F361422
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 180 | 240 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100017159|Ga0068855_1000171596 |
| Length | 328 |
| Sequence | MSAATQEVRFGETPKPALETSALPRNLPPCEHDWENRKLRSVMGKDISPEADKTAVRVALWRALHLEVDAPPYVLEDKVGLQLAAPEEGWRQRPDMDPQWTSIFRASVLARARFIEDLVIDRGNHQVGQYVILGAGLDTFAQRRPEIASRLTIFEIDQPRHQAWKKQRLVEIGYGIPDWLRLVPVDFEAGENWWQRLNASGFDSSKPAVVASTGVSMYLTKEANFSTLRQVAGLAPGSTFAMTFLLPLELADSEVRPGLEMAEKGARASGTPFLSFFTPDEMLTMAKQAGFKEVQHVPASILAARYFANRKDGFRPPNNGEELLVATT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 4 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 5 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 109 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 110 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 112 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 117 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 155 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 156 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 157 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 158 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 168 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 169 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 170 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 175 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 176 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 177 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 178 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 179 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 180 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96 |
| Metatranscriptomes | 0 |
| Isolates | 4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.6 |
| Nodule | 0.8 |
| Rhizoplane | 7.6 |
| Rhizosphere | 67.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10002724 | 3300001991 | Bacteria | 2706 |
| 2 | JGI24743J22301_10003790 | 3300001991 | Bacteria | 2417 |
| 3 | JGI25153J46596_10005169 | 3300003215 | Bacteria | 6872 |
| 4 | Ga0055533_1000225 | 3300003756 | Bacteria | 38201 |
| 5 | Ga0068869_100056468 | 3300005334 | Bacteria | 2863 |
| 6 | Ga0068868_100120875 | 3300005338 | Bacteria | 2136 |
| 7 | Ga0070660_100017590 | 3300005339 | Bacteria | 5212 |
| 8 | Ga0070668_100239715 | 3300005347 | Bacteria | 1502 |
| 9 | Ga0070671_100125093 | 3300005355 | Bacteria | 2164 |
| 10 | Ga0070688_100034762 | 3300005365 | Bacteria | 3056 |
| 11 | Ga0070667_100019932 | 3300005367 | Bacteria | 5565 |
| 12 | Ga0070667_100214300 | 3300005367 | Bacteria | 1712 |
| 13 | Ga0070710_10015230 | 3300005437 | Bacteria | 3888 |
| 14 | Ga0070710_10016910 | 3300005437 | Bacteria | 3722 |
| 15 | Ga0070710_10057025 | 3300005437 | Bacteria | 2212 |
| 16 | Ga0070701_10057237 | 3300005438 | Bacteria | 2043 |
| 17 | Ga0070711_100089234 | 3300005439 | Bacteria | 2217 |
| 18 | Ga0070705_100131616 | 3300005440 | Bacteria | 1633 |
| 19 | Ga0070694_100037846 | 3300005444 | Bacteria | 3202 |
| 20 | Ga0070663_100000788 | 3300005455 | Bacteria | 17207 |
| 21 | Ga0070678_100254574 | 3300005456 | Bacteria | 1474 |
| 22 | Ga0070681_10099579 | 3300005458 | Bacteria | 2852 |
| 23 | Ga0070681_10279686 | 3300005458 | Bacteria | 1579 |
| 24 | Ga0070685_10012423 | 3300005466 | Bacteria | 4473 |
| 25 | Ga0070707_100353046 | 3300005468 | Bacteria | 1428 |
| 26 | Ga0070679_100056719 | 3300005530 | Bacteria | 3903 |
| 27 | Ga0068853_100355527 | 3300005539 | Bacteria | 1363 |
| 28 | Ga0068855_100017159 | 3300005563 | Bacteria | 8709 |
| 29 | Ga0068855_100550834 | 3300005563 | Bacteria | 1248 |
| 30 | Ga0068854_100158226 | 3300005578 | Bacteria | 1752 |
| 31 | Ga0070702_100066317 | 3300005615 | Bacteria | 2116 |
| 32 | Ga0068852_100305713 | 3300005616 | Bacteria | 1541 |
| 33 | Ga0068859_100000044 | 3300005617 | Bacteria | 144391 |
| 34 | Ga0068859_100002525 | 3300005617 | Bacteria | 18568 |
| 35 | Ga0068859_100196337 | 3300005617 | Bacteria | 2102 |
| 36 | Ga0068864_100212487 | 3300005618 | Bacteria | 1782 |
| 37 | Ga0068866_10039271 | 3300005718 | Bacteria | 2336 |
| 38 | Ga0068861_100106847 | 3300005719 | Bacteria | 2237 |
| 39 | Ga0068863_100002873 | 3300005841 | Bacteria | 17054 |
| 40 | Ga0068858_100054705 | 3300005842 | Bacteria | 3690 |
| 41 | Ga0068860_100000023 | 3300005843 | Bacteria | 279076 |
| 42 | Ga0068862_100000582 | 3300005844 | Bacteria | 38007 |
| 43 | Ga0068862_100039300 | 3300005844 | Bacteria | 4018 |
| 44 | Ga0068862_100187437 | 3300005844 | Bacteria | 1860 |
| 45 | Ga0075365_10021101 | 3300006038 | Bacteria | 4056 |
