F361436

General Info

Members Datasets Scaffolds Average Seq Length
250 141 246 98

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10104982|Ga0068866_101049822
Length 112
Sequence MVFVFLGRSLSVKKITPMKTVAEFKESLNSEQPIKGLSVQLKSLWYDGKGDWHQAHAQVDHLNDKESAWVHAYLHRKEGDIWNADYWYSKAQQIRPNISLEEEWEQLVLQFL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
3 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
4 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.6
Nodule 0
Rhizoplane 0.4
Rhizosphere 86.4
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003104 3300001904 Bacteria 2896
2 JGI24736J21556_1035201 3300001904 Bacteria 772
3 JGI24740J21852_10026161 3300001979 Bacteria 1957
4 JGI24739J22299_10249771 3300001989 Bacteria 520
5 JGI24737J22298_10000262 3300001990 Bacteria 17291
6 JGI24737J22298_10024046 3300001990 Bacteria 1930
7 JGI24735J21928_10000002 3300002067 Bacteria 624895
8 JGI24735J21928_10059931 3300002067 Bacteria 1094
9 JGI24735J21928_10230254 3300002067 Bacteria 539
10 JGI25162J39368_1000919 3300002737 Bacteria 18926
11 JGI25152J39213_1000596 3300002773 Bacteria 19416
12 JGI25150J39212_1000001 3300002774 Bacteria 1318726
13 JGI25151J46595_10000001 3300003187 Bacteria 887211
14 JGI25165J46597_1010518 3300003214 Bacteria 1347
15 JGI25153J46596_10000001 3300003215 Bacteria 748985
16 rootH2_10057887 3300003320 Bacteria 3629
17 rootH1_10091382 3300003323 Bacteria 3325
18 rootH1_10108212 3300003323 Bacteria 1223
19 rootH1_10303573 3300003323 Bacteria 1894
20 Ga0055529_1030429 3300003763 Bacteria 662
21 Ga0065714_10008144 3300005288 Bacteria 2966
22 Ga0070658_10249250 3300005327 Bacteria 1506
23 Ga0070658_10467066 3300005327 Bacteria 1088
24 Ga0070658_10689848 3300005327 Bacteria 886
25 Ga0068869_101236039 3300005334 Bacteria 657
26 Ga0070680_100143008 3300005336 Bacteria 2006
27 Ga0068868_100006643 3300005338 Bacteria 8204
28 Ga0070660_100017163 3300005339 Bacteria 5272
29 Ga0070660_100144143 3300005339 Bacteria 1912
30 Ga0070660_101758151 3300005339 Bacteria 528
31 Ga0070675_100608407 3300005354 Bacteria 991
32 Ga0070674_100096101 3300005356 Bacteria 2149
33 Ga0070659_100074059 3300005366 Bacteria 2712
34 Ga0070659_100218251 3300005366 Bacteria 1573
35 Ga0070659_100236294 3300005366 Bacteria 1511
36 Ga0070659_100872522 3300005366 Bacteria 785
37 Ga0070678_100003450 3300005456 Bacteria 8816
38 Ga0070662_100000155 3300005457 Bacteria 39426
39 Ga0070662_100108754 3300005457 Bacteria 2109
40 Ga0070681_10224061 3300005458 Bacteria 1795
41 Ga0068867_100000368 3300005459 Bacteria 30054
42 Ga0070679_100037920 3300005530 Bacteria 4789
43 Ga0070679_100380731 3300005530 Bacteria 1358
44 Ga0068853_100042033 3300005539 Bacteria 3907
45 Ga0068853_100072244 3300005539 Unclassified 3006
46 Ga0068853_100081157 3300005539 Bacteria 2839
47 Ga0068853_100601662 3300005539 Bacteria 1044
48 Ga0070672_100093049 3300005543 Bacteria 2435
49 Ga0070665_100726601 3300005548 Bacteria 1006
50 Ga0070665_102047874 3300005548 Unclassified 577
51 Ga0068855_100000199 3300005563 Bacteria 77676
52 Ga0068855_100005349 3300005563 Bacteria 15659
53 Ga0068855_100224357 3300005563 Bacteria 2106
54 Ga0068855_100430072 3300005563 Bacteria 1443
55 Ga0068855_102101694 3300005563 Bacteria 569
56 Ga0068857_100034820 3300005577 Bacteria 4455
57 Ga0068857_100824315 3300005577 Bacteria 887
58 Ga0068856_100001310 3300005614 Bacteria 26199
59 Ga0068856_100377710 3300005614 Bacteria 1436
60 Ga0068852_100001179 3300005616 Bacteria 17313
61 Ga0068852_102424099 3300005616 Bacteria 545
62 Ga0068866_10104982 3300005718 Bacteria 1566
