F361436
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 141 | 246 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300005718|Ga0068866_10104982|Ga0068866_101049822 |
| Length | 112 |
| Sequence | MVFVFLGRSLSVKKITPMKTVAEFKESLNSEQPIKGLSVQLKSLWYDGKGDWHQAHAQVDHLNDKESAWVHAYLHRKEGDIWNADYWYSKAQQIRPNISLEEEWEQLVLQFL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 3 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 4 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 111 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 112 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 113 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 139 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 140 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 141 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.4 |
| Metatranscriptomes | 0 |
| Isolates | 1.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.6 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 86.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003104 | 3300001904 | Bacteria | 2896 |
| 2 | JGI24736J21556_1035201 | 3300001904 | Bacteria | 772 |
| 3 | JGI24740J21852_10026161 | 3300001979 | Bacteria | 1957 |
| 4 | JGI24739J22299_10249771 | 3300001989 | Bacteria | 520 |
| 5 | JGI24737J22298_10000262 | 3300001990 | Bacteria | 17291 |
| 6 | JGI24737J22298_10024046 | 3300001990 | Bacteria | 1930 |
| 7 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 8 | JGI24735J21928_10059931 | 3300002067 | Bacteria | 1094 |
| 9 | JGI24735J21928_10230254 | 3300002067 | Bacteria | 539 |
| 10 | JGI25162J39368_1000919 | 3300002737 | Bacteria | 18926 |
| 11 | JGI25152J39213_1000596 | 3300002773 | Bacteria | 19416 |
| 12 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 13 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 14 | JGI25165J46597_1010518 | 3300003214 | Bacteria | 1347 |
| 15 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 16 | rootH2_10057887 | 3300003320 | Bacteria | 3629 |
| 17 | rootH1_10091382 | 3300003323 | Bacteria | 3325 |
| 18 | rootH1_10108212 | 3300003323 | Bacteria | 1223 |
| 19 | rootH1_10303573 | 3300003323 | Bacteria | 1894 |
| 20 | Ga0055529_1030429 | 3300003763 | Bacteria | 662 |
| 21 | Ga0065714_10008144 | 3300005288 | Bacteria | 2966 |
| 22 | Ga0070658_10249250 | 3300005327 | Bacteria | 1506 |
| 23 | Ga0070658_10467066 | 3300005327 | Bacteria | 1088 |
| 24 | Ga0070658_10689848 | 3300005327 | Bacteria | 886 |
| 25 | Ga0068869_101236039 | 3300005334 | Bacteria | 657 |
| 26 | Ga0070680_100143008 | 3300005336 | Bacteria | 2006 |
| 27 | Ga0068868_100006643 | 3300005338 | Bacteria | 8204 |
| 28 | Ga0070660_100017163 | 3300005339 | Bacteria | 5272 |
| 29 | Ga0070660_100144143 | 3300005339 | Bacteria | 1912 |
| 30 | Ga0070660_101758151 | 3300005339 | Bacteria | 528 |
| 31 | Ga0070675_100608407 | 3300005354 | Bacteria | 991 |
| 32 | Ga0070674_100096101 | 3300005356 | Bacteria | 2149 |
| 33 | Ga0070659_100074059 | 3300005366 | Bacteria | 2712 |
| 34 | Ga0070659_100218251 | 3300005366 | Bacteria | 1573 |
| 35 | Ga0070659_100236294 | 3300005366 | Bacteria | 1511 |
| 36 | Ga0070659_100872522 | 3300005366 | Bacteria | 785 |
| 37 | Ga0070678_100003450 | 3300005456 | Bacteria | 8816 |
| 38 | Ga0070662_100000155 | 3300005457 | Bacteria | 39426 |
| 39 | Ga0070662_100108754 | 3300005457 | Bacteria | 2109 |
| 40 | Ga0070681_10224061 | 3300005458 | Bacteria | 1795 |
| 41 | Ga0068867_100000368 | 3300005459 | Bacteria | 30054 |
| 42 | Ga0070679_100037920 | 3300005530 | Bacteria | 4789 |
| 43 | Ga0070679_100380731 | 3300005530 | Bacteria | 1358 |
| 44 | Ga0068853_100042033 | 3300005539 | Bacteria | 3907 |
| 45 | Ga0068853_100072244 | 3300005539 | Unclassified | 3006 |
| 46 | Ga0068853_100081157 | 3300005539 | Bacteria | 2839 |
| 47 | Ga0068853_100601662 | 3300005539 | Bacteria | 1044 |
| 48 | Ga0070672_100093049 | 3300005543 | Bacteria | 2435 |
| 49 | Ga0070665_100726601 | 3300005548 | Bacteria | 1006 |
| 50 | Ga0070665_102047874 | 3300005548 | Unclassified | 577 |
| 51 | Ga0068855_100000199 | 3300005563 | Bacteria | 77676 |
| 52 | Ga0068855_100005349 | 3300005563 | Bacteria | 15659 |
| 53 | Ga0068855_100224357 | 3300005563 | Bacteria | 2106 |
| 54 | Ga0068855_100430072 | 3300005563 | Bacteria | 1443 |
| 55 | Ga0068855_102101694 | 3300005563 | Bacteria | 569 |
| 56 | Ga0068857_100034820 | 3300005577 | Bacteria | 4455 |