| 46 | Ga0075365_10023404 | 3300006038 | Bacteria | 3885 |
| 47 | Ga0075365_10023875 | 3300006038 | Bacteria | 3851 |
| 48 | Ga0075368_10027223 | 3300006042 | Bacteria | 2204 |
| 49 | Ga0075363_100014560 | 3300006048 | Bacteria | 3847 |
| 50 | Ga0075363_100050073 | 3300006048 | Bacteria | 2225 |
| 51 | Ga0075363_100051731 | 3300006048 | Bacteria | 2191 |
| 52 | Ga0075364_10001374 | 3300006051 | Bacteria | 13133 |
| 53 | Ga0075364_10039979 | 3300006051 | Bacteria | 3041 |
| 54 | Ga0070716_100016645 | 3300006173 | Bacteria | 3799 |
| 55 | Ga0070712_100056923 | 3300006175 | Bacteria | 2744 |
| 56 | Ga0070712_100061074 | 3300006175 | Bacteria | 2661 |
| 57 | Ga0075362_10069087 | 3300006177 | Bacteria | 1610 |
| 58 | Ga0075367_10002933 | 3300006178 | Bacteria | 7959 |
| 59 | Ga0075367_10129597 | 3300006178 | Bacteria | 1559 |
| 60 | Ga0075369_10000980 | 3300006186 | Bacteria | 9513 |
| 61 | Ga0075369_10003527 | 3300006186 | Bacteria | 5695 |
| 62 | Ga0075369_10012578 | 3300006186 | Bacteria | 3344 |
| 63 | Ga0075370_10029695 | 3300006353 | Bacteria | 3046 |
| 64 | Ga0097620_100000044 | 3300006931 | Bacteria | 144391 |
| 65 | Ga0097620_100002525 | 3300006931 | Bacteria | 18568 |
| 66 | Ga0097620_100196346 | 3300006931 | Bacteria | 2102 |
| 67 | Ga0105240_10078888 | 3300009093 | Bacteria | 4053 |
| 68 | Ga0105247_10001998 | 3300009101 | Bacteria | 14131 |
| 69 | Ga0105247_10015654 | 3300009101 | Bacteria | 4540 |
| 70 | Ga0114129_10257977 | 3300009147 | Bacteria | 2338 |
| 71 | Ga0105237_10007957 | 3300009545 | Bacteria | 11550 |
| 72 | Ga0105238_10020468 | 3300009551 | Bacteria | 6735 |
| 73 | Ga0105238_10039168 | 3300009551 | Bacteria | 4807 |
| 74 | Ga0105238_10159296 | 3300009551 | Bacteria | 2233 |
| 75 | Ga0105249_10001175 | 3300009553 | Bacteria | 23194 |
| 76 | Ga0105249_10033047 | 3300009553 | Bacteria | 4683 |
| 77 | Ga0105249_10341596 | 3300009553 | Bacteria | 1514 |
| 78 | Ga0105239_10000356 | 3300010375 | Bacteria | 66901 |
| 79 | Ga0105239_10018300 | 3300010375 | Bacteria | 7745 |
| 80 | Ga0105239_10332160 | 3300010375 | Bacteria | 1715 |
| 81 | Ga0157371_10092965 | 3300013102 | Bacteria | 2137 |
| 82 | Ga0157370_10203305 | 3300013104 | Bacteria | 1837 |
| 83 | Ga0157369_10068557 | 3300013105 | Bacteria | 3811 |
| 84 | Ga0157378_10140367 | 3300013297 | Bacteria | 2243 |
| 85 | Ga0163162_10658460 | 3300013306 | Bacteria | 1170 |
| 86 | Ga0157372_10362832 | 3300013307 | Bacteria | 1688 |
| 87 | Ga0157375_10006206 | 3300013308 | Bacteria | 10407 |
| 88 | Ga0157375_10368274 | 3300013308 | Bacteria | 1603 |
| 89 | Ga0163163_10012169 | 3300014325 | Bacteria | 7830 |
| 90 | Ga0163163_10386529 | 3300014325 | Bacteria | 1457 |
| 91 | Ga0157379_10685186 | 3300014968 | Unclassified | 961 |
| 92 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 93 | Ga0163161_10174330 | 3300017792 | Bacteria | 1646 |
| 94 | Ga0209758_1000048 | 3300025297 | Bacteria | 358400 |
| 95 | Ga0209758_1000128 | 3300025297 | Bacteria | 186771 |
| 96 | Ga0209758_1029414 | 3300025297 | Bacteria | 2298 |
| 97 | Ga0209257_1024602 | 3300025304 | Bacteria | 2081 |
| 98 | Ga0207710_10000072 | 3300025900 | Bacteria | 150638 |
| 99 | Ga0207688_10015760 | 3300025901 | Bacteria | 4099 |
| 100 | Ga0207647_10007558 | 3300025904 | Bacteria | 7841 |
| 101 | Ga0207647_10039225 | 3300025904 | Bacteria | 2990 |
| 102 | Ga0207705_10010171 | 3300025909 | Bacteria | 6845 |
| 103 | Ga0207695_10008309 | 3300025913 | Bacteria | 13007 |
| 104 | Ga0207695_10222359 | 3300025913 | Bacteria | 1795 |
| 105 | Ga0207671_10016848 | 3300025914 | Bacteria | 5661 |
| 106 | Ga0207693_10078668 | 3300025915 | Bacteria | 2581 |
| 107 | Ga0207693_10175520 | 3300025915 | Bacteria | 1686 |
| 108 | Ga0207663_10156940 | 3300025916 | Bacteria | 1602 |
| 109 | Ga0207660_10220681 | 3300025917 | Bacteria | 1488 |
| 110 | Ga0207652_10038590 | 3300025921 | Bacteria | 4051 |
| 111 | Ga0207646_10118711 | 3300025922 | Bacteria | 2376 |
| 112 | Ga0207694_10052045 | 3300025924 | Bacteria | 3174 |
| 113 | Ga0207694_10254409 | 3300025924 | Bacteria | 1438 |
| 114 | Ga0207687_10130105 | 3300025927 | Bacteria | 1896 |
| 115 | Ga0207700_10001687 | 3300025928 | Bacteria | 12532 |
| 116 | Ga0207664_10033835 | 3300025929 | Bacteria | 3932 |
| 117 | Ga0207644_10229309 | 3300025931 | Bacteria | 1475 |
| 118 | Ga0207665_10019241 | 3300025939 | Bacteria | 4487 |
| 119 | Ga0207665_10019674 | 3300025939 | Bacteria | 4440 |
| 120 | Ga0207691_10024897 | 3300025940 | Bacteria | 5624 |
| 121 | Ga0207689_10030701 | 3300025942 | Bacteria | 4478 |