63 Ga0068858_102081403 3300005842 Bacteria 561
64 Ga0075366_10048732 3300006195 Bacteria 2513
65 Ga0075366_10597907 3300006195 Bacteria 684
66 Ga0097621_100000780 3300006237 Bacteria 22337
67 Ga0097621_101015650 3300006237 Bacteria 776
68 Ga0068871_100000296 3300006358 Bacteria 34815
69 Ga0068865_100000025 3300006881 Bacteria 94590
70 Ga0105251_10357565 3300009011 Bacteria 667
71 Ga0105240_10017109 3300009093 Bacteria 9789
72 Ga0105240_10065352 3300009093 Bacteria 4516
73 Ga0105240_10142772 3300009093 Bacteria 2861
74 Ga0105240_10323587 3300009093 Bacteria 1757
75 Ga0105240_10629420 3300009093 Bacteria 1178
76 Ga0105245_12508375 3300009098 Bacteria 569
77 Ga0105241_10000327 3300009174 Bacteria 35944
78 Ga0105241_10020411 3300009174 Bacteria 4895
79 Ga0105241_10065364 3300009174 Bacteria 2811
80 Ga0105241_10121744 3300009174 Bacteria 2102
81 Ga0105241_11394636 3300009174 Bacteria 671
82 Ga0105242_10353278 3300009176 Bacteria 1358
83 Ga0105242_10381836 3300009176 Bacteria 1310
84 Ga0105237_10002672 3300009545 Bacteria 21880
85 Ga0105237_10018071 3300009545 Bacteria 7303
86 Ga0105237_10052910 3300009545 Bacteria 4074
87 Ga0105237_11198961 3300009545 Bacteria 766
88 Ga0105238_10006366 3300009551 Bacteria 11742
89 Ga0105239_10000530 3300010375 Bacteria 55219
90 Ga0105239_10012237 3300010375 Bacteria 9560
91 Ga0105239_10057691 3300010375 Bacteria 4259
92 Ga0105239_10341015 3300010375 Bacteria 1691
93 Ga0105239_13034041 3300010375 Bacteria 547
94 Ga0105246_10423557 3300011119 Bacteria 1112
95 Ga0105246_10609088 3300011119 Bacteria 945
96 Ga0105246_11629583 3300011119 Bacteria 611
97 Ga0157373_10009595 3300013100 Bacteria 7144
98 Ga0157373_10036306 3300013100 Bacteria 3538
99 Ga0157373_10102237 3300013100 Bacteria 2016
100 Ga0157373_10239120 3300013100 Bacteria 1283
101 Ga0157371_10000441 3300013102 Bacteria 50801
102 Ga0157371_10015106 3300013102 Bacteria 5803
103 Ga0157371_10210345 3300013102 Bacteria 1396
104 Ga0157371_10294220 3300013102 Bacteria 1174
105 Ga0157370_10027549 3300013104 Bacteria 5603
106 Ga0157370_10030710 3300013104 Bacteria 5263
107 Ga0157370_10082271 3300013104 Bacteria 3028
108 Ga0157370_11473619 3300013104 Bacteria 612
109 Ga0157369_10031135 3300013105 Bacteria 5879
110 Ga0157369_10634970 3300013105 Bacteria 1102
111 Ga0157369_12249535 3300013105 Bacteria 553
112 Ga0157374_10003573 3300013296 Bacteria 13089
113 Ga0157378_10017873 3300013297 Bacteria 6223
114 Ga0157378_10019492 3300013297 Bacteria 5964
115 Ga0157378_10229674 3300013297 Bacteria 1768
116 Ga0163162_10001218 3300013306 Bacteria 24051
117 Ga0163162_11383654 3300013306 Bacteria 800
118 Ga0157372_10000262 3300013307 Bacteria 58244
119 Ga0157372_10007243 3300013307 Bacteria 11816
120 Ga0157372_10256002 3300013307 Bacteria 2032
121 Ga0157372_10261851 3300013307 Unclassified 2008
122 Ga0157372_12351619 3300013307 Bacteria 612
123 Ga0157375_10002837 3300013308 Bacteria 15004
124 Ga0157375_10441773 3300013308 Bacteria 1467
125 Ga0157376_10198487 3300014969 Bacteria 1844
126 Ga0163161_10000120 3300017792 Bacteria 73632
127 Ga0213872_10018292 3300021361 Bacteria 3232
128 Ga0207427_113049 3300025231 Bacteria 821
129 Ga0209437_100169 3300025233 Bacteria 142584
130 Ga0207425_1000002 3300025245 Bacteria 1362590
131 Ga0209129_1000002 3300025258 Bacteria 1359086
132 Ga0209129_1006996 3300025258 Bacteria 3476
133 Ga0209233_1000815 3300025261 Bacteria 13892
134 Ga0209455_1004709 3300025272 Bacteria 4388
135 Ga0209025_1000004 3300025294 Bacteria 1361782
136 Ga0209758_1000006 3300025297 Bacteria 1359562
137 Ga0207647_10000274 3300025904 Bacteria 41963