| 57 | Ga0068857_100824315 | 3300005577 | Bacteria | 887 |
| 58 | Ga0068856_100001310 | 3300005614 | Bacteria | 26199 |
| 59 | Ga0068856_100377710 | 3300005614 | Bacteria | 1436 |
| 60 | Ga0068852_100001179 | 3300005616 | Bacteria | 17313 |
| 61 | Ga0068852_102424099 | 3300005616 | Bacteria | 545 |
| 62 | Ga0068866_10104982 | 3300005718 | Bacteria | 1566 |
| 63 | Ga0068858_102081403 | 3300005842 | Bacteria | 561 |
| 64 | Ga0075366_10048732 | 3300006195 | Bacteria | 2513 |
| 65 | Ga0075366_10597907 | 3300006195 | Bacteria | 684 |
| 66 | Ga0097621_100000780 | 3300006237 | Bacteria | 22337 |
| 67 | Ga0097621_101015650 | 3300006237 | Bacteria | 776 |
| 68 | Ga0068871_100000296 | 3300006358 | Bacteria | 34815 |
| 69 | Ga0068865_100000025 | 3300006881 | Bacteria | 94590 |
| 70 | Ga0105251_10357565 | 3300009011 | Bacteria | 667 |
| 71 | Ga0105240_10017109 | 3300009093 | Bacteria | 9789 |
| 72 | Ga0105240_10065352 | 3300009093 | Bacteria | 4516 |
| 73 | Ga0105240_10142772 | 3300009093 | Bacteria | 2861 |
| 74 | Ga0105240_10323587 | 3300009093 | Bacteria | 1757 |
| 75 | Ga0105240_10629420 | 3300009093 | Bacteria | 1178 |
| 76 | Ga0105245_12508375 | 3300009098 | Bacteria | 569 |
| 77 | Ga0105241_10000327 | 3300009174 | Bacteria | 35944 |
| 78 | Ga0105241_10020411 | 3300009174 | Bacteria | 4895 |
| 79 | Ga0105241_10065364 | 3300009174 | Bacteria | 2811 |
| 80 | Ga0105241_10121744 | 3300009174 | Bacteria | 2102 |
| 81 | Ga0105241_11394636 | 3300009174 | Bacteria | 671 |
| 82 | Ga0105242_10353278 | 3300009176 | Bacteria | 1358 |
| 83 | Ga0105242_10381836 | 3300009176 | Bacteria | 1310 |
| 84 | Ga0105237_10002672 | 3300009545 | Bacteria | 21880 |
| 85 | Ga0105237_10018071 | 3300009545 | Bacteria | 7303 |
| 86 | Ga0105237_10052910 | 3300009545 | Bacteria | 4074 |
| 87 | Ga0105237_11198961 | 3300009545 | Bacteria | 766 |
| 88 | Ga0105238_10006366 | 3300009551 | Bacteria | 11742 |
| 89 | Ga0105239_10000530 | 3300010375 | Bacteria | 55219 |
| 90 | Ga0105239_10012237 | 3300010375 | Bacteria | 9560 |
| 91 | Ga0105239_10057691 | 3300010375 | Bacteria | 4259 |
| 92 | Ga0105239_10341015 | 3300010375 | Bacteria | 1691 |
| 93 | Ga0105239_13034041 | 3300010375 | Bacteria | 547 |
| 94 | Ga0105246_10423557 | 3300011119 | Bacteria | 1112 |
| 95 | Ga0105246_10609088 | 3300011119 | Bacteria | 945 |
| 96 | Ga0105246_11629583 | 3300011119 | Bacteria | 611 |
| 97 | Ga0157373_10009595 | 3300013100 | Bacteria | 7144 |
| 98 | Ga0157373_10036306 | 3300013100 | Bacteria | 3538 |
| 99 | Ga0157373_10102237 | 3300013100 | Bacteria | 2016 |
| 100 | Ga0157373_10239120 | 3300013100 | Bacteria | 1283 |
| 101 | Ga0157371_10000441 | 3300013102 | Bacteria | 50801 |
| 102 | Ga0157371_10015106 | 3300013102 | Bacteria | 5803 |
| 103 | Ga0157371_10210345 | 3300013102 | Bacteria | 1396 |
| 104 | Ga0157371_10294220 | 3300013102 | Bacteria | 1174 |
| 105 | Ga0157370_10027549 | 3300013104 | Bacteria | 5603 |
| 106 | Ga0157370_10030710 | 3300013104 | Bacteria | 5263 |
| 107 | Ga0157370_10082271 | 3300013104 | Bacteria | 3028 |
| 108 | Ga0157370_11473619 | 3300013104 | Bacteria | 612 |
| 109 | Ga0157369_10031135 | 3300013105 | Bacteria | 5879 |
| 110 | Ga0157369_10634970 | 3300013105 | Bacteria | 1102 |
| 111 | Ga0157369_12249535 | 3300013105 | Bacteria | 553 |
| 112 | Ga0157374_10003573 | 3300013296 | Bacteria | 13089 |
| 113 | Ga0157378_10017873 | 3300013297 | Bacteria | 6223 |
| 114 | Ga0157378_10019492 | 3300013297 | Bacteria | 5964 |
| 115 | Ga0157378_10229674 | 3300013297 | Bacteria | 1768 |
| 116 | Ga0163162_10001218 | 3300013306 | Bacteria | 24051 |
| 117 | Ga0163162_11383654 | 3300013306 | Bacteria | 800 |
| 118 | Ga0157372_10000262 | 3300013307 | Bacteria | 58244 |
| 119 | Ga0157372_10007243 | 3300013307 | Bacteria | 11816 |
| 120 | Ga0157372_10256002 | 3300013307 | Bacteria | 2032 |
| 121 | Ga0157372_10261851 | 3300013307 | Unclassified | 2008 |
| 122 | Ga0157372_12351619 | 3300013307 | Bacteria | 612 |
| 123 | Ga0157375_10002837 | 3300013308 | Bacteria | 15004 |
| 124 | Ga0157375_10441773 | 3300013308 | Bacteria | 1467 |
| 125 | Ga0157376_10198487 | 3300014969 | Bacteria | 1844 |
| 126 | Ga0163161_10000120 | 3300017792 | Bacteria | 73632 |
| 127 | Ga0213872_10018292 | 3300021361 | Bacteria | 3232 |
| 128 | Ga0207427_113049 | 3300025231 | Bacteria | 821 |
| 129 | Ga0209437_100169 | 3300025233 | Bacteria | 142584 |