| 122 | Ga0207667_10002773 | 3300025949 | Bacteria | 21677 |
| 123 | Ga0207712_10011981 | 3300025961 | Bacteria | 5533 |
| 124 | Ga0207712_10038275 | 3300025961 | Bacteria | 3279 |
| 125 | Ga0207668_10241380 | 3300025972 | Bacteria | 1462 |
| 126 | Ga0207640_10003348 | 3300025981 | Bacteria | 8632 |
| 127 | Ga0207658_10012942 | 3300025986 | Bacteria | 5699 |
| 128 | Ga0207658_10449985 | 3300025986 | Bacteria | 1140 |
| 129 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 130 | Ga0207639_10114963 | 3300026041 | Bacteria | 2200 |
| 131 | Ga0207678_10000441 | 3300026067 | Bacteria | 37760 |
| 132 | Ga0207678_10362788 | 3300026067 | Bacteria | 1250 |
| 133 | Ga0207708_10032029 | 3300026075 | Bacteria | 3992 |
| 134 | Ga0207641_10001713 | 3300026088 | Bacteria | 21263 |
| 135 | Ga0207641_10089736 | 3300026088 | Bacteria | 2687 |
| 136 | Ga0207648_10294004 | 3300026089 | Bacteria | 1455 |
| 137 | Ga0207676_10499628 | 3300026095 | Bacteria | 1155 |
| 138 | Ga0207675_100315416 | 3300026118 | Bacteria | 1525 |
| 139 | Ga0207683_10033755 | 3300026121 | Bacteria | 4446 |
| 140 | Ga0268266_10019158 | 3300028379 | Bacteria | 5828 |
| 141 | Ga0268266_10146684 | 3300028379 | Bacteria | 2122 |
| 142 | Ga0268265_10000205 | 3300028380 | Bacteria | 68729 |
| 143 | Ga0268265_10047353 | 3300028380 | Bacteria | 3221 |
| 144 | Ga0268265_10278078 | 3300028380 | Bacteria | 1497 |
| 145 | Ga0268264_10000008 | 3300028381 | Bacteria | 773387 |
| 146 | Ga0307515_10013555 | 3300028794 | Bacteria | 15219 |
| 147 | Ga0307516_10002519 | 3300031730 | Bacteria | 24386 |
| 148 | Ga0307507_10015952 | 3300033179 | Bacteria | 8788 |
| 149 | Ga0373934_0074437 | 3300035086 | Bacteria | 1360 |
| 150 | Ga0373940_0038442 | 3300035088 | Bacteria | 1306 |
| 151 | Ga0373962_0099236 | 3300035242 | Bacteria | 906 |
| 152 | Ga0436365_0845494 | 3300039437 | Bacteria | 5311 |
| 153 | Ga0466966_0044209 | 3300044684 | Bacteria | 2852 |
| 154 | Ga0466957_0165703 | 3300044842 | Bacteria | 1437 |
| 155 | Ga0466957_0276222 | 3300044842 | Bacteria | 1123 |
| 156 | Ga0466967_0161463 | 3300045976 | Bacteria | 2104 |
| 157 | Ga0495603_0031883 | 3300046455 | Bacteria | 3172 |
| 158 | Ga0495651_0117021 | 3300046462 | Bacteria | 1962 |
| 159 | Ga0495580_0011912 | 3300046472 | Bacteria | 6704 |
| 160 | Ga0495664_0248203 | 3300046477 | Bacteria | 1076 |
| 161 | Ga0495596_0000235 | 3300046500 | Bacteria | 37669 |
| 162 | Ga0495666_0002741 | 3300046526 | Bacteria | 8801 |
| 163 | Ga0495645_0018958 | 3300046543 | Bacteria | 4950 |
| 164 | Ga0495635_0350600 | 3300046663 | Bacteria | 985 |
| 165 | Ga0495661_0001916 | 3300046665 | Bacteria | 16560 |
| 166 | Ga0495599_0063759 | 3300046678 | Bacteria | 2302 |
| 167 | Ga0495623_0010035 | 3300046679 | Bacteria | 6132 |
| 168 | Ga0495669_0000005 | 3300046684 | Bacteria | 193971 |
| 169 | Ga0495613_0012053 | 3300046689 | Bacteria | 6424 |
| 170 | Ga0495624_0302959 | 3300046690 | Bacteria | 963 |
| 171 | Ga0495589_0003421 | 3300046794 | Bacteria | 8589 |
| 172 | Ga0495604_0001868 | 3300047317 | Bacteria | 17132 |
| 173 | Ga0495604_0024267 | 3300047317 | Bacteria | 4839 |
| 174 | Ga0495674_0353488 | 3300047319 | Bacteria | 1192 |
| 175 | Ga0495672_0077211 | 3300047320 | Bacteria | 1868 |
| 176 | Ga0495680_0018868 | 3300047322 | Bacteria | 5842 |
| 177 | Ga0495683_0006568 | 3300047323 | Bacteria | 6345 |
| 178 | Ga0495675_0007913 | 3300047444 | Bacteria | 6567 |
| 179 | Ga0495675_0011800 | 3300047444 | Bacteria | 5488 |
| 180 | Ga0495679_000478 | 3300047446 | Bacteria | 28912 |
| 181 | Ga0495673_0003136 | 3300047469 | Bacteria | 11069 |
| 182 | Ga0495684_0051450 | 3300047471 | Bacteria | 3143 |
| 183 | Ga0495593_0018919 | 3300047673 | Bacteria | 3864 |
| 184 | Ga0495602_0006286 | 3300048088 | Bacteria | 12456 |
| 185 | Ga0495614_0006757 | 3300048089 | Bacteria | 5133 |
| 186 | Ga0496101_0000094 | 3300048904 | Bacteria | 95577 |
| 187 | Ga0496101_0478096 | 3300048904 | Unclassified | 984 |
| 188 | Ga0496102_0000014 | 3300048905 | Bacteria | 310241 |
| 189 | Ga0496102_0098169 | 3300048905 | Bacteria | 2718 |
| 190 | Ga0496102_0192224 | 3300048905 | Bacteria | 1923 |
| 191 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 192 | Ga0496104_0130973 | 3300048907 | Bacteria | 2409 |
| 193 | Ga0496104_0713251 | 3300048907 | Unclassified | 911 |
| 194 | Ga0496106_0020856 | 3300048909 | Bacteria | 4862 |
| 195 | Ga0496108_0001502 | 3300048911 | Bacteria | 18462 |
| 196 | Ga0496109_0006002 | 3300048912 | Bacteria | 10203 |
| 197 | Ga0496109_0061463 | 3300048912 | Bacteria | 3434 |