138 Ga0207647_10000367 3300025904 Bacteria 36727
139 Ga0207647_10158225 3300025904 Bacteria 1322
140 Ga0207645_10000576 3300025907 Bacteria 30417
141 Ga0207705_10638443 3300025909 Bacteria 828
142 Ga0207705_10672650 3300025909 Bacteria 805
143 Ga0207705_11037611 3300025909 Bacteria 633
144 Ga0207654_10025779 3300025911 Bacteria 3176
145 Ga0207654_11073973 3300025911 Bacteria 586
146 Ga0207654_11280395 3300025911 Bacteria 534
147 Ga0207707_10290502 3300025912 Bacteria 1414
148 Ga0207695_10000055 3300025913 Bacteria 382776
149 Ga0207695_10103353 3300025913 Bacteria 2840
150 Ga0207695_10123704 3300025913 Bacteria 2552
151 Ga0207695_10627708 3300025913 Bacteria 956
152 Ga0207671_10002743 3300025914 Bacteria 18404
153 Ga0207671_10191083 3300025914 Bacteria 1597
154 Ga0207671_10253908 3300025914 Bacteria 1382
155 Ga0207660_10119736 3300025917 Bacteria 1992
156 Ga0207657_10033830 3300025919 Bacteria 4603
157 Ga0207657_10053674 3300025919 Bacteria 3490
158 Ga0207652_10002572 3300025921 Bacteria 15232
159 Ga0207659_10867243 3300025926 Bacteria 776
160 Ga0207690_10098813 3300025932 Bacteria 2080
161 Ga0207690_10174358 3300025932 Bacteria 1614
162 Ga0207690_10177078 3300025932 Bacteria 1603
163 Ga0207706_10000036 3300025933 Bacteria 134302
164 Ga0207706_10051099 3300025933 Bacteria 3651
165 Ga0207686_10682825 3300025934 Bacteria 815
166 Ga0207686_11067734 3300025934 Bacteria 657
167 Ga0207669_10329595 3300025937 Bacteria 1171
168 Ga0207704_10009471 3300025938 Bacteria 4701
169 Ga0207691_10454949 3300025940 Bacteria 1089
170 Ga0207689_10959169 3300025942 Bacteria 722
171 Ga0207667_10005820 3300025949 Bacteria 15028
172 Ga0207667_10111593 3300025949 Bacteria 2820
173 Ga0207667_10229172 3300025949 Bacteria 1903
174 Ga0207667_10342710 3300025949 Bacteria 1525
175 Ga0207667_10516102 3300025949 Bacteria 1211
176 Ga0207667_10780800 3300025949 Bacteria 953
177 Ga0207677_10004718 3300026023 Bacteria 7343
178 Ga0207639_10046764 3300026041 Bacteria 3267
179 Ga0207639_10049126 3300026041 Bacteria 3197
180 Ga0207639_10053200 3300026041 Bacteria 3088
181 Ga0207639_10341035 3300026041 Bacteria 1336
182 Ga0207639_10847114 3300026041 Bacteria 853
183 Ga0207639_10900974 3300026041 Bacteria 827
184 Ga0207702_10000463 3300026078 Bacteria 45983
185 Ga0207648_10000331 3300026089 Bacteria 51769
186 Ga0207674_10075590 3300026116 Bacteria 3378
187 Ga0207674_10095038 3300026116 Bacteria 2967
188 Ga0207683_10177722 3300026121 Bacteria 1929
189 Ga0207698_12099628 3300026142 Bacteria 579
190 Ga0268266_10711899 3300028379 Bacteria 968
191 Ga0307509_10927090 3300031507 Bacteria 536
192 Ga0307412_10036189 3300031911 Bacteria 3160
193 Ga0307412_11100716 3300031911 Bacteria 707
194 Ga0307510_10045506 3300033180 Bacteria 4736
195 Ga0395899_0004577 3300037312 Bacteria 10779
196 Ga0395899_0367225 3300037312 Bacteria 959
197 Ga0395900_0000140 3300037418 Bacteria 121917
198 Ga0395900_0034738 3300037418 Bacteria 5193
199 Ga0395900_0190772 3300037418 Bacteria 2079
200 Ga0395898_0082956 3300037466 Bacteria 3089
201 Ga0395898_0599029 3300037466 Bacteria 1045
202 Ga0395905_0815240 3300037471 Bacteria 836
203 Ga0395901_0001623 3300038443 Bacteria 23267
204 Ga0395901_0057313 3300038443 Bacteria 4052
205 Ga0436361_0499494 3300039447 Bacteria 12745
206 Ga0451849_0821085 3300041505 Bacteria 1040
207 Ga0439448_0018095 3300042005 Bacteria 2156
208 Ga0495638_0267244 3300046460 Bacteria 935
209 Ga0495651_0224262 3300046462 Bacteria 1299
210 Ga0495650_0000330 3300046471 Bacteria 84849
211 Ga0495585_0000201 3300046492 Bacteria 62206
212 Ga0495583_0007429 3300046506 Bacteria 6888
213 Ga0495606_0000036 3300046507 Bacteria 234596
214 Ga0495606_0204574 3300046507 Bacteria 1123
215 Ga0495606_0244398 3300046507 Bacteria 999
216 Ga0495608_0421046 3300046511 Bacteria 815
217 Ga0495610_0001404 3300046512 Bacteria 21399
218 Ga0495610_0032696 3300046512 Bacteria 2699
219 Ga0495616_0001583 3300046513 Bacteria 15619
220 Ga0495632_0372194 3300046519 Bacteria 626
221 Ga0495637_0024874 3300046520 Bacteria 2706
222 Ga0495637_0270207 3300046520 Bacteria 608
223 Ga0495652_0686220 3300046529 Bacteria 690
224 Ga0495609_0069141 3300046538 Bacteria 1553
225 Ga0495609_0254016 3300046538 Bacteria 723
226 Ga0495633_0002507 3300046558 Bacteria 12917
227 Ga0495625_0000007 3300046660 Bacteria 565749
228 Ga0495661_0011994 3300046665 Bacteria 5866
229 Ga0495661_0043928 3300046665 Bacteria 2743
230 Ga0495669_0071426 3300046684 Bacteria 1583
231 Ga0495671_0027024 3300046692 Bacteria 2968
232 Ga0495649_0000038 3300046694 Bacteria 128764
233 Ga0495589_0169238 3300046794 Bacteria 1039
234 Ga0495683_0047966 3300047323 Bacteria 2142
235 Ga0495687_003170 3300047443 Bacteria 12241
236 Ga0495679_067516 3300047446 Bacteria 1036
237 Ga0495673_0015983 3300047469 Bacteria 3849
238 Ga0495686_0000524 3300047472 Bacteria 55256
239 Ga0495686_0043187 3300047472 Bacteria 2860
240 Ga0495686_0205050 3300047472 Bacteria 1129
241 nmdc:mga0k408_44613_c1 3300050493 Bacteria 2557
242 nmdc:mga0k408_594666_c1 3300050493 Bacteria 653
243 Ga0500647_0198268 3300053091 Bacteria 912
244 Ga0500608_002264 3300053122 Bacteria 6956
245 Ga0500608_025177 3300053122 Bacteria 2783
246 Ga0500568_0232110 3300053139 Bacteria 673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2599185184 2599478785 91
2 iso_pu_bacteria 2928078545 2928080156 91
3 iso_pu_bacteria 2928147474 2928149671 91
4 iso_pu_bacteria 2932082852 2932083498 91
5 3300009093 Ga0105240_10142772 Ga0105240_101427724 93
6 3300025913 Ga0207695_10103353 Ga0207695_101033534 93
7 3300005327 Ga0070658_10467066 Ga0070658_104670662 94
8 3300005339 Ga0070660_100144143 Ga0070660_1001441432 94
9 3300005366 Ga0070659_100236294 Ga0070659_1002362942 94
10 3300005530 Ga0070679_100380731 Ga0070679_1003807313 94
11 3300005563 Ga0068855_100005349 Ga0068855_1000053493 94
12 3300013102 Ga0157371_10015106 Ga0157371_100151064 94
13 3300013104 Ga0157370_10030710 Ga0157370_100307104 94
14 3300013307 Ga0157372_10261851 Ga0157372_102618512 94
15 3300025909 Ga0207705_10672650 Ga0207705_106726502 94
16 3300025919 Ga0207657_10033830 Ga0207657_100338303 94
17 3300025932 Ga0207690_10177078 Ga0207690_101770782 94
18 3300025949 Ga0207667_10111593 Ga0207667_101115933 94
19 3300031911 Ga0307412_11100716 Ga0307412_111007162 94
20 3300037312 Ga0395899_0004577 Ga0395899_0004577_3976_4260 94
21 3300037418 Ga0395900_0034738 Ga0395900_0034738_3976_4260 94
22 3300037466 Ga0395898_0082956 Ga0395898_0082956_700_984 94
23 3300038443 Ga0395901_0001623 Ga0395901_0001623_10324_10608 94
24 3300046507 Ga0495606_0244398 Ga0495606_0244398_454_738 94
25 3300001990 JGI24737J22298_10000262 JGI24737J22298_100002624 95
26 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002153 95
27 3300002737 JGI25162J39368_1000919 JGI25162J39368_10009194 95
28 3300002773 JGI25152J39213_1000596 JGI25152J39213_10005963 95
29 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001537 95
30 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001266 95
31 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001155 95
32 3300003320 rootH2_10057887 rootH2_100578872 95
33 3300003323 rootH1_10108212 rootH1_101082122 95
34 3300003323 rootH1_10303573 rootH1_103035732 95
35 3300005288 Ga0065714_10008144 Ga0065714_100081444 95
36 3300005339 Ga0070660_100017163 Ga0070660_1000171637 95
37 3300005339 Ga0070660_101758151 Ga0070660_1017581511 95
38 3300005539 Ga0068853_100081157 Ga0068853_1000811572 95
39 3300005563 Ga0068855_102101694 Ga0068855_1021016941 95
40 3300005577 Ga0068857_100824315 Ga0068857_1008243152 95
41 3300005616 Ga0068852_102424099 Ga0068852_1024240991 95
42 3300005718 Ga0068866_10104982 Ga0068866_101049822 95
43 3300006195 Ga0075366_10048732 Ga0075366_100487322 95
44 3300009011 Ga0105251_10357565 Ga0105251_103575652 95
45 3300009093 Ga0105240_10629420 Ga0105240_106294202 95
46 3300009176 Ga0105242_10353278 Ga0105242_103532781 95
47 3300009545 Ga0105237_11198961 Ga0105237_111989611 95
48 3300010375 Ga0105239_10000530 Ga0105239_100005302 95
49 3300010375 Ga0105239_10012237 Ga0105239_100122374 95
50 3300010375 Ga0105239_10341015 Ga0105239_103410152 95
51 3300010375 Ga0105239_13034041 Ga0105239_130340411 95
52 3300011119 Ga0105246_10609088 Ga0105246_106090881 95
53 3300011119 Ga0105246_11629583 Ga0105246_116295832 95
54 3300013100 Ga0157373_10009595 Ga0157373_100095954 95
55 3300013102 Ga0157371_10210345 Ga0157371_102103451 95
56 3300013104 Ga0157370_11473619 Ga0157370_114736191 95
57 3300013297 Ga0157378_10019492 Ga0157378_100194922 95
58 3300013297 Ga0157378_10229674 Ga0157378_102296743 95
59 3300013306 Ga0163162_10001218 Ga0163162_1000121814 95
60 3300013307 Ga0157372_10007243 Ga0157372_1000724310 95
61 3300013308 Ga0157375_10002837 Ga0157375_100028376 95
62 3300013308 Ga0157375_10441773 Ga0157375_104417732 95
63 3300017792 Ga0163161_10000120 Ga0163161_1000012039 95
64 3300025233 Ga0209437_100169 Ga0209437_100169128 95
65 3300025245 Ga0207425_1000002 Ga0207425_1000002638 95
66 3300025258 Ga0209129_1000002 Ga0209129_1000002638 95
67 3300025258 Ga0209129_1006996 Ga0209129_10069964 95
68 3300025294 Ga0209025_1000004 Ga0209025_1000004553 95
69 3300025297 Ga0209758_1000006 Ga0209758_1000006553 95
70 3300025904 Ga0207647_10158225 Ga0207647_101582252 95
71 3300025919 Ga0207657_10053674 Ga0207657_100536745 95
72 3300025934 Ga0207686_10682825 Ga0207686_106828251 95
73 3300025949 Ga0207667_10229172 Ga0207667_102291722 95
74 3300026041 Ga0207639_10049126 Ga0207639_100491262 95
75 3300026041 Ga0207639_10341035 Ga0207639_103410352 95
76 3300026116 Ga0207674_10095038 Ga0207674_100950381 95
77 3300026142 Ga0207698_12099628 Ga0207698_120996281 95
78 3300031911 Ga0307412_10036189 Ga0307412_100361893 95
79 3300033180 Ga0307510_10045506 Ga0307510_100455065 95
80 3300041505 Ga0451849_0821085 Ga0451849_0821085_169_456 95
81 3300046460 Ga0495638_0267244 Ga0495638_0267244_49_336 95
82 3300046471 Ga0495650_0000330 Ga0495650_0000330_15840_16127 95
83 3300046492 Ga0495585_0000201 Ga0495585_0000201_43265_43552 95
84 3300046506 Ga0495583_0007429 Ga0495583_0007429_3519_3806 95
85 3300046507 Ga0495606_0000036 Ga0495606_0000036_191179_191466 95
86 3300046507 Ga0495606_0204574 Ga0495606_0204574_199_486 95
87 3300046512 Ga0495610_0001404 Ga0495610_0001404_13386_13673 95
88 3300046512 Ga0495610_0032696 Ga0495610_0032696_1037_1324 95
89 3300046513 Ga0495616_0001583 Ga0495616_0001583_2441_2728 95
90 3300046519 Ga0495632_0372194 Ga0495632_0372194_36_323 95
91 3300046520 Ga0495637_0024874 Ga0495637_0024874_43_330 95
92 3300046520 Ga0495637_0270207 Ga0495637_0270207_223_510 95
93 3300046538 Ga0495609_0254016 Ga0495609_0254016_75_362 95
94 3300046558 Ga0495633_0002507 Ga0495633_0002507_5687_5974 95