| 130 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 131 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 132 | Ga0209129_1006996 | 3300025258 | Bacteria | 3476 |
| 133 | Ga0209233_1000815 | 3300025261 | Bacteria | 13892 |
| 134 | Ga0209455_1004709 | 3300025272 | Bacteria | 4388 |
| 135 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 136 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 137 | Ga0207647_10000274 | 3300025904 | Bacteria | 41963 |
| 138 | Ga0207647_10000367 | 3300025904 | Bacteria | 36727 |
| 139 | Ga0207647_10158225 | 3300025904 | Bacteria | 1322 |
| 140 | Ga0207645_10000576 | 3300025907 | Bacteria | 30417 |
| 141 | Ga0207705_10638443 | 3300025909 | Bacteria | 828 |
| 142 | Ga0207705_10672650 | 3300025909 | Bacteria | 805 |
| 143 | Ga0207705_11037611 | 3300025909 | Bacteria | 633 |
| 144 | Ga0207654_10025779 | 3300025911 | Bacteria | 3176 |
| 145 | Ga0207654_11073973 | 3300025911 | Bacteria | 586 |
| 146 | Ga0207654_11280395 | 3300025911 | Bacteria | 534 |
| 147 | Ga0207707_10290502 | 3300025912 | Bacteria | 1414 |
| 148 | Ga0207695_10000055 | 3300025913 | Bacteria | 382776 |
| 149 | Ga0207695_10103353 | 3300025913 | Bacteria | 2840 |
| 150 | Ga0207695_10123704 | 3300025913 | Bacteria | 2552 |
| 151 | Ga0207695_10627708 | 3300025913 | Bacteria | 956 |
| 152 | Ga0207671_10002743 | 3300025914 | Bacteria | 18404 |
| 153 | Ga0207671_10191083 | 3300025914 | Bacteria | 1597 |
| 154 | Ga0207671_10253908 | 3300025914 | Bacteria | 1382 |
| 155 | Ga0207660_10119736 | 3300025917 | Bacteria | 1992 |
| 156 | Ga0207657_10033830 | 3300025919 | Bacteria | 4603 |
| 157 | Ga0207657_10053674 | 3300025919 | Bacteria | 3490 |
| 158 | Ga0207652_10002572 | 3300025921 | Bacteria | 15232 |
| 159 | Ga0207659_10867243 | 3300025926 | Bacteria | 776 |
| 160 | Ga0207690_10098813 | 3300025932 | Bacteria | 2080 |
| 161 | Ga0207690_10174358 | 3300025932 | Bacteria | 1614 |
| 162 | Ga0207690_10177078 | 3300025932 | Bacteria | 1603 |
| 163 | Ga0207706_10000036 | 3300025933 | Bacteria | 134302 |
| 164 | Ga0207706_10051099 | 3300025933 | Bacteria | 3651 |
| 165 | Ga0207686_10682825 | 3300025934 | Bacteria | 815 |
| 166 | Ga0207686_11067734 | 3300025934 | Bacteria | 657 |
| 167 | Ga0207669_10329595 | 3300025937 | Bacteria | 1171 |
| 168 | Ga0207704_10009471 | 3300025938 | Bacteria | 4701 |
| 169 | Ga0207691_10454949 | 3300025940 | Bacteria | 1089 |
| 170 | Ga0207689_10959169 | 3300025942 | Bacteria | 722 |
| 171 | Ga0207667_10005820 | 3300025949 | Bacteria | 15028 |
| 172 | Ga0207667_10111593 | 3300025949 | Bacteria | 2820 |
| 173 | Ga0207667_10229172 | 3300025949 | Bacteria | 1903 |
| 174 | Ga0207667_10342710 | 3300025949 | Bacteria | 1525 |
| 175 | Ga0207667_10516102 | 3300025949 | Bacteria | 1211 |
| 176 | Ga0207667_10780800 | 3300025949 | Bacteria | 953 |
| 177 | Ga0207677_10004718 | 3300026023 | Bacteria | 7343 |
| 178 | Ga0207639_10046764 | 3300026041 | Bacteria | 3267 |
| 179 | Ga0207639_10049126 | 3300026041 | Bacteria | 3197 |
| 180 | Ga0207639_10053200 | 3300026041 | Bacteria | 3088 |
| 181 | Ga0207639_10341035 | 3300026041 | Bacteria | 1336 |
| 182 | Ga0207639_10847114 | 3300026041 | Bacteria | 853 |
| 183 | Ga0207639_10900974 | 3300026041 | Bacteria | 827 |
| 184 | Ga0207702_10000463 | 3300026078 | Bacteria | 45983 |
| 185 | Ga0207648_10000331 | 3300026089 | Bacteria | 51769 |
| 186 | Ga0207674_10075590 | 3300026116 | Bacteria | 3378 |
| 187 | Ga0207674_10095038 | 3300026116 | Bacteria | 2967 |
| 188 | Ga0207683_10177722 | 3300026121 | Bacteria | 1929 |
| 189 | Ga0207698_12099628 | 3300026142 | Bacteria | 579 |
| 190 | Ga0268266_10711899 | 3300028379 | Bacteria | 968 |
| 191 | Ga0307509_10927090 | 3300031507 | Bacteria | 536 |
| 192 | Ga0307412_10036189 | 3300031911 | Bacteria | 3160 |
| 193 | Ga0307412_11100716 | 3300031911 | Bacteria | 707 |
| 194 | Ga0307510_10045506 | 3300033180 | Bacteria | 4736 |
| 195 | Ga0395899_0004577 | 3300037312 | Bacteria | 10779 |
| 196 | Ga0395899_0367225 | 3300037312 | Bacteria | 959 |
| 197 | Ga0395900_0000140 | 3300037418 | Bacteria | 121917 |
| 198 | Ga0395900_0034738 | 3300037418 | Bacteria | 5193 |
| 199 | Ga0395900_0190772 | 3300037418 | Bacteria | 2079 |
| 200 | Ga0395898_0082956 | 3300037466 | Bacteria | 3089 |
| 201 | Ga0395898_0599029 | 3300037466 | Bacteria | 1045 |
| 202 | Ga0395905_0815240 | 3300037471 | Bacteria | 836 |