| 198 | Ga0496110_0238962 | 3300048913 | Bacteria | 1653 |
| 199 | Ga0496110_0468103 | 3300048913 | Bacteria | 1148 |
| 200 | Ga0496112_0003000 | 3300048915 | Bacteria | 13795 |
| 201 | Ga0496112_0225952 | 3300048915 | Bacteria | 1827 |
| 202 | Ga0496115_0000170 | 3300048918 | Bacteria | 60309 |
| 203 | Ga0496115_0051309 | 3300048918 | Bacteria | 3308 |
| 204 | Ga0496116_0000069 | 3300048919 | Bacteria | 252643 |
| 205 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 206 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 207 | Ga0496118_0151006 | 3300048921 | Bacteria | 1454 |
| 208 | Ga0496119_0001073 | 3300048922 | Bacteria | 34598 |
| 209 | Ga0496119_0003510 | 3300048922 | Bacteria | 16208 |
| 210 | Ga0496119_0044880 | 3300048922 | Bacteria | 2777 |
| 211 | Ga0496121_0000032 | 3300048924 | Bacteria | 378997 |
| 212 | Ga0496121_0000882 | 3300048924 | Bacteria | 54258 |
| 213 | Ga0496126_0000067 | 3300048929 | Bacteria | 249091 |
| 214 | Ga0496126_0000393 | 3300048929 | Bacteria | 89680 |
| 215 | Ga0496126_0023127 | 3300048929 | Bacteria | 6025 |
| 216 | Ga0496126_0122388 | 3300048929 | Bacteria | 2255 |
| 217 | Ga0495682_0008253 | 3300049460 | Bacteria | 4112 |
| 218 | Ga0501067_0022343 | 3300049583 | Bacteria | 3501 |
| 219 | Ga0501070_0052169 | 3300049586 | Bacteria | 3395 |
| 220 | nmdc:mga03683_128575_c1 | 3300050489 | Bacteria | 1132 |
| 221 | nmdc:mga03683_2251_c1 | 3300050489 | Bacteria | 5952 |
| 222 | nmdc:mga03683_61232_c1 | 3300050489 | Bacteria | 1591 |
| 223 | nmdc:mga03n38_68240_c1 | 3300050490 | Bacteria | 1639 |
| 224 | nmdc:mga00v17_1723_c1 | 3300050491 | Bacteria | 11354 |
| 225 | nmdc:mga00v17_50233_c1 | 3300050491 | Bacteria | 2533 |
| 226 | nmdc:mga0yw44_17450_c1 | 3300050492 | Bacteria | 3905 |
| 227 | nmdc:mga0yw44_69467_c1 | 3300050492 | Bacteria | 2182 |
| 228 | nmdc:mga06z11_114845_c2 | 3300050494 | Bacteria | 1038 |
| 229 | nmdc:mga06z11_40240_c1 | 3300050494 | Bacteria | 2331 |
| 230 | nmdc:mga04h51_83575_c1 | 3300050495 | Bacteria | 1137 |
| 231 | nmdc:mga07m45_16349_c1 | 3300050496 | Bacteria | 3972 |
| 232 | nmdc:mga05p37_175473_c1 | 3300050507 | Bacteria | 2611 |
| 233 | nmdc:mga0sz30_11868_c1 | 3300050516 | Bacteria | 3378 |
| 234 | nmdc:mga0sz30_12989_c1 | 3300050516 | Bacteria | 3252 |
| 235 | nmdc:mga0sz30_4145_c1 | 3300050516 | Bacteria | 5223 |
| 236 | Ga0495612_0058935 | 3300053078 | Bacteria | 1587 |
| 237 | Ga0500616_0003087 | 3300053153 | Bacteria | 13073 |
| 238 | Ga0500637_0138506 | 3300053178 | Bacteria | 1409 |
| 239 | Ga0466962_0002253 | 3300061719 | Bacteria | 9136 |
| 240 | Ga0466962_0012102 | 3300061719 | Bacteria | 4148 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10068557 | Ga0157369_100685572 | 231 |
| 2 | 3300009147 | Ga0114129_10257977 | Ga0114129_102579772 | 262 |
| 3 | 3300050507 | nmdc:mga05p37_175473_c1 | nmdc:mga05p37_175473_c1_142_951 | 262 |
| 4 | 3300013308 | Ga0157375_10368274 | Ga0157375_103682742 | 263 |
| 5 | 3300047319 | Ga0495674_0353488 | Ga0495674_0353488_60_854 | 263 |
| 6 | 3300048905 | Ga0496102_0192224 | Ga0496102_0192224_275_1072 | 263 |
| 7 | 3300048921 | Ga0496118_0151006 | Ga0496118_0151006_275_1072 | 263 |
| 8 | 3300048922 | Ga0496119_0044880 | Ga0496119_0044880_1972_2763 | 263 |
| 9 | 3300048915 | Ga0496112_0225952 | Ga0496112_0225952_1014_1814 | 266 |
| 10 | 3300013102 | Ga0157371_10092965 | Ga0157371_100929652 | 267 |
| 11 | 3300006048 | Ga0075363_100050073 | Ga0075363_1000500732 | 270 |
| 12 | 3300044684 | Ga0466966_0044209 | Ga0466966_0044209_1552_2409 | 270 |
| 13 | 3300044842 | Ga0466957_0165703 | Ga0466957_0165703_553_1410 | 270 |
| 14 | 3300006175 | Ga0070712_100061074 | Ga0070712_1000610742 | 271 |
| 15 | 3300025928 | Ga0207700_10001687 | Ga0207700_100016876 | 271 |
| 16 | iso_pu_bacteria | 2558860112 | 2558912630 | 273 |
| 17 | 3300005539 | Ga0068853_100355527 | Ga0068853_1003555272 | 277 |
| 18 | 3300049583 | Ga0501067_0022343 | Ga0501067_0022343_472_1311 | 278 |
| 19 | 3300005455 | Ga0070663_100000788 | Ga0070663_1000007887 | 279 |
| 20 | 3300026067 | Ga0207678_10000441 | Ga0207678_1000044128 | 279 |
| 21 | 3300046684 | Ga0495669_0000005 | Ga0495669_0000005_140391_141236 | 279 |
| 22 | 3300047471 | Ga0495684_0051450 | Ga0495684_0051450_2213_3106 | 279 |
| 23 | iso_pu_bacteria | 2508501039 | 2508677984 | 279 |
| 24 | iso_pu_bacteria | 2791355406 | 2793977802 | 279 |
| 25 | iso_pu_bacteria | 2899359706 | 2899360650 | 279 |
| 26 | iso_pu_bacteria | 2902792274 | 2902798249 | 279 |
| 27 | iso_pu_bacteria | 8002784119 | 8002786057 | 279 |
| 28 | iso_pu_bacteria | 8047893842 | 8047900759 | 279 |
