F361422

General Info

Members Datasets Scaffolds Average Seq Length
250 180 240 284

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100017159|Ga0068855_1000171596
Length 328
Sequence MSAATQEVRFGETPKPALETSALPRNLPPCEHDWENRKLRSVMGKDISPEADKTAVRVALWRALHLEVDAPPYVLEDKVGLQLAAPEEGWRQRPDMDPQWTSIFRASVLARARFIEDLVIDRGNHQVGQYVILGAGLDTFAQRRPEIASRLTIFEIDQPRHQAWKKQRLVEIGYGIPDWLRLVPVDFEAGENWWQRLNASGFDSSKPAVVASTGVSMYLTKEANFSTLRQVAGLAPGSTFAMTFLLPLELADSEVRPGLEMAEKGARASGTPFLSFFTPDEMLTMAKQAGFKEVQHVPASILAARYFANRKDGFRPPNNGEELLVATT

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
4 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
5 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 8002784119 Frankia sp. AgB1.9 Isolate Nodule
177 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
178 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
179 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
180 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.6
Nodule 0.8
Rhizoplane 7.6
Rhizosphere 67.6
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10002724 3300001991 Bacteria 2706
2 JGI24743J22301_10003790 3300001991 Bacteria 2417
3 JGI25153J46596_10005169 3300003215 Bacteria 6872
4 Ga0055533_1000225 3300003756 Bacteria 38201
5 Ga0068869_100056468 3300005334 Bacteria 2863
6 Ga0068868_100120875 3300005338 Bacteria 2136
7 Ga0070660_100017590 3300005339 Bacteria 5212
8 Ga0070668_100239715 3300005347 Bacteria 1502
9 Ga0070671_100125093 3300005355 Bacteria 2164
10 Ga0070688_100034762 3300005365 Bacteria 3056
11 Ga0070667_100019932 3300005367 Bacteria 5565
12 Ga0070667_100214300 3300005367 Bacteria 1712
13 Ga0070710_10015230 3300005437 Bacteria 3888
14 Ga0070710_10016910 3300005437 Bacteria 3722
15 Ga0070710_10057025 3300005437 Bacteria 2212
16 Ga0070701_10057237 3300005438 Bacteria 2043
17 Ga0070711_100089234 3300005439 Bacteria 2217
18 Ga0070705_100131616 3300005440 Bacteria 1633
19 Ga0070694_100037846 3300005444 Bacteria 3202
20 Ga0070663_100000788 3300005455 Bacteria 17207
21 Ga0070678_100254574 3300005456 Bacteria 1474
22 Ga0070681_10099579 3300005458 Bacteria 2852
23 Ga0070681_10279686 3300005458 Bacteria 1579
24 Ga0070685_10012423 3300005466 Bacteria 4473
25 Ga0070707_100353046 3300005468 Bacteria 1428
26 Ga0070679_100056719 3300005530 Bacteria 3903
27 Ga0068853_100355527 3300005539 Bacteria 1363
28 Ga0068855_100017159 3300005563 Bacteria 8709
29 Ga0068855_100550834 3300005563 Bacteria 1248
30 Ga0068854_100158226 3300005578 Bacteria 1752
31 Ga0070702_100066317 3300005615 Bacteria 2116
32 Ga0068852_100305713 3300005616 Bacteria 1541
33 Ga0068859_100000044 3300005617 Bacteria 144391
34 Ga0068859_100002525 3300005617 Bacteria 18568
35 Ga0068859_100196337 3300005617 Bacteria 2102
36 Ga0068864_100212487 3300005618 Bacteria 1782
37 Ga0068866_10039271 3300005718 Bacteria 2336
38 Ga0068861_100106847 3300005719 Bacteria 2237
39 Ga0068863_100002873 3300005841 Bacteria 17054
40 Ga0068858_100054705 3300005842 Bacteria 3690
41 Ga0068860_100000023 3300005843 Bacteria 279076
42 Ga0068862_100000582 3300005844 Bacteria 38007
43 Ga0068862_100039300 3300005844 Bacteria 4018
44 Ga0068862_100187437 3300005844 Bacteria 1860
45 Ga0075365_10021101 3300006038 Bacteria 4056
46 Ga0075365_10023404 3300006038 Bacteria 3885
47 Ga0075365_10023875 3300006038 Bacteria 3851
48 Ga0075368_10027223 3300006042 Bacteria 2204
49 Ga0075363_100014560 3300006048 Bacteria 3847
50 Ga0075363_100050073 3300006048 Bacteria 2225
51 Ga0075363_100051731 3300006048 Bacteria 2191
52 Ga0075364_10001374 3300006051 Bacteria 13133
53 Ga0075364_10039979 3300006051 Bacteria 3041
54 Ga0070716_100016645 3300006173 Bacteria 3799
55 Ga0070712_100056923 3300006175 Bacteria 2744
56 Ga0070712_100061074 3300006175 Bacteria 2661
57 Ga0075362_10069087 3300006177 Bacteria 1610
58 Ga0075367_10002933 3300006178 Bacteria 7959
59 Ga0075367_10129597 3300006178 Bacteria 1559
60 Ga0075369_10000980 3300006186 Bacteria 9513
61 Ga0075369_10003527 3300006186 Bacteria 5695
62 Ga0075369_10012578 3300006186 Bacteria 3344
63 Ga0075370_10029695 3300006353 Bacteria 3046
64 Ga0097620_100000044 3300006931 Bacteria 144391
65 Ga0097620_100002525 3300006931 Bacteria 18568
66 Ga0097620_100196346 3300006931 Bacteria 2102
67 Ga0105240_10078888 3300009093 Bacteria 4053
68 Ga0105247_10001998 3300009101 Bacteria 14131
69 Ga0105247_10015654 3300009101 Bacteria 4540
70 Ga0114129_10257977 3300009147 Bacteria 2338
71 Ga0105237_10007957 3300009545 Bacteria 11550
72 Ga0105238_10020468 3300009551 Bacteria 6735
73 Ga0105238_10039168 3300009551 Bacteria 4807
74 Ga0105238_10159296 3300009551 Bacteria 2233
75 Ga0105249_10001175 3300009553 Bacteria 23194
76 Ga0105249_10033047 3300009553 Bacteria 4683
77 Ga0105249_10341596 3300009553 Bacteria 1514
78 Ga0105239_10000356 3300010375 Bacteria 66901
79 Ga0105239_10018300 3300010375 Bacteria 7745
80 Ga0105239_10332160 3300010375 Bacteria 1715
81 Ga0157371_10092965 3300013102 Bacteria 2137
82 Ga0157370_10203305 3300013104 Bacteria 1837
83 Ga0157369_10068557 3300013105 Bacteria 3811
84 Ga0157378_10140367 3300013297 Bacteria 2243
85 Ga0163162_10658460 3300013306 Bacteria 1170
86 Ga0157372_10362832 3300013307 Bacteria 1688
87 Ga0157375_10006206 3300013308 Bacteria 10407
88 Ga0157375_10368274 3300013308 Bacteria 1603
89 Ga0163163_10012169 3300014325 Bacteria 7830
90 Ga0163163_10386529 3300014325 Bacteria 1457
91 Ga0157379_10685186 3300014968 Unclassified 961
92 Ga0183368_1002 3300015687 Bacteria 1865598
93 Ga0163161_10174330 3300017792 Bacteria 1646
94 Ga0209758_1000048 3300025297 Bacteria 358400
95 Ga0209758_1000128 3300025297 Bacteria 186771
96 Ga0209758_1029414 3300025297 Bacteria 2298
97 Ga0209257_1024602 3300025304 Bacteria 2081
98 Ga0207710_10000072 3300025900 Bacteria 150638
99 Ga0207688_10015760 3300025901 Bacteria 4099
100 Ga0207647_10007558 3300025904 Bacteria 7841
101 Ga0207647_10039225 3300025904 Bacteria 2990
102 Ga0207705_10010171 3300025909 Bacteria 6845
103 Ga0207695_10008309 3300025913 Bacteria 13007
104 Ga0207695_10222359 3300025913 Bacteria 1795
105 Ga0207671_10016848 3300025914 Bacteria 5661
106 Ga0207693_10078668 3300025915 Bacteria 2581
107 Ga0207693_10175520 3300025915 Bacteria 1686
108 Ga0207663_10156940 3300025916 Bacteria 1602
109 Ga0207660_10220681 3300025917 Bacteria 1488
110 Ga0207652_10038590 3300025921 Bacteria 4051
111 Ga0207646_10118711 3300025922 Bacteria 2376
112 Ga0207694_10052045 3300025924 Bacteria 3174
113 Ga0207694_10254409 3300025924 Bacteria 1438
114 Ga0207687_10130105 3300025927 Bacteria 1896
115 Ga0207700_10001687 3300025928 Bacteria 12532
116 Ga0207664_10033835 3300025929 Bacteria 3932
117 Ga0207644_10229309 3300025931 Bacteria 1475
118 Ga0207665_10019241 3300025939 Bacteria 4487
119 Ga0207665_10019674 3300025939 Bacteria 4440
120 Ga0207691_10024897 3300025940 Bacteria 5624
121 Ga0207689_10030701 3300025942 Bacteria 4478
122 Ga0207667_10002773 3300025949 Bacteria 21677
123 Ga0207712_10011981 3300025961 Bacteria 5533
124 Ga0207712_10038275 3300025961 Bacteria 3279
125 Ga0207668_10241380 3300025972 Bacteria 1462
126 Ga0207640_10003348 3300025981 Bacteria 8632
127 Ga0207658_10012942 3300025986 Bacteria 5699
128 Ga0207658_10449985 3300025986 Bacteria 1140
129 Ga0207703_10000002 3300026035 Bacteria 600711
130 Ga0207639_10114963 3300026041 Bacteria 2200
131 Ga0207678_10000441 3300026067 Bacteria 37760
132 Ga0207678_10362788 3300026067 Bacteria 1250
133 Ga0207708_10032029 3300026075 Bacteria 3992
134 Ga0207641_10001713 3300026088 Bacteria 21263
135 Ga0207641_10089736 3300026088 Bacteria 2687
136 Ga0207648_10294004 3300026089 Bacteria 1455
137 Ga0207676_10499628 3300026095 Bacteria 1155
138 Ga0207675_100315416 3300026118 Bacteria 1525
139 Ga0207683_10033755 3300026121 Bacteria 4446
140 Ga0268266_10019158 3300028379 Bacteria 5828
141 Ga0268266_10146684 3300028379 Bacteria 2122
142 Ga0268265_10000205 3300028380 Bacteria 68729
143 Ga0268265_10047353 3300028380 Bacteria 3221
144 Ga0268265_10278078 3300028380 Bacteria 1497
145 Ga0268264_10000008 3300028381 Bacteria 773387
146 Ga0307515_10013555 3300028794 Bacteria 15219
147 Ga0307516_10002519 3300031730 Bacteria 24386
148 Ga0307507_10015952 3300033179 Bacteria 8788
149 Ga0373934_0074437 3300035086 Bacteria 1360
150 Ga0373940_0038442 3300035088 Bacteria 1306
151 Ga0373962_0099236 3300035242 Bacteria 906
152 Ga0436365_0845494 3300039437 Bacteria 5311
153 Ga0466966_0044209 3300044684 Bacteria 2852
154 Ga0466957_0165703 3300044842 Bacteria 1437
155 Ga0466957_0276222 3300044842 Bacteria 1123
156 Ga0466967_0161463 3300045976 Bacteria 2104
157 Ga0495603_0031883 3300046455 Bacteria 3172
158 Ga0495651_0117021 3300046462 Bacteria 1962
159 Ga0495580_0011912 3300046472 Bacteria 6704
160 Ga0495664_0248203 3300046477 Bacteria 1076
161 Ga0495596_0000235 3300046500 Bacteria 37669
162 Ga0495666_0002741 3300046526 Bacteria 8801
163 Ga0495645_0018958 3300046543 Bacteria 4950
164 Ga0495635_0350600 3300046663 Bacteria 985
165 Ga0495661_0001916 3300046665 Bacteria 16560
166 Ga0495599_0063759 3300046678 Bacteria 2302
167 Ga0495623_0010035 3300046679 Bacteria 6132
168 Ga0495669_0000005 3300046684 Bacteria 193971
169 Ga0495613_0012053 3300046689 Bacteria 6424
170 Ga0495624_0302959 3300046690 Bacteria 963
171 Ga0495589_0003421 3300046794 Bacteria 8589
172 Ga0495604_0001868 3300047317 Bacteria 17132
173 Ga0495604_0024267 3300047317 Bacteria 4839
174 Ga0495674_0353488 3300047319 Bacteria 1192
175 Ga0495672_0077211 3300047320 Bacteria 1868
176 Ga0495680_0018868 3300047322 Bacteria 5842
177 Ga0495683_0006568 3300047323 Bacteria 6345
178 Ga0495675_0007913 3300047444 Bacteria 6567
179 Ga0495675_0011800 3300047444 Bacteria 5488
180 Ga0495679_000478 3300047446 Bacteria 28912
181 Ga0495673_0003136 3300047469 Bacteria 11069
182 Ga0495684_0051450 3300047471 Bacteria 3143
183 Ga0495593_0018919 3300047673 Bacteria 3864
184 Ga0495602_0006286 3300048088 Bacteria 12456
185 Ga0495614_0006757 3300048089 Bacteria 5133
186 Ga0496101_0000094 3300048904 Bacteria 95577
187 Ga0496101_0478096 3300048904 Unclassified 984
188 Ga0496102_0000014 3300048905 Bacteria 310241
189 Ga0496102_0098169 3300048905 Bacteria 2718
190 Ga0496102_0192224 3300048905 Bacteria 1923
191 Ga0496103_0000004 3300048906 Bacteria 510080
192 Ga0496104_0130973 3300048907 Bacteria 2409
193 Ga0496104_0713251 3300048907 Unclassified 911
194 Ga0496106_0020856 3300048909 Bacteria 4862
195 Ga0496108_0001502 3300048911 Bacteria 18462
196 Ga0496109_0006002 3300048912 Bacteria 10203
197 Ga0496109_0061463 3300048912 Bacteria 3434
198 Ga0496110_0238962 3300048913 Bacteria 1653
199 Ga0496110_0468103 3300048913 Bacteria 1148
200 Ga0496112_0003000 3300048915 Bacteria 13795
201 Ga0496112_0225952 3300048915 Bacteria 1827
202 Ga0496115_0000170 3300048918 Bacteria 60309
203 Ga0496115_0051309 3300048918 Bacteria 3308
204 Ga0496116_0000069 3300048919 Bacteria 252643
205 Ga0496117_0000003 3300048920 Bacteria 1881097
206 Ga0496118_0000001 3300048921 Bacteria 1881100
207 Ga0496118_0151006 3300048921 Bacteria 1454
208 Ga0496119_0001073 3300048922 Bacteria 34598
209 Ga0496119_0003510 3300048922 Bacteria 16208
210 Ga0496119_0044880 3300048922 Bacteria 2777
211 Ga0496121_0000032 3300048924 Bacteria 378997
212 Ga0496121_0000882 3300048924 Bacteria 54258
213 Ga0496126_0000067 3300048929 Bacteria 249091
214 Ga0496126_0000393 3300048929 Bacteria 89680
215 Ga0496126_0023127 3300048929 Bacteria 6025
216 Ga0496126_0122388 3300048929 Bacteria 2255
217 Ga0495682_0008253 3300049460 Bacteria 4112
218 Ga0501067_0022343 3300049583 Bacteria 3501
219 Ga0501070_0052169 3300049586 Bacteria 3395
220 nmdc:mga03683_128575_c1 3300050489 Bacteria 1132
221 nmdc:mga03683_2251_c1 3300050489 Bacteria 5952
222 nmdc:mga03683_61232_c1 3300050489 Bacteria 1591
223 nmdc:mga03n38_68240_c1 3300050490 Bacteria 1639
224 nmdc:mga00v17_1723_c1 3300050491 Bacteria 11354
225 nmdc:mga00v17_50233_c1 3300050491 Bacteria 2533
226 nmdc:mga0yw44_17450_c1 3300050492 Bacteria 3905
227 nmdc:mga0yw44_69467_c1 3300050492 Bacteria 2182
228 nmdc:mga06z11_114845_c2 3300050494 Bacteria 1038
229 nmdc:mga06z11_40240_c1 3300050494 Bacteria 2331
230 nmdc:mga04h51_83575_c1 3300050495 Bacteria 1137
231 nmdc:mga07m45_16349_c1 3300050496 Bacteria 3972
232 nmdc:mga05p37_175473_c1 3300050507 Bacteria 2611
233 nmdc:mga0sz30_11868_c1 3300050516 Bacteria 3378
234 nmdc:mga0sz30_12989_c1 3300050516 Bacteria 3252
235 nmdc:mga0sz30_4145_c1 3300050516 Bacteria 5223
236 Ga0495612_0058935 3300053078 Bacteria 1587
237 Ga0500616_0003087 3300053153 Bacteria 13073
238 Ga0500637_0138506 3300053178 Bacteria 1409
239 Ga0466962_0002253 3300061719 Bacteria 9136
240 Ga0466962_0012102 3300061719 Bacteria 4148

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10068557 Ga0157369_100685572 231
2 3300009147 Ga0114129_10257977 Ga0114129_102579772 262
3 3300050507 nmdc:mga05p37_175473_c1 nmdc:mga05p37_175473_c1_142_951 262
4 3300013308 Ga0157375_10368274 Ga0157375_103682742 263
5 3300047319 Ga0495674_0353488 Ga0495674_0353488_60_854 263
6 3300048905 Ga0496102_0192224 Ga0496102_0192224_275_1072 263
7 3300048921 Ga0496118_0151006 Ga0496118_0151006_275_1072 263
8 3300048922 Ga0496119_0044880 Ga0496119_0044880_1972_2763 263
9 3300048915 Ga0496112_0225952 Ga0496112_0225952_1014_1814 266
10 3300013102 Ga0157371_10092965 Ga0157371_100929652 267
11 3300006048 Ga0075363_100050073 Ga0075363_1000500732 270
12 3300044684 Ga0466966_0044209 Ga0466966_0044209_1552_2409 270
13 3300044842 Ga0466957_0165703 Ga0466957_0165703_553_1410 270
14 3300006175 Ga0070712_100061074 Ga0070712_1000610742 271
15 3300025928 Ga0207700_10001687 Ga0207700_100016876 271
16 iso_pu_bacteria 2558860112 2558912630 273
17 3300005539 Ga0068853_100355527 Ga0068853_1003555272 277
18 3300049583 Ga0501067_0022343 Ga0501067_0022343_472_1311 278
19 3300005455 Ga0070663_100000788 Ga0070663_1000007887 279
20 3300026067 Ga0207678_10000441 Ga0207678_1000044128 279
21 3300046684 Ga0495669_0000005 Ga0495669_0000005_140391_141236 279
22 3300047471 Ga0495684_0051450 Ga0495684_0051450_2213_3106 279
23 iso_pu_bacteria 2508501039 2508677984 279
24 iso_pu_bacteria 2791355406 2793977802 279
25 iso_pu_bacteria 2899359706 2899360650 279
26 iso_pu_bacteria 2902792274 2902798249 279
27 iso_pu_bacteria 8002784119 8002786057 279
28 iso_pu_bacteria 8047893842 8047900759 279
29 iso_pu_bacteria 8048356638 8048358143 279
30 iso_pu_bacteria 8048369669 8048377700 279
31 iso_pu_bacteria 8048379754 8048386797 279
32 3300003756 Ga0055533_1000225 Ga0055533_100022538 280
33 3300006038 Ga0075365_10021101 Ga0075365_100211013 280
34 3300006051 Ga0075364_10039979 Ga0075364_100399795 280
35 3300006178 Ga0075367_10129597 Ga0075367_101295972 280
36 3300015687 Ga0183368_1002 Ga0183368_1002941 280
37 3300025904 Ga0207647_10007558 Ga0207647_100075582 280
38 3300033179 Ga0307507_10015952 Ga0307507_100159529 280
39 3300048905 Ga0496102_0098169 Ga0496102_0098169_1762_2610 280
40 3300048907 Ga0496104_0130973 Ga0496104_0130973_64_942 280
41 3300048918 Ga0496115_0000170 Ga0496115_0000170_15377_16255 280
42 3300049586 Ga0501070_0052169 Ga0501070_0052169_940_1788 280
43 3300050489 nmdc:mga03683_61232_c1 nmdc:mga03683_61232_c1_355_1200 280
44 3300050490 nmdc:mga03n38_68240_c1 nmdc:mga03n38_68240_c1_546_1391 280
45 3300050494 nmdc:mga06z11_114845_c2 nmdc:mga06z11_114845_c2_73_918 280
46 3300050495 nmdc:mga04h51_83575_c1 nmdc:mga04h51_83575_c1_249_1094 280
47 3300006042 Ga0075368_10027223 Ga0075368_100272232 281
48 3300006048 Ga0075363_100051731 Ga0075363_1000517312 281
49 3300006178 Ga0075367_10002933 Ga0075367_100029335 281
50 3300039437 Ga0436365_0845494 Ga0436365_0845494_2811_3662 282
51 3300044842 Ga0466957_0276222 Ga0466957_0276222_31_894 282
52 3300001991 JGI24743J22301_10002724 JGI24743J22301_100027244 283
53 3300001991 JGI24743J22301_10003790 JGI24743J22301_100037904 283
54 3300003215 JGI25153J46596_10005169 JGI25153J46596_100051695 283
55 3300005334 Ga0068869_100056468 Ga0068869_1000564682 283
56 3300005338 Ga0068868_100120875 Ga0068868_1001208754 283
57 3300005339 Ga0070660_100017590 Ga0070660_1000175901 283
58 3300005347 Ga0070668_100239715 Ga0070668_1002397152 283
59 3300005355 Ga0070671_100125093 Ga0070671_1001250932 283
60 3300005365 Ga0070688_100034762 Ga0070688_1000347621 283
61 3300005367 Ga0070667_100019932 Ga0070667_1000199327 283
62 3300005367 Ga0070667_100214300 Ga0070667_1002143003 283
63 3300005437 Ga0070710_10015230 Ga0070710_100152302 283
64 3300005437 Ga0070710_10016910 Ga0070710_100169105 283
65 3300005437 Ga0070710_10057025 Ga0070710_100570252 283
66 3300005438 Ga0070701_10057237 Ga0070701_100572372 283
67 3300005439 Ga0070711_100089234 Ga0070711_1000892344 283
68 3300005440 Ga0070705_100131616 Ga0070705_1001316163 283
69 3300005444 Ga0070694_100037846 Ga0070694_1000378464 283
70 3300005456 Ga0070678_100254574 Ga0070678_1002545742 283
71 3300005458 Ga0070681_10099579 Ga0070681_100995792 283
72 3300005458 Ga0070681_10279686 Ga0070681_102796862 283
73 3300005466 Ga0070685_10012423 Ga0070685_100124235 283
74 3300005468 Ga0070707_100353046 Ga0070707_1003530461 283
75 3300005530 Ga0070679_100056719 Ga0070679_1000567191 283
76 3300005563 Ga0068855_100017159 Ga0068855_1000171596 283
77 3300005563 Ga0068855_100550834 Ga0068855_1005508341 283
78 3300005578 Ga0068854_100158226 Ga0068854_1001582262 283
79 3300005615 Ga0070702_100066317 Ga0070702_1000663172 283
80 3300005616 Ga0068852_100305713 Ga0068852_1003057132 283
81 3300005617 Ga0068859_100000044 Ga0068859_100000044140 283
82 3300005617 Ga0068859_100002525 Ga0068859_1000025252 283
83 3300005617 Ga0068859_100196337 Ga0068859_1001963374 283
84 3300005618 Ga0068864_100212487 Ga0068864_1002124874 283
85 3300005718 Ga0068866_10039271 Ga0068866_100392711 283
86 3300005719 Ga0068861_100106847 Ga0068861_1001068475 283
87 3300005841 Ga0068863_100002873 Ga0068863_10000287310 283
88 3300005842 Ga0068858_100054705 Ga0068858_1000547054 283
89 3300005843 Ga0068860_100000023 Ga0068860_100000023140 283
90 3300005844 Ga0068862_100000582 Ga0068862_10000058225 283
91 3300005844 Ga0068862_100039300 Ga0068862_1000393003 283
92 3300005844 Ga0068862_100187437 Ga0068862_1001874374 283
93 3300006038 Ga0075365_10023404 Ga0075365_100234044 283
94 3300006038 Ga0075365_10023875 Ga0075365_100238751 283
95 3300006048 Ga0075363_100014560 Ga0075363_1000145601 283
96 3300006051 Ga0075364_10001374 Ga0075364_100013747 283
97 3300006173 Ga0070716_100016645 Ga0070716_1000166452 283
98 3300006175 Ga0070712_100056923 Ga0070712_1000569234 283
99 3300006177 Ga0075362_10069087 Ga0075362_100690872 283
100 3300006186 Ga0075369_10000980 Ga0075369_100009807 283
101 3300006186 Ga0075369_10003527 Ga0075369_100035276 283
102 3300006186 Ga0075369_10012578 Ga0075369_100125784 283
103 3300006353 Ga0075370_10029695 Ga0075370_100296954 283
104 3300006931 Ga0097620_100000044 Ga0097620_100000044140 283
105 3300006931 Ga0097620_100002525 Ga0097620_1000025252 283
106 3300006931 Ga0097620_100196346 Ga0097620_1001963464 283
107 3300009093 Ga0105240_10078888 Ga0105240_100788883 283
108 3300009101 Ga0105247_10001998 Ga0105247_1000199813 283
109 3300009101 Ga0105247_10015654 Ga0105247_100156544 283
110 3300009545 Ga0105237_10007957 Ga0105237_100079572 283
111 3300009551 Ga0105238_10020468 Ga0105238_1002046810 283
112 3300009551 Ga0105238_10039168 Ga0105238_100391683 283
113 3300009551 Ga0105238_10159296 Ga0105238_101592962 283
114 3300009553 Ga0105249_10001175 Ga0105249_1000117520 283
115 3300009553 Ga0105249_10033047 Ga0105249_100330473 283
116 3300009553 Ga0105249_10341596 Ga0105249_103415961 283
117 3300010375 Ga0105239_10000356 Ga0105239_1000035615 283
118 3300010375 Ga0105239_10018300 Ga0105239_1001830011 283
119 3300010375 Ga0105239_10332160 Ga0105239_103321602 283
120 3300013104 Ga0157370_10203305 Ga0157370_102033052 283
121 3300013297 Ga0157378_10140367 Ga0157378_101403674 283
122 3300013306 Ga0163162_10658460 Ga0163162_106584602 283
123 3300013307 Ga0157372_10362832 Ga0157372_103628322 283
124 3300013308 Ga0157375_10006206 Ga0157375_100062063 283
125 3300014325 Ga0163163_10012169 Ga0163163_100121698 283
126 3300014325 Ga0163163_10386529 Ga0163163_103865292 283
127 3300014968 Ga0157379_10685186 Ga0157379_106851861 283
128 3300017792 Ga0163161_10174330 Ga0163161_101743301 283
129 3300025297 Ga0209758_1000048 Ga0209758_1000048193 283
130 3300025297 Ga0209758_1000128 Ga0209758_100012852 283
131 3300025297 Ga0209758_1029414 Ga0209758_10294142 283
132 3300025304 Ga0209257_1024602 Ga0209257_10246022 283
133 3300025900 Ga0207710_10000072 Ga0207710_1000007244 283
134 3300025901 Ga0207688_10015760 Ga0207688_100157605 283
135 3300025904 Ga0207647_10039225 Ga0207647_100392254 283
136 3300025909 Ga0207705_10010171 Ga0207705_100101716 283
137 3300025913 Ga0207695_10008309 Ga0207695_1000830914 283
138 3300025913 Ga0207695_10222359 Ga0207695_102223592 283
139 3300025914 Ga0207671_10016848 Ga0207671_100168488 283
140 3300025915 Ga0207693_10078668 Ga0207693_100786684 283
141 3300025915 Ga0207693_10175520 Ga0207693_101755202 283
142 3300025916 Ga0207663_10156940 Ga0207663_101569402 283
143 3300025917 Ga0207660_10220681 Ga0207660_102206812 283
144 3300025921 Ga0207652_10038590 Ga0207652_100385902 283
145 3300025922 Ga0207646_10118711 Ga0207646_101187111 283
146 3300025924 Ga0207694_10052045 Ga0207694_100520452 283
147 3300025924 Ga0207694_10254409 Ga0207694_102544092 283
148 3300025927 Ga0207687_10130105 Ga0207687_101301055 283
149 3300025929 Ga0207664_10033835 Ga0207664_100338354 283
150 3300025931 Ga0207644_10229309 Ga0207644_102293092 283
151 3300025939 Ga0207665_10019241 Ga0207665_100192413 283
152 3300025939 Ga0207665_10019674 Ga0207665_100196744 283
153 3300025940 Ga0207691_10024897 Ga0207691_100248974 283
154 3300025942 Ga0207689_10030701 Ga0207689_100307014 283
155 3300025949 Ga0207667_10002773 Ga0207667_1000277311 283
156 3300025961 Ga0207712_10011981 Ga0207712_100119812 283
157 3300025961 Ga0207712_10038275 Ga0207712_100382753 283
158 3300025972 Ga0207668_10241380 Ga0207668_102413802 283
159 3300025981 Ga0207640_10003348 Ga0207640_100033486 283
160 3300025986 Ga0207658_10012942 Ga0207658_100129427 283
161 3300025986 Ga0207658_10449985 Ga0207658_104499851 283
162 3300026035 Ga0207703_10000002 Ga0207703_10000002416 283
163 3300026041 Ga0207639_10114963 Ga0207639_101149633 283
164 3300026067 Ga0207678_10362788 Ga0207678_103627881 283
165 3300026075 Ga0207708_10032029 Ga0207708_100320291 283
166 3300026088 Ga0207641_10001713 Ga0207641_1000171310 283
167 3300026088 Ga0207641_10089736 Ga0207641_100897364 283
168 3300026089 Ga0207648_10294004 Ga0207648_102940042 283
169 3300026095 Ga0207676_10499628 Ga0207676_104996281 283
170 3300026118 Ga0207675_100315416 Ga0207675_1003154162 283
171 3300026121 Ga0207683_10033755 Ga0207683_100337552 283
172 3300028379 Ga0268266_10019158 Ga0268266_100191586 283
173 3300028379 Ga0268266_10146684 Ga0268266_101466842 283
174 3300028380 Ga0268265_10000205 Ga0268265_1000020526 283
175 3300028380 Ga0268265_10047353 Ga0268265_100473534 283
176 3300028380 Ga0268265_10278078 Ga0268265_102780782 283
177 3300028381 Ga0268264_10000008 Ga0268264_10000008120 283
178 3300028794 Ga0307515_10013555 Ga0307515_1001355510 283
179 3300031730 Ga0307516_10002519 Ga0307516_100025194 283
180 3300035086 Ga0373934_0074437 Ga0373934_0074437_145_1002 283
181 3300035088 Ga0373940_0038442 Ga0373940_0038442_43_894 283
182 3300035242 Ga0373962_0099236 Ga0373962_0099236_15_866 283
183 3300045976 Ga0466967_0161463 Ga0466967_0161463_773_1624 283
184 3300046455 Ga0495603_0031883 Ga0495603_0031883_440_1315 283
185 3300046462 Ga0495651_0117021 Ga0495651_0117021_251_1108 283
186 3300046472 Ga0495580_0011912 Ga0495580_0011912_2594_3469 283
187 3300046477 Ga0495664_0248203 Ga0495664_0248203_126_983 283
188 3300046500 Ga0495596_0000235 Ga0495596_0000235_5057_5932 283
189 3300046526 Ga0495666_0002741 Ga0495666_0002741_830_1705 283
190 3300046543 Ga0495645_0018958 Ga0495645_0018958_2854_3711 283
191 3300046663 Ga0495635_0350600 Ga0495635_0350600_32_883 283
192 3300046665 Ga0495661_0001916 Ga0495661_0001916_15118_15993 283
193 3300046678 Ga0495599_0063759 Ga0495599_0063759_729_1670 283
194 3300046679 Ga0495623_0010035 Ga0495623_0010035_2276_3217 283
195 3300046689 Ga0495613_0012053 Ga0495613_0012053_5219_6094 283
196 3300046690 Ga0495624_0302959 Ga0495624_0302959_77_937 283
197 3300046794 Ga0495589_0003421 Ga0495589_0003421_3349_4224 283
198 3300047317 Ga0495604_0001868 Ga0495604_0001868_16031_16972 283
199 3300047317 Ga0495604_0024267 Ga0495604_0024267_3920_4777 283
200 3300047320 Ga0495672_0077211 Ga0495672_0077211_774_1625 283
201 3300047322 Ga0495680_0018868 Ga0495680_0018868_1073_2014 283
202 3300047323 Ga0495683_0006568 Ga0495683_0006568_4588_5463 283
203 3300047444 Ga0495675_0007913 Ga0495675_0007913_1858_2733 283
204 3300047444 Ga0495675_0011800 Ga0495675_0011800_3346_4287 283
205 3300047446 Ga0495679_000478 Ga0495679_000478_17087_17962 283
206 3300047469 Ga0495673_0003136 Ga0495673_0003136_1791_2666 283
207 3300047673 Ga0495593_0018919 Ga0495593_0018919_1917_2792 283
208 3300048088 Ga0495602_0006286 Ga0495602_0006286_4174_5115 283
209 3300048089 Ga0495614_0006757 Ga0495614_0006757_3801_4676 283
210 3300048904 Ga0496101_0000094 Ga0496101_0000094_62355_63206 283
211 3300048904 Ga0496101_0478096 Ga0496101_0478096_10_861 283
212 3300048905 Ga0496102_0000014 Ga0496102_0000014_179146_179997 283
213 3300048906 Ga0496103_0000004 Ga0496103_0000004_179652_180503 283
214 3300048907 Ga0496104_0713251 Ga0496104_0713251_23_874 283
215 3300048909 Ga0496106_0020856 Ga0496106_0020856_566_1417 283
216 3300048911 Ga0496108_0001502 Ga0496108_0001502_5896_6747 283
217 3300048912 Ga0496109_0006002 Ga0496109_0006002_7657_8508 283
218 3300048912 Ga0496109_0061463 Ga0496109_0061463_1039_1890 283
219 3300048913 Ga0496110_0238962 Ga0496110_0238962_457_1314 283
220 3300048913 Ga0496110_0468103 Ga0496110_0468103_205_1056 283
221 3300048915 Ga0496112_0003000 Ga0496112_0003000_7877_8728 283
222 3300048918 Ga0496115_0051309 Ga0496115_0051309_1394_2251 283
223 3300048919 Ga0496116_0000069 Ga0496116_0000069_180603_181454 283
224 3300048920 Ga0496117_0000003 Ga0496117_0000003_1378055_1378906 283
225 3300048921 Ga0496118_0000001 Ga0496118_0000001_1378058_1378909 283
226 3300048922 Ga0496119_0001073 Ga0496119_0001073_24976_25827 283
227 3300048922 Ga0496119_0003510 Ga0496119_0003510_2360_3217 283
228 3300048924 Ga0496121_0000032 Ga0496121_0000032_270824_271675 283
229 3300048924 Ga0496121_0000882 Ga0496121_0000882_38340_39197 283
230 3300048929 Ga0496126_0000067 Ga0496126_0000067_130122_130973 283
231 3300048929 Ga0496126_0000393 Ga0496126_0000393_84889_85749 283
232 3300048929 Ga0496126_0023127 Ga0496126_0023127_4558_5418 283
233 3300048929 Ga0496126_0122388 Ga0496126_0122388_603_1454 283
234 3300049460 Ga0495682_0008253 Ga0495682_0008253_2656_3531 283
235 3300050489 nmdc:mga03683_128575_c1 nmdc:mga03683_128575_c1_240_1091 283
236 3300050489 nmdc:mga03683_2251_c1 nmdc:mga03683_2251_c1_454_1314 283
237 3300050491 nmdc:mga00v17_1723_c1 nmdc:mga00v17_1723_c1_7576_8448 283
238 3300050491 nmdc:mga00v17_50233_c1 nmdc:mga00v17_50233_c1_1350_2201 283
239 3300050492 nmdc:mga0yw44_17450_c1 nmdc:mga0yw44_17450_c1_26_898 283
240 3300050492 nmdc:mga0yw44_69467_c1 nmdc:mga0yw44_69467_c1_1275_2126 283
241 3300050494 nmdc:mga06z11_40240_c1 nmdc:mga06z11_40240_c1_1113_1973 283
242 3300050496 nmdc:mga07m45_16349_c1 nmdc:mga07m45_16349_c1_1681_2541 283
243 3300050516 nmdc:mga0sz30_11868_c1 nmdc:mga0sz30_11868_c1_444_1304 283
244 3300050516 nmdc:mga0sz30_12989_c1 nmdc:mga0sz30_12989_c1_1889_2740 283
245 3300050516 nmdc:mga0sz30_4145_c1 nmdc:mga0sz30_4145_c1_2976_3848 283
246 3300053078 Ga0495612_0058935 Ga0495612_0058935_481_1338 283
247 3300053153 Ga0500616_0003087 Ga0500616_0003087_3825_4676 283
248 3300053178 Ga0500637_0138506 Ga0500637_0138506_111_971 283
249 3300061719 Ga0466962_0002253 Ga0466962_0002253_667_1524 283
250 3300061719 Ga0466962_0012102 Ga0466962_0012102_2280_3137 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04072

LCM

Leucine carboxyl methyltransferase

55

232

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uyo-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form 0.7589 9 282
6id6-assembly1.cif.gz_A crystal structure of rv0731c from mycobacterium tuberculosis at 1.63 angstroms. 0.7549 8 282
2ckd-assembly2.cif.gz_B crystal structure of ml2640 from mycobacterium leprae 0.7543 7 282
2uyo-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form 0.7489 9 282
2uyq-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in complex with s-adenosylmethionine 0.7457 9 282
ID Description Score Start End Superfamily
af_I6YEA3_2_289_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8541 10 283 3.40.50.150
af_I6YEA3_2_289_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8261 10 283 3.40.50.150
af_B3H6G9_58_302_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8161 11 282 3.40.50.150
af_Q8BYR1_3_315_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7995 10 282 3.40.50.150
af_P46554_9_333_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.796 11 283 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A543FEY3-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.993 6 283 GO:0008168
GO:0032259
AF-A0A7W9TXL1-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9903 6 168 GO:0008168
GO:0032259
AF-Q0RHY3-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9895 7 283 GO:0008168
GO:0032259
AF-B1T671-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9892 53 283 GO:0008168
GO:0032259
AF-A0A8B6LYY5-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9865 6 283 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map