| 203 | Ga0395901_0001623 | 3300038443 | Bacteria | 23267 |
| 204 | Ga0395901_0057313 | 3300038443 | Bacteria | 4052 |
| 205 | Ga0436361_0499494 | 3300039447 | Bacteria | 12745 |
| 206 | Ga0451849_0821085 | 3300041505 | Bacteria | 1040 |
| 207 | Ga0439448_0018095 | 3300042005 | Bacteria | 2156 |
| 208 | Ga0495638_0267244 | 3300046460 | Bacteria | 935 |
| 209 | Ga0495651_0224262 | 3300046462 | Bacteria | 1299 |
| 210 | Ga0495650_0000330 | 3300046471 | Bacteria | 84849 |
| 211 | Ga0495585_0000201 | 3300046492 | Bacteria | 62206 |
| 212 | Ga0495583_0007429 | 3300046506 | Bacteria | 6888 |
| 213 | Ga0495606_0000036 | 3300046507 | Bacteria | 234596 |
| 214 | Ga0495606_0204574 | 3300046507 | Bacteria | 1123 |
| 215 | Ga0495606_0244398 | 3300046507 | Bacteria | 999 |
| 216 | Ga0495608_0421046 | 3300046511 | Bacteria | 815 |
| 217 | Ga0495610_0001404 | 3300046512 | Bacteria | 21399 |
| 218 | Ga0495610_0032696 | 3300046512 | Bacteria | 2699 |
| 219 | Ga0495616_0001583 | 3300046513 | Bacteria | 15619 |
| 220 | Ga0495632_0372194 | 3300046519 | Bacteria | 626 |
| 221 | Ga0495637_0024874 | 3300046520 | Bacteria | 2706 |
| 222 | Ga0495637_0270207 | 3300046520 | Bacteria | 608 |
| 223 | Ga0495652_0686220 | 3300046529 | Bacteria | 690 |
| 224 | Ga0495609_0069141 | 3300046538 | Bacteria | 1553 |
| 225 | Ga0495609_0254016 | 3300046538 | Bacteria | 723 |
| 226 | Ga0495633_0002507 | 3300046558 | Bacteria | 12917 |
| 227 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 228 | Ga0495661_0011994 | 3300046665 | Bacteria | 5866 |
| 229 | Ga0495661_0043928 | 3300046665 | Bacteria | 2743 |
| 230 | Ga0495669_0071426 | 3300046684 | Bacteria | 1583 |
| 231 | Ga0495671_0027024 | 3300046692 | Bacteria | 2968 |
| 232 | Ga0495649_0000038 | 3300046694 | Bacteria | 128764 |
| 233 | Ga0495589_0169238 | 3300046794 | Bacteria | 1039 |
| 234 | Ga0495683_0047966 | 3300047323 | Bacteria | 2142 |
| 235 | Ga0495687_003170 | 3300047443 | Bacteria | 12241 |
| 236 | Ga0495679_067516 | 3300047446 | Bacteria | 1036 |
| 237 | Ga0495673_0015983 | 3300047469 | Bacteria | 3849 |
| 238 | Ga0495686_0000524 | 3300047472 | Bacteria | 55256 |
| 239 | Ga0495686_0043187 | 3300047472 | Bacteria | 2860 |
| 240 | Ga0495686_0205050 | 3300047472 | Bacteria | 1129 |
| 241 | nmdc:mga0k408_44613_c1 | 3300050493 | Bacteria | 2557 |
| 242 | nmdc:mga0k408_594666_c1 | 3300050493 | Bacteria | 653 |
| 243 | Ga0500647_0198268 | 3300053091 | Bacteria | 912 |
| 244 | Ga0500608_002264 | 3300053122 | Bacteria | 6956 |
| 245 | Ga0500608_025177 | 3300053122 | Bacteria | 2783 |
| 246 | Ga0500568_0232110 | 3300053139 | Bacteria | 673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2599185184 | 2599478785 | 91 |
| 2 | iso_pu_bacteria | 2928078545 | 2928080156 | 91 |
| 3 | iso_pu_bacteria | 2928147474 | 2928149671 | 91 |
| 4 | iso_pu_bacteria | 2932082852 | 2932083498 | 91 |
| 5 | 3300009093 | Ga0105240_10142772 | Ga0105240_101427724 | 93 |
| 6 | 3300025913 | Ga0207695_10103353 | Ga0207695_101033534 | 93 |
| 7 | 3300005327 | Ga0070658_10467066 | Ga0070658_104670662 | 94 |
| 8 | 3300005339 | Ga0070660_100144143 | Ga0070660_1001441432 | 94 |
| 9 | 3300005366 | Ga0070659_100236294 | Ga0070659_1002362942 | 94 |
| 10 | 3300005530 | Ga0070679_100380731 | Ga0070679_1003807313 | 94 |
| 11 | 3300005563 | Ga0068855_100005349 | Ga0068855_1000053493 | 94 |
| 12 | 3300013102 | Ga0157371_10015106 | Ga0157371_100151064 | 94 |
| 13 | 3300013104 | Ga0157370_10030710 | Ga0157370_100307104 | 94 |
| 14 | 3300013307 | Ga0157372_10261851 | Ga0157372_102618512 | 94 |
| 15 | 3300025909 | Ga0207705_10672650 | Ga0207705_106726502 | 94 |
| 16 | 3300025919 | Ga0207657_10033830 | Ga0207657_100338303 | 94 |
| 17 | 3300025932 | Ga0207690_10177078 | Ga0207690_101770782 | 94 |
| 18 | 3300025949 | Ga0207667_10111593 | Ga0207667_101115933 | 94 |
| 19 | 3300031911 | Ga0307412_11100716 | Ga0307412_111007162 | 94 |
| 20 | 3300037312 | Ga0395899_0004577 | Ga0395899_0004577_3976_4260 | 94 |
| 21 | 3300037418 | Ga0395900_0034738 | Ga0395900_0034738_3976_4260 | 94 |
| 22 | 3300037466 | Ga0395898_0082956 | Ga0395898_0082956_700_984 | 94 |
| 23 | 3300038443 | Ga0395901_0001623 | Ga0395901_0001623_10324_10608 | 94 |
| 24 | 3300046507 | Ga0495606_0244398 | Ga0495606_0244398_454_738 | 94 |
| 25 | 3300001990 | JGI24737J22298_10000262 | JGI24737J22298_100002624 | 95 |
| 26 | 3300002067 | JGI24735J21928_10000002 | JGI24735J21928_10000002153 | 95 |
| 27 | 3300002737 | JGI25162J39368_1000919 | JGI25162J39368_10009194 | 95 |
| 28 | 3300002773 | JGI25152J39213_1000596 | JGI25152J39213_10005963 | 95 |
| 29 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001537 | 95 |
| 30 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001266 | 95 |
| 31 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001155 | 95 |
| 32 | 3300003320 | rootH2_10057887 | rootH2_100578872 | 95 |
| 33 | 3300003323 | rootH1_10108212 | rootH1_101082122 | 95 |
| 34 | 3300003323 | rootH1_10303573 | rootH1_103035732 | 95 |
| 35 | 3300005288 | Ga0065714_10008144 | Ga0065714_100081444 | 95 |
| 36 | 3300005339 | Ga0070660_100017163 | Ga0070660_1000171637 | 95 |
| 37 | 3300005339 | Ga0070660_101758151 | Ga0070660_1017581511 | 95 |
| 38 | 3300005539 | Ga0068853_100081157 | Ga0068853_1000811572 | 95 |
| 39 | 3300005563 | Ga0068855_102101694 | Ga0068855_1021016941 | 95 |
| 40 | 3300005577 | Ga0068857_100824315 | Ga0068857_1008243152 | 95 |
| 41 | 3300005616 | Ga0068852_102424099 | Ga0068852_1024240991 | 95 |
| 42 | 3300005718 | Ga0068866_10104982 | Ga0068866_101049822 | 95 |
| 43 | 3300006195 | Ga0075366_10048732 | Ga0075366_100487322 | 95 |
| 44 | 3300009011 | Ga0105251_10357565 | Ga0105251_103575652 | 95 |
| 45 | 3300009093 | Ga0105240_10629420 | Ga0105240_106294202 | 95 |
| 46 | 3300009176 | Ga0105242_10353278 | Ga0105242_103532781 | 95 |
| 47 | 3300009545 | Ga0105237_11198961 | Ga0105237_111989611 | 95 |
| 48 | 3300010375 | Ga0105239_10000530 | Ga0105239_100005302 | 95 |
| 49 | 3300010375 | Ga0105239_10012237 | Ga0105239_100122374 | 95 |
| 50 | 3300010375 | Ga0105239_10341015 | Ga0105239_103410152 | 95 |
| 51 | 3300010375 | Ga0105239_13034041 | Ga0105239_130340411 | 95 |
| 52 | 3300011119 | Ga0105246_10609088 | Ga0105246_106090881 | 95 |
| 53 | 3300011119 | Ga0105246_11629583 | Ga0105246_116295832 | 95 |
| 54 | 3300013100 | Ga0157373_10009595 | Ga0157373_100095954 | 95 |
| 55 | 3300013102 | Ga0157371_10210345 | Ga0157371_102103451 | 95 |
| 56 | 3300013104 | Ga0157370_11473619 | Ga0157370_114736191 | 95 |
| 57 | 3300013297 | Ga0157378_10019492 | Ga0157378_100194922 | 95 |
| 58 | 3300013297 | Ga0157378_10229674 | Ga0157378_102296743 | 95 |
| 59 | 3300013306 | Ga0163162_10001218 | Ga0163162_1000121814 | 95 |
| 60 | 3300013307 | Ga0157372_10007243 | Ga0157372_1000724310 | 95 |
| 61 | 3300013308 | Ga0157375_10002837 | Ga0157375_100028376 | 95 |
| 62 | 3300013308 | Ga0157375_10441773 | Ga0157375_104417732 | 95 |
| 63 | 3300017792 | Ga0163161_10000120 | Ga0163161_1000012039 | 95 |
| 64 | 3300025233 | Ga0209437_100169 | Ga0209437_100169128 | 95 |
| 65 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002638 | 95 |
| 66 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002638 | 95 |
| 67 | 3300025258 | Ga0209129_1006996 | Ga0209129_10069964 | 95 |
| 68 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004553 | 95 |
| 69 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006553 | 95 |
| 70 | 3300025904 | Ga0207647_10158225 | Ga0207647_101582252 | 95 |
| 71 | 3300025919 | Ga0207657_10053674 | Ga0207657_100536745 | 95 |
| 72 | 3300025934 | Ga0207686_10682825 | Ga0207686_106828251 | 95 |
| 73 | 3300025949 | Ga0207667_10229172 | Ga0207667_102291722 | 95 |
| 74 | 3300026041 | Ga0207639_10049126 | Ga0207639_100491262 | 95 |
| 75 | 3300026041 | Ga0207639_10341035 | Ga0207639_103410352 | 95 |
| 76 | 3300026116 | Ga0207674_10095038 | Ga0207674_100950381 | 95 |
| 77 | 3300026142 | Ga0207698_12099628 | Ga0207698_120996281 | 95 |
| 78 | 3300031911 | Ga0307412_10036189 | Ga0307412_100361893 | 95 |
| 79 | 3300033180 | Ga0307510_10045506 | Ga0307510_100455065 | 95 |
| 80 | 3300041505 | Ga0451849_0821085 | Ga0451849_0821085_169_456 | 95 |
| 81 | 3300046460 | Ga0495638_0267244 | Ga0495638_0267244_49_336 | 95 |
| 82 | 3300046471 | Ga0495650_0000330 | Ga0495650_0000330_15840_16127 | 95 |
| 83 | 3300046492 | Ga0495585_0000201 | Ga0495585_0000201_43265_43552 | 95 |
| 84 | 3300046506 | Ga0495583_0007429 | Ga0495583_0007429_3519_3806 | 95 |
| 85 | 3300046507 | Ga0495606_0000036 | Ga0495606_0000036_191179_191466 | 95 |
| 86 | 3300046507 | Ga0495606_0204574 | Ga0495606_0204574_199_486 | 95 |
| 87 | 3300046512 | Ga0495610_0001404 | Ga0495610_0001404_13386_13673 | 95 |
| 88 | 3300046512 | Ga0495610_0032696 | Ga0495610_0032696_1037_1324 | 95 |
| 89 | 3300046513 | Ga0495616_0001583 | Ga0495616_0001583_2441_2728 | 95 |
| 90 | 3300046519 | Ga0495632_0372194 | Ga0495632_0372194_36_323 | 95 |
| 91 | 3300046520 | Ga0495637_0024874 | Ga0495637_0024874_43_330 | 95 |
| 92 | 3300046520 | Ga0495637_0270207 | Ga0495637_0270207_223_510 | 95 |
| 93 | 3300046538 | Ga0495609_0254016 | Ga0495609_0254016_75_362 | 95 |
| 94 | 3300046558 | Ga0495633_0002507 | Ga0495633_0002507_5687_5974 | 95 |
| 95 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_525943_526230 | 95 |
| 96 | 3300046665 | Ga0495661_0011994 | Ga0495661_0011994_2315_2602 | 95 |
| 97 | 3300046665 | Ga0495661_0043928 | Ga0495661_0043928_1712_1999 | 95 |
| 98 | 3300046684 | Ga0495669_0071426 | Ga0495669_0071426_1089_1427 | 95 |
| 99 | 3300046692 | Ga0495671_0027024 | Ga0495671_0027024_699_986 | 95 |
| 100 | 3300046694 | Ga0495649_0000038 | Ga0495649_0000038_39568_39855 | 95 |
| 101 | 3300046794 | Ga0495589_0169238 | Ga0495589_0169238_117_404 | 95 |
| 102 | 3300047323 | Ga0495683_0047966 | Ga0495683_0047966_221_508 | 95 |
| 103 | 3300047446 | Ga0495679_067516 | Ga0495679_067516_628_915 | 95 |
| 104 | 3300047469 | Ga0495673_0015983 | Ga0495673_0015983_1170_1457 | 95 |
| 105 | 3300047472 | Ga0495686_0000524 | Ga0495686_0000524_8423_8710 | 95 |
| 106 | 3300047472 | Ga0495686_0043187 | Ga0495686_0043187_1216_1503 | 95 |
| 107 | 3300047472 | Ga0495686_0205050 | Ga0495686_0205050_329_616 | 95 |
| 108 | 3300050493 | nmdc:mga0k408_44613_c1 | nmdc:mga0k408_44613_c1_1886_2173 | 95 |
| 109 | 3300053091 | Ga0500647_0198268 | Ga0500647_0198268_143_430 | 95 |
| 110 | 3300053122 | Ga0500608_002264 | Ga0500608_002264_4603_4890 | 95 |
| 111 | 3300053122 | Ga0500608_025177 | Ga0500608_025177_2427_2714 | 95 |
| 112 | 3300053139 | Ga0500568_0232110 | Ga0500568_0232110_266_553 | 95 |
| 113 | 3300001989 | JGI24739J22299_10249771 | JGI24739J22299_102497711 | 96 |
| 114 | 3300003323 | rootH1_10091382 | rootH1_100913822 | 96 |
| 115 | 3300003763 | Ga0055529_1030429 | Ga0055529_10304291 | 96 |
| 116 | 3300005334 | Ga0068869_101236039 | Ga0068869_1012360392 | 96 |
| 117 | 3300005338 | Ga0068868_100006643 | Ga0068868_1000066434 | 96 |
| 118 | 3300005354 | Ga0070675_100608407 | Ga0070675_1006084072 | 96 |
| 119 | 3300005356 | Ga0070674_100096101 | Ga0070674_1000961012 | 96 |
| 120 | 3300005456 | Ga0070678_100003450 | Ga0070678_1000034502 | 96 |
| 121 | 3300005459 | Ga0068867_100000368 | Ga0068867_10000036813 | 96 |
| 122 | 3300005539 | Ga0068853_100042033 | Ga0068853_1000420333 | 96 |
| 123 | 3300005539 | Ga0068853_100601662 | Ga0068853_1006016621 | 96 |
| 124 | 3300005543 | Ga0070672_100093049 | Ga0070672_1000930491 | 96 |
| 125 | 3300005548 | Ga0070665_100726601 | Ga0070665_1007266011 | 96 |
| 126 | 3300005563 | Ga0068855_100000199 | Ga0068855_10000019963 | 96 |
| 127 | 3300005563 | Ga0068855_100224357 | Ga0068855_1002243573 | 96 |
| 128 | 3300005616 | Ga0068852_100001179 | Ga0068852_1000011795 | 96 |
| 129 | 3300005842 | Ga0068858_102081403 | Ga0068858_1020814031 | 96 |
| 130 | 3300006195 | Ga0075366_10597907 | Ga0075366_105979072 | 96 |
| 131 | 3300006237 | Ga0097621_100000780 | Ga0097621_10000078024 | 96 |
| 132 | 3300006358 | Ga0068871_100000296 | Ga0068871_10000029613 | 96 |
| 133 | 3300006881 | Ga0068865_100000025 | Ga0068865_10000002563 | 96 |
| 134 | 3300009093 | Ga0105240_10017109 | Ga0105240_100171094 | 96 |
| 135 | 3300009093 | Ga0105240_10065352 | Ga0105240_100653527 | 96 |
| 136 | 3300009093 | Ga0105240_10323587 | Ga0105240_103235872 | 96 |
| 137 | 3300009174 | Ga0105241_10020411 | Ga0105241_100204114 | 96 |
| 138 | 3300009174 | Ga0105241_10065364 | Ga0105241_100653644 | 96 |
| 139 | 3300009174 | Ga0105241_10121744 | Ga0105241_101217443 | 96 |
| 140 | 3300009176 | Ga0105242_10381836 | Ga0105242_103818362 | 96 |
| 141 | 3300009545 | Ga0105237_10002672 | Ga0105237_1000267213 | 96 |
| 142 | 3300009545 | Ga0105237_10018071 | Ga0105237_1001807110 | 96 |
| 143 | 3300009545 | Ga0105237_10052910 | Ga0105237_100529103 | 96 |
| 144 | 3300009551 | Ga0105238_10006366 | Ga0105238_100063669 | 96 |
| 145 | 3300010375 | Ga0105239_10057691 | Ga0105239_100576915 | 96 |
| 146 | 3300013100 | Ga0157373_10102237 | Ga0157373_101022373 | 96 |
| 147 | 3300013296 | Ga0157374_10003573 | Ga0157374_100035732 | 96 |
| 148 | 3300013297 | Ga0157378_10017873 | Ga0157378_100178734 | 96 |
| 149 | 3300014969 | Ga0157376_10198487 | Ga0157376_101984872 | 96 |
| 150 | 3300025272 | Ga0209455_1004709 | Ga0209455_10047093 | 96 |
| 151 | 3300025907 | Ga0207645_10000576 | Ga0207645_1000057610 | 96 |
| 152 | 3300025911 | Ga0207654_10025779 | Ga0207654_100257793 | 96 |
| 153 | 3300025911 | Ga0207654_11073973 | Ga0207654_110739731 | 96 |
| 154 | 3300025913 | Ga0207695_10000055 | Ga0207695_10000055208 | 96 |
| 155 | 3300025913 | Ga0207695_10123704 | Ga0207695_101237041 | 96 |
| 156 | 3300025913 | Ga0207695_10627708 | Ga0207695_106277082 | 96 |
| 157 | 3300025914 | Ga0207671_10002743 | Ga0207671_100027432 | 96 |
| 158 | 3300025914 | Ga0207671_10191083 | Ga0207671_101910831 | 96 |
| 159 | 3300025914 | Ga0207671_10253908 | Ga0207671_102539082 | 96 |
| 160 | 3300025926 | Ga0207659_10867243 | Ga0207659_108672432 | 96 |
| 161 | 3300025934 | Ga0207686_11067734 | Ga0207686_110677341 | 96 |
| 162 | 3300025937 | Ga0207669_10329595 | Ga0207669_103295952 | 96 |
| 163 | 3300025938 | Ga0207704_10009471 | Ga0207704_100094711 | 96 |
| 164 | 3300025940 | Ga0207691_10454949 | Ga0207691_104549491 | 96 |
| 165 | 3300025942 | Ga0207689_10959169 | Ga0207689_109591692 | 96 |
| 166 | 3300025949 | Ga0207667_10005820 | Ga0207667_100058207 | 96 |
| 167 | 3300025949 | Ga0207667_10780800 | Ga0207667_107808002 | 96 |
| 168 | 3300026023 | Ga0207677_10004718 | Ga0207677_100047183 | 96 |
| 169 | 3300026041 | Ga0207639_10046764 | Ga0207639_100467643 | 96 |
| 170 | 3300026041 | Ga0207639_10847114 | Ga0207639_108471141 | 96 |
| 171 | 3300026089 | Ga0207648_10000331 | Ga0207648_100003314 | 96 |
| 172 | 3300026121 | Ga0207683_10177722 | Ga0207683_101777222 | 96 |
| 173 | 3300028379 | Ga0268266_10711899 | Ga0268266_107118992 | 96 |
| 174 | 3300031507 | Ga0307509_10927090 | Ga0307509_109270902 | 96 |
| 175 | 3300042005 | Ga0439448_0018095 | Ga0439448_0018095_1312_1602 | 96 |
| 176 | 3300046462 | Ga0495651_0224262 | Ga0495651_0224262_580_870 | 96 |
| 177 | 3300046511 | Ga0495608_0421046 | Ga0495608_0421046_299_589 | 96 |
| 178 | 3300046529 | Ga0495652_0686220 | Ga0495652_0686220_146_436 | 96 |
| 179 | 3300046538 | Ga0495609_0069141 | Ga0495609_0069141_565_855 | 96 |
| 180 | 3300050493 | nmdc:mga0k408_594666_c1 | nmdc:mga0k408_594666_c1_218_508 | 96 |
| 181 | 3300005336 | Ga0070680_100143008 | Ga0070680_1001430082 | 97 |
| 182 | 3300005458 | Ga0070681_10224061 | Ga0070681_102240614 | 97 |
| 183 | 3300005530 | Ga0070679_100037920 | Ga0070679_1000379203 | 97 |
| 184 | 3300013307 | Ga0157372_12351619 | Ga0157372_123516191 | 97 |
| 185 | 3300025912 | Ga0207707_10290502 | Ga0207707_102905022 | 97 |
| 186 | 3300025917 | Ga0207660_10119736 | Ga0207660_101197364 | 97 |
| 187 | 3300025921 | Ga0207652_10002572 | Ga0207652_1000257210 | 97 |
| 188 | 3300001904 | JGI24736J21556_1003104 | JGI24736J21556_10031043 | 98 |
| 189 | 3300001904 | JGI24736J21556_1035201 | JGI24736J21556_10352011 | 98 |
| 190 | 3300001979 | JGI24740J21852_10026161 | JGI24740J21852_100261612 | 98 |
| 191 | 3300001990 | JGI24737J22298_10024046 | JGI24737J22298_100240463 | 98 |
| 192 | 3300002067 | JGI24735J21928_10059931 | JGI24735J21928_100599312 | 98 |
| 193 | 3300002067 | JGI24735J21928_10230254 | JGI24735J21928_102302542 | 98 |
| 194 | 3300003214 | JGI25165J46597_1010518 | JGI25165J46597_10105182 | 98 |
| 195 | 3300005327 | Ga0070658_10249250 | Ga0070658_102492501 | 98 |
| 196 | 3300005327 | Ga0070658_10689848 | Ga0070658_106898482 | 98 |
| 197 | 3300005366 | Ga0070659_100074059 | Ga0070659_1000740593 | 98 |
| 198 | 3300005366 | Ga0070659_100218251 | Ga0070659_1002182512 | 98 |
| 199 | 3300005366 | Ga0070659_100872522 | Ga0070659_1008725221 | 98 |
| 200 | 3300005457 | Ga0070662_100000155 | Ga0070662_10000015510 | 98 |
| 201 | 3300005457 | Ga0070662_100108754 | Ga0070662_1001087542 | 98 |
| 202 | 3300005539 | Ga0068853_100072244 | Ga0068853_1000722442 | 98 |
| 203 | 3300005548 | Ga0070665_102047874 | Ga0070665_1020478742 | 98 |
| 204 | 3300005563 | Ga0068855_100430072 | Ga0068855_1004300723 | 98 |
| 205 | 3300005577 | Ga0068857_100034820 | Ga0068857_1000348204 | 98 |
| 206 | 3300005614 | Ga0068856_100001310 | Ga0068856_10000131026 | 98 |
| 207 | 3300005614 | Ga0068856_100377710 | Ga0068856_1003777102 | 98 |
| 208 | 3300006237 | Ga0097621_101015650 | Ga0097621_1010156502 | 98 |
| 209 | 3300009098 | Ga0105245_12508375 | Ga0105245_125083751 | 98 |
| 210 | 3300009174 | Ga0105241_10000327 | Ga0105241_100003278 | 98 |
| 211 | 3300009174 | Ga0105241_11394636 | Ga0105241_113946362 | 98 |
| 212 | 3300011119 | Ga0105246_10423557 | Ga0105246_104235572 | 98 |
| 213 | 3300013100 | Ga0157373_10036306 | Ga0157373_100363064 | 98 |
| 214 | 3300013100 | Ga0157373_10239120 | Ga0157373_102391201 | 98 |
| 215 | 3300013102 | Ga0157371_10000441 | Ga0157371_1000044142 | 98 |
| 216 | 3300013102 | Ga0157371_10294220 | Ga0157371_102942201 | 98 |
| 217 | 3300013104 | Ga0157370_10027549 | Ga0157370_100275494 | 98 |
| 218 | 3300013104 | Ga0157370_10082271 | Ga0157370_100822712 | 98 |
| 219 | 3300013105 | Ga0157369_10031135 | Ga0157369_100311353 | 98 |
| 220 | 3300013105 | Ga0157369_10634970 | Ga0157369_106349702 | 98 |
| 221 | 3300013105 | Ga0157369_12249535 | Ga0157369_122495351 | 98 |
| 222 | 3300013306 | Ga0163162_11383654 | Ga0163162_113836541 | 98 |
| 223 | 3300013307 | Ga0157372_10000262 | Ga0157372_1000026224 | 98 |
| 224 | 3300013307 | Ga0157372_10256002 | Ga0157372_102560024 | 98 |
| 225 | 3300021361 | Ga0213872_10018292 | Ga0213872_100182922 | 98 |
| 226 | 3300025231 | Ga0207427_113049 | Ga0207427_1130492 | 98 |
| 227 | 3300025261 | Ga0209233_1000815 | Ga0209233_10008156 | 98 |
| 228 | 3300025904 | Ga0207647_10000274 | Ga0207647_100002743 | 98 |
| 229 | 3300025904 | Ga0207647_10000367 | Ga0207647_1000036726 | 98 |
| 230 | 3300025909 | Ga0207705_10638443 | Ga0207705_106384432 | 98 |
| 231 | 3300025909 | Ga0207705_11037611 | Ga0207705_110376111 | 98 |
| 232 | 3300025911 | Ga0207654_11280395 | Ga0207654_112803952 | 98 |
| 233 | 3300025932 | Ga0207690_10098813 | Ga0207690_100988133 | 98 |
| 234 | 3300025932 | Ga0207690_10174358 | Ga0207690_101743582 | 98 |
| 235 | 3300025933 | Ga0207706_10000036 | Ga0207706_10000036102 | 98 |
| 236 | 3300025933 | Ga0207706_10051099 | Ga0207706_100510994 | 98 |
| 237 | 3300025949 | Ga0207667_10342710 | Ga0207667_103427103 | 98 |
| 238 | 3300025949 | Ga0207667_10516102 | Ga0207667_105161022 | 98 |
| 239 | 3300026041 | Ga0207639_10053200 | Ga0207639_100532003 | 98 |
| 240 | 3300026041 | Ga0207639_10900974 | Ga0207639_109009742 | 98 |
| 241 | 3300026078 | Ga0207702_10000463 | Ga0207702_100004635 | 98 |
| 242 | 3300026116 | Ga0207674_10075590 | Ga0207674_100755902 | 98 |
| 243 | 3300037312 | Ga0395899_0367225 | Ga0395899_0367225_613_918 | 98 |
| 244 | 3300037418 | Ga0395900_0000140 | Ga0395900_0000140_4246_4554 | 98 |
| 245 | 3300037418 | Ga0395900_0190772 | Ga0395900_0190772_1433_1729 | 98 |
| 246 | 3300037466 | Ga0395898_0599029 | Ga0395898_0599029_314_610 | 98 |
| 247 | 3300037471 | Ga0395905_0815240 | Ga0395905_0815240_151_447 | 98 |
| 248 | 3300038443 | Ga0395901_0057313 | Ga0395901_0057313_1810_2106 | 98 |
| 249 | 3300039447 | Ga0436361_0499494 | Ga0436361_0499494_5373_5669 | 98 |
| 250 | 3300047443 | Ga0495687_003170 | Ga0495687_003170_11643_11945 | 98 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6eou-assembly1.cif.gz_A | o-glcnac transferase tpr domain with the intellectual disability associated mutation l254f | 0.8926 | 22 | 74 |
| 4xi0-assembly1.cif.gz_E | mama 41-end from desulfovibrio magneticus rs-1 | 0.8577 | 22 | 75 |
| 3asd-assembly1.cif.gz_A | mama r50e mutant | 0.8418 | 22 | 75 |
| 3as4-assembly1.cif.gz_A | mama amb-1 c2221 | 0.8391 | 22 | 75 |
| 6q6h-assembly1.cif.gz_K | cryo-em structure of the apc/c-cdc20-cdk2-cyclina2-cks2 complex, the d2 box class | 0.8226 | 22 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LT60_9_519_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8804 | 22 | 74 | 1.25.40.10 |
| af_Q54D26_1237_1387_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8472 | 22 | 74 | 1.25.40.10 |
| af_Q54D26_896_1068_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8371 | 22 | 75 | 1.25.40.10 |
| af_A0A2R8QHY0_618_785_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.7865 | 22 | 75 | 1.25.40.10 |
| af_Q58823_270_341_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.7651 | 21 | 85 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8VYQ3-F1-model_v4 | Uncharacterized protein | 1.007 | 1 | 96 |
|
| AF-A0A223NYQ0-F1-model_v4 | Uncharacterized protein | 1.003 | 1 | 94 |
|
| AF-A0A1H7JL40-F1-model_v4 | Uncharacterized protein | 1.003 | 3 | 94 |
|
| AF-A0A246AGU3-F1-model_v4 | Uncharacterized protein | 1.002 | 3 | 94 |
|
| AF-A0A1H7QKR6-F1-model_v4 | Uncharacterized protein | 1.001 | 3 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar