Ga0105248_100959382 252
165 3300009545 Ga0105237_10024414 Ga0105237_100244146 252
166 3300009551 Ga0105238_10065396 Ga0105238_100653963 252
167 3300009553 Ga0105249_10279918 Ga0105249_102799182 252
168 3300010375 Ga0105239_10173628 Ga0105239_101736283 252
169 3300011119 Ga0105246_10018517 Ga0105246_100185172 252
170 3300013296 Ga0157374_10224750 Ga0157374_102247502 252
171 3300013297 Ga0157378_10013480 Ga0157378_100134803 252
172 3300013308 Ga0157375_10013817 Ga0157375_100138172 252
173 3300014325 Ga0163163_10017288 Ga0163163_100172886 252
174 3300014968 Ga0157379_10014667 Ga0157379_100146676 252
175 3300014969 Ga0157376_10009858 Ga0157376_100098582 252
176 3300014969 Ga0157376_10241590 Ga0157376_102415902 252
177 3300025900 Ga0207710_10010535 Ga0207710_100105354 252
178 3300025903 Ga0207680_10063730 Ga0207680_100637302 252
179 3300025911 Ga0207654_10041093 Ga0207654_100410933 252
180 3300025913 Ga0207695_10025109 Ga0207695_100251093 252
181 3300025914 Ga0207671_10025345 Ga0207671_100253452 252
182 3300025925 Ga0207650_10041687 Ga0207650_100416873 252
183 3300025927 Ga0207687_10033997 Ga0207687_100339972 252
184 3300025941 Ga0207711_10258990 Ga0207711_102589902 252
185 3300025944 Ga0207661_10032578 Ga0207661_100325782 252
186 3300026023 Ga0207677_10064086 Ga0207677_100640862 252
187 3300026035 Ga0207703_10107096 Ga0207703_101070963 252
188 3300026041 Ga0207639_10324269 Ga0207639_103242692 252
189 3300026088 Ga0207641_10008542 Ga0207641_100085427 252
190 3300026095 Ga0207676_10097112 Ga0207676_100971122 252
191 3300026116 Ga0207674_10030921 Ga0207674_100309212 252
192 3300028381 Ga0268264_10006968 Ga0268264_100069683 252
193 3300048908 Ga0496105_0434934 Ga0496105_0434934_91_912 252
194 3300048918 Ga0496115_0036443 Ga0496115_0036443_2326_3150 252
195 3300048918 Ga0496115_0264823 Ga0496115_0264823_310_1131 252
196 3300005328 Ga0070676_10032956 Ga0070676_100329563 253
197 3300005329 Ga0070683_100326431 Ga0070683_1003264312 253
198 3300005331 Ga0070670_100030783 Ga0070670_1000307834 253
199 3300005334 Ga0068869_100012689 Ga0068869_1000126892 253
200 3300005354 Ga0070675_100070861 Ga0070675_1000708612 253
201 3300005456 Ga0070678_100015046 Ga0070678_1000150463 253
202 3300005457 Ga0070662_100274735 Ga0070662_1002747352 253
203 3300005535 Ga0070684_100189339 Ga0070684_1001893392 253
204 3300005548 Ga0070665_100263261 Ga0070665_1002632612 253
205 3300005564 Ga0070664_100218279 Ga0070664_1002182792 253
206 3300005578 Ga0068854_100054517 Ga0068854_1000545173 253
207 3300005614 Ga0068856_100069429 Ga0068856_1000694293 253
208 3300005616 Ga0068852_100091903 Ga0068852_1000919033 253
209 3300005834 Ga0068851_10021398 Ga0068851_100213983 253
210 3300005841 Ga0068863_100122651 Ga0068863_1001226513 253
211 3300005843 Ga0068860_100210775 Ga0068860_1002107752 253
212 3300006358 Ga0068871_100058542 Ga0068871_1000585423 253
213 3300006881 Ga0068865_100040623 Ga0068865_1000406233 253
214 3300009545 Ga0105237_10012717 Ga0105237_100127172 253
215 3300010375 Ga0105239_10121975 Ga0105239_101219752 253
216 3300013296 Ga0157374_10018321 Ga0157374_100183212 253
217 3300014325 Ga0163163_10117228 Ga0163163_101172283 253
218 3300025315 Ga0207697_10028039 Ga0207697_100280392 253
219 3300025321 Ga0207656_10032310 Ga0207656_100323103 253
220 3300025907 Ga0207645_10008445 Ga0207645_100084453 253
221 3300025914 Ga0207671_10273725 Ga0207671_102737252 253
222 3300025933 Ga0207706_10063605 Ga0207706_100636053 253
223 3300025938 Ga0207704_10062934 Ga0207704_100629342 253
224 3300025940 Ga0207691_10013598 Ga0207691_100135982 253
225 3300025941 Ga0207711_10073026 Ga0207711_100730262 253
226 3300025986 Ga0207658_10124407 Ga0207658_101244072 253
227 3300026023 Ga0207677_10249571 Ga0207677_102495712 253
228 3300026035 Ga0207703_10045700 Ga0207703_100457003 253
229 3300026088 Ga0207641_10060314 Ga0207641_100603142 253
230 3300026121 Ga0207683_10002458 Ga0207683_100024583 253
231 3300026142 Ga0207698_10060428 Ga0207698_100604282 253
232 3300028381 Ga0268264_10101667 Ga0268264_101016672 253
233 3300031595 Ga0265313_10073535 Ga0265313_100735352 253
234 3300048918 Ga0496115_0075506 Ga0496115_0075506_1474_2298 253
235 3300003320 rootH2_10174645 rootH2_101746453 254
236 3300005327 Ga0070658_10564533 Ga0070658_105645331 254
237 3300005458 Ga0070681_10379791 Ga0070681_103797912 254
238 3300006028 Ga0070717_10021772 Ga0070717_100217725 254
239 3300009177 Ga0105248_10000027 Ga0105248_1000002752 254
240 3300009177 Ga0105248_10015194 Ga0105248_100151946 254
241 3300011119 Ga0105246_10027234 Ga0105246_100272341 254
242 3300025913 Ga0207695_10094183 Ga0207695_100941832 254
243 3300025941 Ga0207711_10000136 Ga0207711_1000013613 254
244 3300025941 Ga0207711_10008083 Ga0207711_100080835 254
245 3300025942 Ga0207689_10084247 Ga0207689_100842472 254
246 3300028800 Ga0265338_10074819 Ga0265338_100748192 254
247 3300031344 Ga0265316_10108268 Ga0265316_101082682 254
248 3300031595 Ga0265313_10007630 Ga0265313_100076303 254
249 3300031711 Ga0265314_10167785 Ga0265314_101677852 254
250 3300031712 Ga0265342_10082143 Ga0265342_100821432 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

187

307

0.94

PF01678

DAP_epimerase

Diaminopimelate epimerase

45

172

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.8149 2 251
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8119 3 251
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.7998 2 251
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.7942 3 251
2q9h-assembly1.cif.gz_A crystal structure of the c73s mutant of diaminopimelate epimerase 0.7676 3 254
ID Description Score Start End Superfamily
af_I1NA10_49_204_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8007 1 103 3.10.310.10
3ejxA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.7964 2 103 3.10.310.10
af_Q8K284_174_250_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7948 121 142 1.10.10.10
3ejxD01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.7712 1 103 3.10.310.10
af_P91147_2_338_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7711 84 118 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A5B9EDN9-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.8945 1 254 GO:0005829
GO:0008837
GO:0009089
AF-A0A5B9EDN9-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.8911 1 254 GO:0005829
GO:0008837
GO:0009089
AF-W0B653-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.8877 114 254 GO:0005829
GO:0008837
GO:0009089
AF-A0A6L8GNA1-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.8782 2 205 GO:0005829
GO:0008837
GO:0009089
AF-A0A2V9ZAQ8-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.8653 1 210 GO:0005829
GO:0008837
GO:0009089

Feature Viewer

pLDDT pTM Quality
84.47 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map