95 3300046660 Ga0495625_0000007 Ga0495625_0000007_525943_526230 95
96 3300046665 Ga0495661_0011994 Ga0495661_0011994_2315_2602 95
97 3300046665 Ga0495661_0043928 Ga0495661_0043928_1712_1999 95
98 3300046684 Ga0495669_0071426 Ga0495669_0071426_1089_1427 95
99 3300046692 Ga0495671_0027024 Ga0495671_0027024_699_986 95
100 3300046694 Ga0495649_0000038 Ga0495649_0000038_39568_39855 95
101 3300046794 Ga0495589_0169238 Ga0495589_0169238_117_404 95
102 3300047323 Ga0495683_0047966 Ga0495683_0047966_221_508 95
103 3300047446 Ga0495679_067516 Ga0495679_067516_628_915 95
104 3300047469 Ga0495673_0015983 Ga0495673_0015983_1170_1457 95
105 3300047472 Ga0495686_0000524 Ga0495686_0000524_8423_8710 95
106 3300047472 Ga0495686_0043187 Ga0495686_0043187_1216_1503 95
107 3300047472 Ga0495686_0205050 Ga0495686_0205050_329_616 95
108 3300050493 nmdc:mga0k408_44613_c1 nmdc:mga0k408_44613_c1_1886_2173 95
109 3300053091 Ga0500647_0198268 Ga0500647_0198268_143_430 95
110 3300053122 Ga0500608_002264 Ga0500608_002264_4603_4890 95
111 3300053122 Ga0500608_025177 Ga0500608_025177_2427_2714 95
112 3300053139 Ga0500568_0232110 Ga0500568_0232110_266_553 95
113 3300001989 JGI24739J22299_10249771 JGI24739J22299_102497711 96
114 3300003323 rootH1_10091382 rootH1_100913822 96
115 3300003763 Ga0055529_1030429 Ga0055529_10304291 96
116 3300005334 Ga0068869_101236039 Ga0068869_1012360392 96
117 3300005338 Ga0068868_100006643 Ga0068868_1000066434 96
118 3300005354 Ga0070675_100608407 Ga0070675_1006084072 96
119 3300005356 Ga0070674_100096101 Ga0070674_1000961012 96
120 3300005456 Ga0070678_100003450 Ga0070678_1000034502 96
121 3300005459 Ga0068867_100000368 Ga0068867_10000036813 96
122 3300005539 Ga0068853_100042033 Ga0068853_1000420333 96
123 3300005539 Ga0068853_100601662 Ga0068853_1006016621 96
124 3300005543 Ga0070672_100093049 Ga0070672_1000930491 96
125 3300005548 Ga0070665_100726601 Ga0070665_1007266011 96
126 3300005563 Ga0068855_100000199 Ga0068855_10000019963 96
127 3300005563 Ga0068855_100224357 Ga0068855_1002243573 96
128 3300005616 Ga0068852_100001179 Ga0068852_1000011795 96
129 3300005842 Ga0068858_102081403 Ga0068858_1020814031 96
130 3300006195 Ga0075366_10597907 Ga0075366_105979072 96
131 3300006237 Ga0097621_100000780 Ga0097621_10000078024 96
132 3300006358 Ga0068871_100000296 Ga0068871_10000029613 96
133 3300006881 Ga0068865_100000025 Ga0068865_10000002563 96
134 3300009093 Ga0105240_10017109 Ga0105240_100171094 96
135 3300009093 Ga0105240_10065352 Ga0105240_100653527 96
136 3300009093 Ga0105240_10323587 Ga0105240_103235872 96
137 3300009174 Ga0105241_10020411 Ga0105241_100204114 96
138 3300009174 Ga0105241_10065364 Ga0105241_100653644 96
139 3300009174 Ga0105241_10121744 Ga0105241_101217443 96
140 3300009176 Ga0105242_10381836 Ga0105242_103818362 96
141 3300009545 Ga0105237_10002672 Ga0105237_1000267213 96
142 3300009545 Ga0105237_10018071 Ga0105237_1001807110 96
143 3300009545 Ga0105237_10052910 Ga0105237_100529103 96
144 3300009551 Ga0105238_10006366 Ga0105238_100063669 96
145 3300010375 Ga0105239_10057691 Ga0105239_100576915 96
146 3300013100 Ga0157373_10102237 Ga0157373_101022373 96
147 3300013296 Ga0157374_10003573 Ga0157374_100035732 96
148 3300013297 Ga0157378_10017873 Ga0157378_100178734 96
149 3300014969 Ga0157376_10198487 Ga0157376_101984872 96
150 3300025272 Ga0209455_1004709 Ga0209455_10047093 96
151 3300025907 Ga0207645_10000576 Ga0207645_1000057610 96
152 3300025911 Ga0207654_10025779 Ga0207654_100257793 96
153 3300025911 Ga0207654_11073973 Ga0207654_110739731 96
154 3300025913 Ga0207695_10000055 Ga0207695_10000055208 96
155 3300025913 Ga0207695_10123704 Ga0207695_101237041 96
156 3300025913 Ga0207695_10627708 Ga0207695_106277082 96
157 3300025914 Ga0207671_10002743 Ga0207671_100027432 96
158 3300025914 Ga0207671_10191083 Ga0207671_101910831 96
159 3300025914 Ga0207671_10253908 Ga0207671_102539082 96
160 3300025926 Ga0207659_10867243 Ga0207659_108672432 96
161 3300025934 Ga0207686_11067734 Ga0207686_110677341 96
162 3300025937 Ga0207669_10329595 Ga0207669_103295952 96
163 3300025938 Ga0207704_10009471 Ga0207704_100094711 96
164 3300025940 Ga0207691_10454949 Ga0207691_104549491 96
165 3300025942 Ga0207689_10959169 Ga0207689_109591692 96
166 3300025949 Ga0207667_10005820 Ga0207667_100058207 96
167 3300025949 Ga0207667_10780800 Ga0207667_107808002 96
168 3300026023 Ga0207677_10004718 Ga0207677_100047183 96
169 3300026041 Ga0207639_10046764 Ga0207639_100467643 96
170 3300026041 Ga0207639_10847114 Ga0207639_108471141 96
171 3300026089 Ga0207648_10000331 Ga0207648_100003314 96
172 3300026121 Ga0207683_10177722 Ga0207683_101777222 96
173 3300028379 Ga0268266_10711899 Ga0268266_107118992 96
174 3300031507 Ga0307509_10927090 Ga0307509_109270902 96
175 3300042005 Ga0439448_0018095 Ga0439448_0018095_1312_1602 96
176 3300046462 Ga0495651_0224262 Ga0495651_0224262_580_870 96
177 3300046511 Ga0495608_0421046 Ga0495608_0421046_299_589 96
178 3300046529 Ga0495652_0686220 Ga0495652_0686220_146_436 96
179 3300046538 Ga0495609_0069141 Ga0495609_0069141_565_855 96
180 3300050493 nmdc:mga0k408_594666_c1 nmdc:mga0k408_594666_c1_218_508 96
181 3300005336 Ga0070680_100143008 Ga0070680_1001430082 97
182 3300005458 Ga0070681_10224061 Ga0070681_102240614 97
183 3300005530 Ga0070679_100037920 Ga0070679_1000379203 97
184 3300013307 Ga0157372_12351619 Ga0157372_123516191 97
185 3300025912 Ga0207707_10290502 Ga0207707_102905022 97
186 3300025917 Ga0207660_10119736 Ga0207660_101197364 97
187 3300025921 Ga0207652_10002572 Ga0207652_1000257210 97
188 3300001904 JGI24736J21556_1003104 JGI24736J21556_10031043 98
189 3300001904 JGI24736J21556_1035201 JGI24736J21556_10352011 98
190 3300001979 JGI24740J21852_10026161 JGI24740J21852_100261612 98
191 3300001990 JGI24737J22298_10024046 JGI24737J22298_100240463 98
192 3300002067 JGI24735J21928_10059931 JGI24735J21928_100599312 98
193 3300002067 JGI24735J21928_10230254 JGI24735J21928_102302542 98
194 3300003214 JGI25165J46597_1010518 JGI25165J46597_10105182 98
195 3300005327 Ga0070658_10249250 Ga0070658_102492501 98
196 3300005327 Ga0070658_10689848 Ga0070658_106898482 98
197 3300005366 Ga0070659_100074059 Ga0070659_1000740593 98
198 3300005366 Ga0070659_100218251 Ga0070659_1002182512 98
199 3300005366 Ga0070659_100872522 Ga0070659_1008725221 98
200 3300005457 Ga0070662_100000155 Ga0070662_10000015510 98
201 3300005457 Ga0070662_100108754 Ga0070662_1001087542 98
202 3300005539 Ga0068853_100072244 Ga0068853_1000722442 98
203 3300005548 Ga0070665_102047874 Ga0070665_1020478742 98
204 3300005563 Ga0068855_100430072 Ga0068855_1004300723 98
205 3300005577 Ga0068857_100034820 Ga0068857_1000348204 98
206 3300005614 Ga0068856_100001310 Ga0068856_10000131026 98
207 3300005614 Ga0068856_100377710 Ga0068856_1003777102 98
208 3300006237 Ga0097621_101015650 Ga0097621_1010156502 98
209 3300009098 Ga0105245_12508375 Ga0105245_125083751 98
210 3300009174 Ga0105241_10000327 Ga0105241_100003278 98
211 3300009174 Ga0105241_11394636 Ga0105241_113946362 98
212 3300011119 Ga0105246_10423557 Ga0105246_104235572 98
213 3300013100 Ga0157373_10036306 Ga0157373_100363064 98
214 3300013100 Ga0157373_10239120 Ga0157373_102391201 98
215 3300013102 Ga0157371_10000441 Ga0157371_1000044142 98
216 3300013102 Ga0157371_10294220 Ga0157371_102942201 98
217 3300013104 Ga0157370_10027549 Ga0157370_100275494 98
218 3300013104 Ga0157370_10082271 Ga0157370_100822712 98
219 3300013105 Ga0157369_10031135 Ga0157369_100311353 98
220 3300013105 Ga0157369_10634970 Ga0157369_106349702 98
221 3300013105 Ga0157369_12249535 Ga0157369_122495351 98
222 3300013306 Ga0163162_11383654 Ga0163162_113836541 98
223 3300013307 Ga0157372_10000262 Ga0157372_1000026224 98
224 3300013307 Ga0157372_10256002 Ga0157372_102560024 98
225 3300021361 Ga0213872_10018292 Ga0213872_100182922 98
226 3300025231 Ga0207427_113049 Ga0207427_1130492 98
227 3300025261 Ga0209233_1000815 Ga0209233_10008156 98
228 3300025904 Ga0207647_10000274 Ga0207647_100002743 98
229 3300025904 Ga0207647_10000367 Ga0207647_1000036726 98
230 3300025909 Ga0207705_10638443 Ga0207705_106384432 98
231 3300025909 Ga0207705_11037611 Ga0207705_110376111 98
232 3300025911 Ga0207654_11280395 Ga0207654_112803952 98
233 3300025932 Ga0207690_10098813 Ga0207690_100988133 98
234 3300025932 Ga0207690_10174358 Ga0207690_101743582 98
235 3300025933 Ga0207706_10000036 Ga0207706_10000036102 98
236 3300025933 Ga0207706_10051099 Ga0207706_100510994 98
237 3300025949 Ga0207667_10342710 Ga0207667_103427103 98
238 3300025949 Ga0207667_10516102 Ga0207667_105161022 98
239 3300026041 Ga0207639_10053200 Ga0207639_100532003 98
240 3300026041 Ga0207639_10900974 Ga0207639_109009742 98
241 3300026078 Ga0207702_10000463 Ga0207702_100004635 98
242 3300026116 Ga0207674_10075590 Ga0207674_100755902 98
243 3300037312 Ga0395899_0367225 Ga0395899_0367225_613_918 98
244 3300037418 Ga0395900_0000140 Ga0395900_0000140_4246_4554 98
245 3300037418 Ga0395900_0190772 Ga0395900_0190772_1433_1729 98
246 3300037466 Ga0395898_0599029 Ga0395898_0599029_314_610 98
247 3300037471 Ga0395905_0815240 Ga0395905_0815240_151_447 98
248 3300038443 Ga0395901_0057313 Ga0395901_0057313_1810_2106 98
249 3300039447 Ga0436361_0499494 Ga0436361_0499494_5373_5669 98
250 3300047443 Ga0495687_003170 Ga0495687_003170_11643_11945 98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eou-assembly1.cif.gz_A o-glcnac transferase tpr domain with the intellectual disability associated mutation l254f 0.8926 22 74
4xi0-assembly1.cif.gz_E mama 41-end from desulfovibrio magneticus rs-1 0.8577 22 75
3asd-assembly1.cif.gz_A mama r50e mutant 0.8418 22 75
3as4-assembly1.cif.gz_A mama amb-1 c2221 0.8391 22 75
6q6h-assembly1.cif.gz_K cryo-em structure of the apc/c-cdc20-cdk2-cyclina2-cks2 complex, the d2 box class 0.8226 22 74
ID Description Score Start End Superfamily
af_I1LT60_9_519_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8804 22 74 1.25.40.10
af_Q54D26_1237_1387_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8472 22 74 1.25.40.10
af_Q54D26_896_1068_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8371 22 75 1.25.40.10
af_A0A2R8QHY0_618_785_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7865 22 75 1.25.40.10
af_Q58823_270_341_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7651 21 85 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1H8VYQ3-F1-model_v4 Uncharacterized protein 1.007 1 96
AF-A0A223NYQ0-F1-model_v4 Uncharacterized protein 1.003 1 94
AF-A0A1H7JL40-F1-model_v4 Uncharacterized protein 1.003 3 94
AF-A0A246AGU3-F1-model_v4 Uncharacterized protein 1.002 3 94
AF-A0A1H7QKR6-F1-model_v4 Uncharacterized protein 1.001 3 95

Feature Viewer

pLDDT pTM Quality
96.46 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map