| 29 | iso_pu_bacteria | 8048356638 | 8048358143 | 279 |
| 30 | iso_pu_bacteria | 8048369669 | 8048377700 | 279 |
| 31 | iso_pu_bacteria | 8048379754 | 8048386797 | 279 |
| 32 | 3300003756 | Ga0055533_1000225 | Ga0055533_100022538 | 280 |
| 33 | 3300006038 | Ga0075365_10021101 | Ga0075365_100211013 | 280 |
| 34 | 3300006051 | Ga0075364_10039979 | Ga0075364_100399795 | 280 |
| 35 | 3300006178 | Ga0075367_10129597 | Ga0075367_101295972 | 280 |
| 36 | 3300015687 | Ga0183368_1002 | Ga0183368_1002941 | 280 |
| 37 | 3300025904 | Ga0207647_10007558 | Ga0207647_100075582 | 280 |
| 38 | 3300033179 | Ga0307507_10015952 | Ga0307507_100159529 | 280 |
| 39 | 3300048905 | Ga0496102_0098169 | Ga0496102_0098169_1762_2610 | 280 |
| 40 | 3300048907 | Ga0496104_0130973 | Ga0496104_0130973_64_942 | 280 |
| 41 | 3300048918 | Ga0496115_0000170 | Ga0496115_0000170_15377_16255 | 280 |
| 42 | 3300049586 | Ga0501070_0052169 | Ga0501070_0052169_940_1788 | 280 |
| 43 | 3300050489 | nmdc:mga03683_61232_c1 | nmdc:mga03683_61232_c1_355_1200 | 280 |
| 44 | 3300050490 | nmdc:mga03n38_68240_c1 | nmdc:mga03n38_68240_c1_546_1391 | 280 |
| 45 | 3300050494 | nmdc:mga06z11_114845_c2 | nmdc:mga06z11_114845_c2_73_918 | 280 |
| 46 | 3300050495 | nmdc:mga04h51_83575_c1 | nmdc:mga04h51_83575_c1_249_1094 | 280 |
| 47 | 3300006042 | Ga0075368_10027223 | Ga0075368_100272232 | 281 |
| 48 | 3300006048 | Ga0075363_100051731 | Ga0075363_1000517312 | 281 |
| 49 | 3300006178 | Ga0075367_10002933 | Ga0075367_100029335 | 281 |
| 50 | 3300039437 | Ga0436365_0845494 | Ga0436365_0845494_2811_3662 | 282 |
| 51 | 3300044842 | Ga0466957_0276222 | Ga0466957_0276222_31_894 | 282 |
| 52 | 3300001991 | JGI24743J22301_10002724 | JGI24743J22301_100027244 | 283 |
| 53 | 3300001991 | JGI24743J22301_10003790 | JGI24743J22301_100037904 | 283 |
| 54 | 3300003215 | JGI25153J46596_10005169 | JGI25153J46596_100051695 | 283 |
| 55 | 3300005334 | Ga0068869_100056468 | Ga0068869_1000564682 | 283 |
| 56 | 3300005338 | Ga0068868_100120875 | Ga0068868_1001208754 | 283 |
| 57 | 3300005339 | Ga0070660_100017590 | Ga0070660_1000175901 | 283 |
| 58 | 3300005347 | Ga0070668_100239715 | Ga0070668_1002397152 | 283 |
| 59 | 3300005355 | Ga0070671_100125093 | Ga0070671_1001250932 | 283 |
| 60 | 3300005365 | Ga0070688_100034762 | Ga0070688_1000347621 | 283 |
| 61 | 3300005367 | Ga0070667_100019932 | Ga0070667_1000199327 | 283 |
| 62 | 3300005367 | Ga0070667_100214300 | Ga0070667_1002143003 | 283 |
| 63 | 3300005437 | Ga0070710_10015230 | Ga0070710_100152302 | 283 |
| 64 | 3300005437 | Ga0070710_10016910 | Ga0070710_100169105 | 283 |
| 65 | 3300005437 | Ga0070710_10057025 | Ga0070710_100570252 | 283 |
| 66 | 3300005438 | Ga0070701_10057237 | Ga0070701_100572372 | 283 |
| 67 | 3300005439 | Ga0070711_100089234 | Ga0070711_1000892344 | 283 |
| 68 | 3300005440 | Ga0070705_100131616 | Ga0070705_1001316163 | 283 |
| 69 | 3300005444 | Ga0070694_100037846 | Ga0070694_1000378464 | 283 |
| 70 | 3300005456 | Ga0070678_100254574 | Ga0070678_1002545742 | 283 |
| 71 | 3300005458 | Ga0070681_10099579 | Ga0070681_100995792 | 283 |
| 72 | 3300005458 | Ga0070681_10279686 | Ga0070681_102796862 | 283 |
| 73 | 3300005466 | Ga0070685_10012423 | Ga0070685_100124235 | 283 |
| 74 | 3300005468 | Ga0070707_100353046 | Ga0070707_1003530461 | 283 |
| 75 | 3300005530 | Ga0070679_100056719 | Ga0070679_1000567191 | 283 |
| 76 | 3300005563 | Ga0068855_100017159 | Ga0068855_1000171596 | 283 |
| 77 | 3300005563 | Ga0068855_100550834 | Ga0068855_1005508341 | 283 |
| 78 | 3300005578 | Ga0068854_100158226 | Ga0068854_1001582262 | 283 |
| 79 | 3300005615 | Ga0070702_100066317 | Ga0070702_1000663172 | 283 |
| 80 | 3300005616 | Ga0068852_100305713 | Ga0068852_1003057132 | 283 |
| 81 | 3300005617 | Ga0068859_100000044 | Ga0068859_100000044140 | 283 |
| 82 | 3300005617 | Ga0068859_100002525 | Ga0068859_1000025252 | 283 |
| 83 | 3300005617 | Ga0068859_100196337 | Ga0068859_1001963374 | 283 |
| 84 | 3300005618 | Ga0068864_100212487 | Ga0068864_1002124874 | 283 |
| 85 | 3300005718 | Ga0068866_10039271 | Ga0068866_100392711 | 283 |
| 86 | 3300005719 | Ga0068861_100106847 | Ga0068861_1001068475 | 283 |
| 87 | 3300005841 | Ga0068863_100002873 | Ga0068863_10000287310 | 283 |
| 88 | 3300005842 | Ga0068858_100054705 | Ga0068858_1000547054 | 283 |
| 89 | 3300005843 | Ga0068860_100000023 | Ga0068860_100000023140 | 283 |
| 90 | 3300005844 | Ga0068862_100000582 | Ga0068862_10000058225 | 283 |
| 91 | 3300005844 | Ga0068862_100039300 | Ga0068862_1000393003 | 283 |
| 92 | 3300005844 | Ga0068862_100187437 | Ga0068862_1001874374 | 283 |
| 93 | 3300006038 | Ga0075365_10023404 | Ga0075365_100234044 | 283 |
| 94 | 3300006038 | Ga0075365_10023875 | Ga0075365_100238751 | 283 |
| 95 | 3300006048 | Ga0075363_100014560 | Ga0075363_1000145601 | 283 |
| 96 | 3300006051 | Ga0075364_10001374 | Ga0075364_100013747 | 283 |
| 97 | 3300006173 | Ga0070716_100016645 | Ga0070716_1000166452 | 283 |
| 98 | 3300006175 | Ga0070712_100056923 | Ga0070712_1000569234 | 283 |
| 99 | 3300006177 | Ga0075362_10069087 | Ga0075362_100690872 | 283 |
| 100 | 3300006186 | Ga0075369_10000980 | Ga0075369_100009807 | 283 |
| 101 | 3300006186 | Ga0075369_10003527 | Ga0075369_100035276 | 283 |
| 102 | 3300006186 | Ga0075369_10012578 | Ga0075369_100125784 | 283 |
| 103 | 3300006353 | Ga0075370_10029695 | Ga0075370_100296954 | 283 |
| 104 | 3300006931 | Ga0097620_100000044 | Ga0097620_100000044140 | 283 |
| 105 | 3300006931 | Ga0097620_100002525 | Ga0097620_1000025252 | 283 |
| 106 | 3300006931 | Ga0097620_100196346 | Ga0097620_1001963464 | 283 |
| 107 | 3300009093 | Ga0105240_10078888 | Ga0105240_100788883 | 283 |
| 108 | 3300009101 | Ga0105247_10001998 | Ga0105247_1000199813 | 283 |
| 109 | 3300009101 | Ga0105247_10015654 | Ga0105247_100156544 | 283 |
| 110 | 3300009545 | Ga0105237_10007957 | Ga0105237_100079572 | 283 |
| 111 | 3300009551 | Ga0105238_10020468 | Ga0105238_1002046810 | 283 |
| 112 | 3300009551 | Ga0105238_10039168 | Ga0105238_100391683 | 283 |
| 113 | 3300009551 | Ga0105238_10159296 | Ga0105238_101592962 | 283 |
| 114 | 3300009553 | Ga0105249_10001175 | Ga0105249_1000117520 | 283 |
| 115 | 3300009553 | Ga0105249_10033047 | Ga0105249_100330473 | 283 |
| 116 | 3300009553 | Ga0105249_10341596 | Ga0105249_103415961 | 283 |
| 117 | 3300010375 | Ga0105239_10000356 | Ga0105239_1000035615 | 283 |
| 118 | 3300010375 | Ga0105239_10018300 | Ga0105239_1001830011 | 283 |
| 119 | 3300010375 | Ga0105239_10332160 | Ga0105239_103321602 | 283 |
| 120 | 3300013104 | Ga0157370_10203305 | Ga0157370_102033052 | 283 |
| 121 | 3300013297 | Ga0157378_10140367 | Ga0157378_101403674 | 283 |
| 122 | 3300013306 | Ga0163162_10658460 | Ga0163162_106584602 | 283 |
| 123 | 3300013307 | Ga0157372_10362832 | Ga0157372_103628322 | 283 |
| 124 | 3300013308 | Ga0157375_10006206 | Ga0157375_100062063 | 283 |
| 125 | 3300014325 | Ga0163163_10012169 | Ga0163163_100121698 | 283 |
| 126 | 3300014325 | Ga0163163_10386529 | Ga0163163_103865292 | 283 |
| 127 | 3300014968 | Ga0157379_10685186 | Ga0157379_106851861 | 283 |
| 128 | 3300017792 | Ga0163161_10174330 | Ga0163161_101743301 | 283 |
| 129 | 3300025297 | Ga0209758_1000048 | Ga0209758_1000048193 | 283 |
| 130 | 3300025297 | Ga0209758_1000128 | Ga0209758_100012852 | 283 |
| 131 | 3300025297 | Ga0209758_1029414 | Ga0209758_10294142 | 283 |
| 132 | 3300025304 | Ga0209257_1024602 | Ga0209257_10246022 | 283 |
| 133 | 3300025900 | Ga0207710_10000072 | Ga0207710_1000007244 | 283 |
| 134 | 3300025901 | Ga0207688_10015760 | Ga0207688_100157605 | 283 |
| 135 | 3300025904 | Ga0207647_10039225 | Ga0207647_100392254 | 283 |
| 136 | 3300025909 | Ga0207705_10010171 | Ga0207705_100101716 | 283 |
| 137 | 3300025913 | Ga0207695_10008309 | Ga0207695_1000830914 | 283 |
| 138 | 3300025913 | Ga0207695_10222359 | Ga0207695_102223592 | 283 |
| 139 | 3300025914 | Ga0207671_10016848 | Ga0207671_100168488 | 283 |
| 140 | 3300025915 | Ga0207693_10078668 | Ga0207693_100786684 | 283 |
| 141 | 3300025915 | Ga0207693_10175520 | Ga0207693_101755202 | 283 |
| 142 | 3300025916 | Ga0207663_10156940 | Ga0207663_101569402 | 283 |
| 143 | 3300025917 | Ga0207660_10220681 | Ga0207660_102206812 | 283 |
| 144 | 3300025921 | Ga0207652_10038590 | Ga0207652_100385902 | 283 |
| 145 | 3300025922 | Ga0207646_10118711 | Ga0207646_101187111 | 283 |
| 146 | 3300025924 | Ga0207694_10052045 | Ga0207694_100520452 | 283 |
| 147 | 3300025924 | Ga0207694_10254409 | Ga0207694_102544092 | 283 |
| 148 | 3300025927 | Ga0207687_10130105 | Ga0207687_101301055 | 283 |
| 149 | 3300025929 | Ga0207664_10033835 | Ga0207664_100338354 | 283 |
| 150 | 3300025931 | Ga0207644_10229309 | Ga0207644_102293092 | 283 |
| 151 | 3300025939 | Ga0207665_10019241 | Ga0207665_100192413 | 283 |
| 152 | 3300025939 | Ga0207665_10019674 | Ga0207665_100196744 | 283 |
| 153 | 3300025940 | Ga0207691_10024897 | Ga0207691_100248974 | 283 |
| 154 | 3300025942 | Ga0207689_10030701 | Ga0207689_100307014 | 283 |
| 155 | 3300025949 | Ga0207667_10002773 | Ga0207667_1000277311 | 283 |
| 156 | 3300025961 | Ga0207712_10011981 | Ga0207712_100119812 | 283 |
| 157 | 3300025961 | Ga0207712_10038275 | Ga0207712_100382753 | 283 |
| 158 | 3300025972 | Ga0207668_10241380 | Ga0207668_102413802 | 283 |
| 159 | 3300025981 | Ga0207640_10003348 | Ga0207640_100033486 | 283 |
| 160 | 3300025986 | Ga0207658_10012942 | Ga0207658_100129427 | 283 |
| 161 | 3300025986 | Ga0207658_10449985 | Ga0207658_104499851 | 283 |
| 162 | 3300026035 | Ga0207703_10000002 | Ga0207703_10000002416 | 283 |
| 163 | 3300026041 | Ga0207639_10114963 | Ga0207639_101149633 | 283 |
| 164 | 3300026067 | Ga0207678_10362788 | Ga0207678_103627881 | 283 |
| 165 | 3300026075 | Ga0207708_10032029 | Ga0207708_100320291 | 283 |
| 166 | 3300026088 | Ga0207641_10001713 | Ga0207641_1000171310 | 283 |
| 167 | 3300026088 | Ga0207641_10089736 | Ga0207641_100897364 | 283 |
| 168 | 3300026089 | Ga0207648_10294004 | Ga0207648_102940042 | 283 |
| 169 | 3300026095 | Ga0207676_10499628 | Ga0207676_104996281 | 283 |
| 170 | 3300026118 | Ga0207675_100315416 | Ga0207675_1003154162 | 283 |
| 171 | 3300026121 | Ga0207683_10033755 | Ga0207683_100337552 | 283 |
| 172 | 3300028379 | Ga0268266_10019158 | Ga0268266_100191586 | 283 |
| 173 | 3300028379 | Ga0268266_10146684 | Ga0268266_101466842 | 283 |
| 174 | 3300028380 | Ga0268265_10000205 | Ga0268265_1000020526 | 283 |
| 175 | 3300028380 | Ga0268265_10047353 | Ga0268265_100473534 | 283 |
| 176 | 3300028380 | Ga0268265_10278078 | Ga0268265_102780782 | 283 |
| 177 | 3300028381 | Ga0268264_10000008 | Ga0268264_10000008120 | 283 |
| 178 | 3300028794 | Ga0307515_10013555 | Ga0307515_1001355510 | 283 |
| 179 | 3300031730 | Ga0307516_10002519 | Ga0307516_100025194 | 283 |
| 180 | 3300035086 | Ga0373934_0074437 | Ga0373934_0074437_145_1002 | 283 |
| 181 | 3300035088 | Ga0373940_0038442 | Ga0373940_0038442_43_894 | 283 |
| 182 | 3300035242 | Ga0373962_0099236 | Ga0373962_0099236_15_866 | 283 |
| 183 | 3300045976 | Ga0466967_0161463 | Ga0466967_0161463_773_1624 | 283 |
| 184 | 3300046455 | Ga0495603_0031883 | Ga0495603_0031883_440_1315 | 283 |
| 185 | 3300046462 | Ga0495651_0117021 | Ga0495651_0117021_251_1108 | 283 |
| 186 | 3300046472 | Ga0495580_0011912 | Ga0495580_0011912_2594_3469 | 283 |
| 187 | 3300046477 | Ga0495664_0248203 | Ga0495664_0248203_126_983 | 283 |
| 188 | 3300046500 | Ga0495596_0000235 | Ga0495596_0000235_5057_5932 | 283 |
| 189 | 3300046526 | Ga0495666_0002741 | Ga0495666_0002741_830_1705 | 283 |
| 190 | 3300046543 | Ga0495645_0018958 | Ga0495645_0018958_2854_3711 | 283 |
| 191 | 3300046663 | Ga0495635_0350600 | Ga0495635_0350600_32_883 | 283 |
| 192 | 3300046665 | Ga0495661_0001916 | Ga0495661_0001916_15118_15993 | 283 |
| 193 | 3300046678 | Ga0495599_0063759 | Ga0495599_0063759_729_1670 | 283 |
| 194 | 3300046679 | Ga0495623_0010035 | Ga0495623_0010035_2276_3217 | 283 |
| 195 | 3300046689 | Ga0495613_0012053 | Ga0495613_0012053_5219_6094 | 283 |
| 196 | 3300046690 | Ga0495624_0302959 | Ga0495624_0302959_77_937 | 283 |
| 197 | 3300046794 | Ga0495589_0003421 | Ga0495589_0003421_3349_4224 | 283 |
| 198 | 3300047317 | Ga0495604_0001868 | Ga0495604_0001868_16031_16972 | 283 |
| 199 | 3300047317 | Ga0495604_0024267 | Ga0495604_0024267_3920_4777 | 283 |
| 200 | 3300047320 | Ga0495672_0077211 | Ga0495672_0077211_774_1625 | 283 |
| 201 | 3300047322 | Ga0495680_0018868 | Ga0495680_0018868_1073_2014 | 283 |
| 202 | 3300047323 | Ga0495683_0006568 | Ga0495683_0006568_4588_5463 | 283 |
| 203 | 3300047444 | Ga0495675_0007913 | Ga0495675_0007913_1858_2733 | 283 |
| 204 | 3300047444 | Ga0495675_0011800 | Ga0495675_0011800_3346_4287 | 283 |
| 205 | 3300047446 | Ga0495679_000478 | Ga0495679_000478_17087_17962 | 283 |
| 206 | 3300047469 | Ga0495673_0003136 | Ga0495673_0003136_1791_2666 | 283 |
| 207 | 3300047673 | Ga0495593_0018919 | Ga0495593_0018919_1917_2792 | 283 |
| 208 | 3300048088 | Ga0495602_0006286 | Ga0495602_0006286_4174_5115 | 283 |
| 209 | 3300048089 | Ga0495614_0006757 | Ga0495614_0006757_3801_4676 | 283 |
| 210 | 3300048904 | Ga0496101_0000094 | Ga0496101_0000094_62355_63206 | 283 |
| 211 | 3300048904 | Ga0496101_0478096 | Ga0496101_0478096_10_861 | 283 |
| 212 | 3300048905 | Ga0496102_0000014 | Ga0496102_0000014_179146_179997 | 283 |
| 213 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_179652_180503 | 283 |
| 214 | 3300048907 | Ga0496104_0713251 | Ga0496104_0713251_23_874 | 283 |
| 215 | 3300048909 | Ga0496106_0020856 | Ga0496106_0020856_566_1417 | 283 |
| 216 | 3300048911 | Ga0496108_0001502 | Ga0496108_0001502_5896_6747 | 283 |
| 217 | 3300048912 | Ga0496109_0006002 | Ga0496109_0006002_7657_8508 | 283 |
| 218 | 3300048912 | Ga0496109_0061463 | Ga0496109_0061463_1039_1890 | 283 |
| 219 | 3300048913 | Ga0496110_0238962 | Ga0496110_0238962_457_1314 | 283 |
| 220 | 3300048913 | Ga0496110_0468103 | Ga0496110_0468103_205_1056 | 283 |
| 221 | 3300048915 | Ga0496112_0003000 | Ga0496112_0003000_7877_8728 | 283 |
| 222 | 3300048918 | Ga0496115_0051309 | Ga0496115_0051309_1394_2251 | 283 |
| 223 | 3300048919 | Ga0496116_0000069 | Ga0496116_0000069_180603_181454 | 283 |
| 224 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1378055_1378906 | 283 |
| 225 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1378058_1378909 | 283 |
| 226 | 3300048922 | Ga0496119_0001073 | Ga0496119_0001073_24976_25827 | 283 |
| 227 | 3300048922 | Ga0496119_0003510 | Ga0496119_0003510_2360_3217 | 283 |
| 228 | 3300048924 | Ga0496121_0000032 | Ga0496121_0000032_270824_271675 | 283 |
| 229 | 3300048924 | Ga0496121_0000882 | Ga0496121_0000882_38340_39197 | 283 |
| 230 | 3300048929 | Ga0496126_0000067 | Ga0496126_0000067_130122_130973 | 283 |
| 231 | 3300048929 | Ga0496126_0000393 | Ga0496126_0000393_84889_85749 | 283 |
| 232 | 3300048929 | Ga0496126_0023127 | Ga0496126_0023127_4558_5418 | 283 |
| 233 | 3300048929 | Ga0496126_0122388 | Ga0496126_0122388_603_1454 | 283 |
| 234 | 3300049460 | Ga0495682_0008253 | Ga0495682_0008253_2656_3531 | 283 |
| 235 | 3300050489 | nmdc:mga03683_128575_c1 | nmdc:mga03683_128575_c1_240_1091 | 283 |
| 236 | 3300050489 | nmdc:mga03683_2251_c1 | nmdc:mga03683_2251_c1_454_1314 | 283 |
| 237 | 3300050491 | nmdc:mga00v17_1723_c1 | nmdc:mga00v17_1723_c1_7576_8448 | 283 |
| 238 | 3300050491 | nmdc:mga00v17_50233_c1 | nmdc:mga00v17_50233_c1_1350_2201 | 283 |
| 239 | 3300050492 | nmdc:mga0yw44_17450_c1 | nmdc:mga0yw44_17450_c1_26_898 | 283 |
| 240 | 3300050492 | nmdc:mga0yw44_69467_c1 | nmdc:mga0yw44_69467_c1_1275_2126 | 283 |
| 241 | 3300050494 | nmdc:mga06z11_40240_c1 | nmdc:mga06z11_40240_c1_1113_1973 | 283 |
| 242 | 3300050496 | nmdc:mga07m45_16349_c1 | nmdc:mga07m45_16349_c1_1681_2541 | 283 |
| 243 | 3300050516 | nmdc:mga0sz30_11868_c1 | nmdc:mga0sz30_11868_c1_444_1304 | 283 |
| 244 | 3300050516 | nmdc:mga0sz30_12989_c1 | nmdc:mga0sz30_12989_c1_1889_2740 | 283 |
| 245 | 3300050516 | nmdc:mga0sz30_4145_c1 | nmdc:mga0sz30_4145_c1_2976_3848 | 283 |
| 246 | 3300053078 | Ga0495612_0058935 | Ga0495612_0058935_481_1338 | 283 |
| 247 | 3300053153 | Ga0500616_0003087 | Ga0500616_0003087_3825_4676 | 283 |
| 248 | 3300053178 | Ga0500637_0138506 | Ga0500637_0138506_111_971 | 283 |
| 249 | 3300061719 | Ga0466962_0002253 | Ga0466962_0002253_667_1524 | 283 |
| 250 | 3300061719 | Ga0466962_0012102 | Ga0466962_0012102_2280_3137 | 283 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2uyo-assembly1.cif.gz_A | crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form | 0.7589 | 9 | 282 |
| 6id6-assembly1.cif.gz_A | crystal structure of rv0731c from mycobacterium tuberculosis at 1.63 angstroms. | 0.7549 | 8 | 282 |
| 2ckd-assembly2.cif.gz_B | crystal structure of ml2640 from mycobacterium leprae | 0.7543 | 7 | 282 |
| 2uyo-assembly1.cif.gz_A | crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form | 0.7489 | 9 | 282 |
| 2uyq-assembly1.cif.gz_A | crystal structure of ml2640c from mycobacterium leprae in complex with s-adenosylmethionine | 0.7457 | 9 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YEA3_2_289_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8541 | 10 | 283 | 3.40.50.150 |
| af_I6YEA3_2_289_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8261 | 10 | 283 | 3.40.50.150 |
| af_B3H6G9_58_302_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8161 | 11 | 282 | 3.40.50.150 |
| af_Q8BYR1_3_315_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7995 | 10 | 282 | 3.40.50.150 |
| af_P46554_9_333_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.796 | 11 | 283 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A543FEY3-F1-model_v4 | S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) | 0.993 | 6 | 283 |
GO:0008168
GO:0032259 |
| AF-A0A7W9TXL1-F1-model_v4 | S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) | 0.9903 | 6 | 168 |
GO:0008168
GO:0032259 |
| AF-Q0RHY3-F1-model_v4 | S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) | 0.9895 | 7 | 283 |
GO:0008168
GO:0032259 |
| AF-B1T671-F1-model_v4 | S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) | 0.9892 | 53 | 283 |
GO:0008168
GO:0032259 |
| AF-A0A8B6LYY5-F1-model_v4 | S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) | 0.9865 | 6 | 283 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar