F361263

General Info

Members Datasets Scaffolds Average Seq Length
250 161 500 277

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10204657|rootL2_102046571
Length 300
Sequence VRLATARLTEPTGVRTAAVRVEADTLVELPFADVGALLATPGWHAAAAADGPEHAWAAAVFAPVVPRPSKVVCVGLNYRNHIQEMGRDLPEHPTLFAKFADCLVGAADDVVRPAETAEFDWEVELAVVVGRADAAPVRRADERAAIAAIAGFTVLNDLSCRDWQFRTREWLQGKAWDSTTPVGPWLVTPDEVGGVRPALTVTCSVDGVVMQSDSTGDLLFDPVDLVRYVSTVVRLNPGDIIATGTPGGVGHARKPPVYLDGGELLVTEIEGIGRLANRVVNDLAVAGADAVTEVGSGAPA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
67 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
68 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
132 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
135 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
136 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
137 2643221711 Terrabacter sp. Root85 Isolate Unclassified
138 2687453737 Frankia sp. BMG5.36 Isolate Nodule
139 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
140 2739367898 Nocardioides sp. CF479 Isolate Unclassified
141 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
142 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
143 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
144 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
145 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
146 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
147 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
148 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
149 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
150 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
151 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
152 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
153 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
154 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
155 2919069694 Microbacterium sp. 1154 Isolate Unclassified
156 2920879853 Kocuria salina CV6 Isolate Unclassified
157 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
158 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
159 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
160 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
161 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.2
Metatranscriptomes 0
Isolates 10.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 2
Nodule 0.4
Rhizoplane 8
Rhizosphere 76.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10204657 3300003322 Bacteria 1937
2 JGI24739J22299_10035032 3300001989 Bacteria 1704
3 Ga0070683_100013229 3300005329 Bacteria 7190
4 Ga0070683_100324095 3300005329 Bacteria 1466
5 Ga0068868_100023933 3300005338 Bacteria 4628
6 Ga0070692_10010205 3300005345 Bacteria 4266
7 Ga0070668_100078124 3300005347 Bacteria 2588
8 Ga0070659_100258381 3300005366 Bacteria 1445
9 Ga0070667_100182562 3300005367 Bacteria 1856
10 Ga0070713_100011194 3300005436 Bacteria 6523
11 Ga0070701_10043821 3300005438 Bacteria 2291
12 Ga0070700_100104711 3300005441 Bacteria 1870
13 Ga0070708_100000869 3300005445 Bacteria 22803
14 Ga0070708_100012274 3300005445 Bacteria 6984
15 Ga0070708_100025180 3300005445 Bacteria 5085
16 Ga0070708_100085252 3300005445 Bacteria 2867
17 Ga0070678_100345457 3300005456 Bacteria 1278
18 Ga0070685_10023761 3300005466 Bacteria 3359
19 Ga0070706_100005869 3300005467 Bacteria 11642
20 Ga0070706_100059715 3300005467 Bacteria 3520
21 Ga0070706_100103418 3300005467 Bacteria 2648
22 Ga0070707_100005628 3300005468 Bacteria 11709
23 Ga0070707_100016520 3300005468 Bacteria 6927
24 Ga0070698_100052376 3300005471 Bacteria 4152
25 Ga0070699_100448090 3300005518 Bacteria 1170
26 Ga0070684_100030296 3300005535 Bacteria 4596
27 Ga0070697_100664686 3300005536 Bacteria 918
28 Ga0070672_100193058 3300005543 Bacteria 1701
29 Ga0068861_100023132 3300005719 Bacteria 4480
30 Ga0068870_10020582 3300005840 Bacteria 3215
31 Ga0068863_100088188 3300005841 Bacteria 2940
32 Ga0068860_100049021 3300005843 Bacteria 4025
33 Ga0068860_100634142 3300005843 Bacteria 1076
34 Ga0068862_100149648 3300005844 Bacteria 2077
35 Ga0081455_10064172 3300005937 Bacteria 3077
36 Ga0068865_100167506 3300006881 Bacteria 1681
37 Ga0105245_10036190 3300009098 Bacteria 4384
38 Ga0105243_10008159 3300009148 Bacteria 8042
39 Ga0105243_10388831 3300009148 Bacteria 1292
40 Ga0105243_10566873 3300009148 Bacteria 1088
41 Ga0105243_10649470 3300009148 Bacteria 1022
42 Ga0105238_10702942 3300009551 Bacteria 1023
43 Ga0105246_10053281 3300011119 Bacteria 2783
44 Ga0157372_10073062 3300013307 Bacteria 3865
45 Ga0163163_10214039 3300014325 Bacteria 1976
46 Ga0209051_1001424 3300025303 Bacteria 20480
47 Ga0207647_10029979 3300025904 Bacteria 3514
48 Ga0207647_10159889 3300025904 Bacteria 1314
49 Ga0207643_10026815 3300025908 Bacteria 3192
50 Ga0207684_10008986 3300025910 Bacteria 8859
51 Ga0207684_10032084 3300025910 Bacteria 4467
52 Ga0207684_10085697 3300025910 Bacteria 2683
53 Ga0207646_10043945 3300025922 Bacteria 4010
54 Ga0207646_10049171 3300025922 Bacteria 3777
55 Ga0207650_10095302 3300025925 Bacteria 2281
56 Ga0207687_10336716 3300025927 Bacteria 1226
57 Ga0207664_10097277 3300025929 Bacteria 2424
58 Ga0207690_10198513 3300025932 Bacteria 1522
59 Ga0207709_10103768 3300025935 Bacteria 1885
60 Ga0207691_10181161 3300025940 Bacteria 1841
61 Ga0207661_10031738 3300025944 Bacteria 4085
62 Ga0207661_10490980 3300025944 Bacteria 1122
63 Ga0207677_10031383 3300026023 Bacteria 3403
64 Ga0207641_10144486 3300026088 Bacteria 2150
65 Ga0207648_10017973 3300026089 Bacteria 6413
66 Ga0207675_100037829 3300026118 Bacteria 4501
67 Ga0268264_10094363 3300028381 Bacteria 2586
68 Ga0265338_10013709 3300028800 Bacteria 9117
69 Ga0307511_10000546 3300030521 Bacteria 40380
70 Ga0307511_10001828 3300030521 Bacteria 22370
71 Ga0307512_10002417 3300030522 Bacteria 23737
72 Ga0307512_10168503 3300030522 Bacteria 1262
73 Ga0265327_10017868 3300031251 Bacteria 4424
74 Ga0265327_10049066 3300031251 Bacteria 2216
75 Ga0265327_10093693 3300031251 Bacteria 1461
76 Ga0307508_10087443 3300031616 Bacteria 2701
77 Ga0307508_10121934 3300031616 Bacteria 2210
78 Ga0307508_10180226 3300031616 Bacteria 1715
79 Ga0307516_10022660 3300031730 Bacteria 6447
80 Ga0307518_10147559 3300031838 Bacteria 1631
81 Ga0307518_10207634 3300031838 Bacteria 1293
82 Ga0307410_10231027 3300031852 Bacteria 1428
83 Ga0307416_100330978 3300032002 Bacteria 1531
84 Ga0307416_100394381 3300032002 Bacteria 1419
85 Ga0373962_0002506 3300035242 Bacteria 4360
86 Ga0373937_0152123 3300036401 Bacteria 2168
87 Ga0395898_0198533 3300037466 Bacteria 1916
88 Ga0395901_0425410 3300038443 Bacteria 1361
89 Ga0436365_0765781 3300039437 Bacteria 7365
90 Ga0451789_0334088 3300041443 Bacteria 3211
91 Ga0451791_0362825 3300041451 Bacteria 2675
92 Ga0451802_1244891 3300041460 Bacteria 1219
93 Ga0451853_1723901 3300041512 Bacteria 2765
94 Ga0466969_0048345 3300044656 Bacteria 2103
95 Ga0466966_0049357 3300044684 Bacteria 2680
96 Ga0466961_0002728 3300044693 Bacteria 10981
97 Ga0466971_0009988 3300044719 Bacteria 4146
98 Ga0466968_0135474 3300044735 Bacteria 1123
99 Ga0466970_0106885 3300044765 Bacteria 1527
100 Ga0466959_0042791 3300045049 Bacteria 3340
101 Ga0495617_005354 3300046452 Bacteria 4558
102 Ga0495603_0002760 3300046455 Bacteria 10349
103 Ga0495603_0009191 3300046455 Bacteria 5973
104 Ga0495629_0010318 3300046459 Bacteria 6806
105 Ga0495650_0015460 3300046471 Bacteria 3914
106 Ga0495585_0028636 3300046492 Bacteria 3176
107 Ga0495585_0050932 3300046492 Bacteria 2296
108 Ga0495594_0016210 3300046499 Bacteria 3923
109 Ga0495594_0061467 3300046499 Bacteria 2079
110 Ga0495628_0045329 3300046516 Bacteria 3497
111 Ga0495666_0008676 3300046526 Bacteria 5093
112 Ga0495652_0246574 3300046529 Bacteria 1326
113 Ga0495622_0000764 3300046557 Bacteria 17980
114 Ga0495668_0148356 3300046616 Bacteria 1284
115 Ga0495611_0000581 3300046648 Bacteria 21096
116 Ga0495611_0002298 3300046648 Bacteria 8842
117 Ga0495635_0152211 3300046663 Bacteria 1575
118 Ga0495613_0008088 3300046689 Bacteria 7818
119 Ga0495670_0048443 3300046691 Bacteria 2126
120 Ga0495589_0001697 3300046794 Bacteria 12566
121 Ga0495589_0006920 3300046794 Bacteria 5957
122 Ga0495589_0021635 3300046794 Bacteria 3286
123 Ga0495636_0068284 3300047318 Bacteria 1513
124 Ga0495676_0001027 3300047321 Bacteria 23623
125 Ga0495683_0015965 3300047323 Bacteria 3901
126 Ga0495685_000555 3300047447 Bacteria 11574
127 Ga0495685_016044 3300047447 Bacteria 2559
128 Ga0495614_0000357 3300048089 Bacteria 18281
129 Ga0496101_0188955 3300048904 Bacteria 1589
130 Ga0496105_0014159 3300048908 Bacteria 6346
131 Ga0496105_0139651 3300048908 Bacteria 1995
132 Ga0496108_0010857 3300048911 Bacteria 7393
133 Ga0496108_0151718 3300048911 Bacteria 2000
134 Ga0496108_0201110 3300048911 Bacteria 1729
135 Ga0496108_0273970 3300048911 Bacteria 1469
136 Ga0496109_0014609 3300048912 Bacteria 6831
137 Ga0496109_0346565 3300048912 Bacteria 1403
138 Ga0496109_0413988 3300048912 Bacteria 1273
139 Ga0496110_0057738 3300048913 Bacteria 3417
140 Ga0496111_0013972 3300048914 Bacteria 5476
141 Ga0496111_0175883 3300048914 Bacteria 1591
142 Ga0496112_0189845 3300048915 Bacteria 2017
143 Ga0496114_0001052 3300048917 Bacteria 20732
144 Ga0496114_0053344 3300048917 Bacteria 3370
145 Ga0496114_0218379 3300048917 Bacteria 1673
146 Ga0496126_0007532 3300048929 Bacteria 11915
147 Ga0501031_0337388 3300049568 Bacteria 976
148 Ga0501032_0013378 3300049569 Bacteria 5839
149 Ga0501032_0035427 3300049569 Bacteria 3411
150 Ga0501032_0085998 3300049569 Bacteria 2090
151 Ga0501032_0241320 3300049569 Bacteria 1174
152 Ga0501033_0000203 3300049570 Bacteria 56963
153 Ga0501033_0004864 3300049570 Bacteria 10697
154 Ga0501034_0002407 3300049571 Bacteria 22652
155 Ga0501034_0006277 3300049571 Bacteria 12790
156 Ga0501034_0159268 3300049571 Bacteria 2230
157 Ga0501036_0000355 3300049572 Bacteria 32330
158 Ga0501036_0010928 3300049572 Bacteria 7504
159 Ga0501036_0177889 3300049572 Bacteria 1791
160 Ga0501036_0197350 3300049572 Bacteria 1693
161 Ga0501037_0012141 3300049573 Bacteria 6341
162 Ga0501037_0018015 3300049573 Bacteria 5200
163 Ga0501037_0019828 3300049573 Bacteria 4962
164 Ga0501037_0041227 3300049573 Bacteria 3395
165 Ga0501038_0000736 3300049574 Bacteria 29224
166 Ga0501038_0001817 3300049574 Bacteria 19766
167 Ga0501038_0026170 3300049574 Bacteria 5197
168 Ga0501038_0040539 3300049574 Bacteria 4066
169 Ga0501038_0058899 3300049574 Bacteria 3291
170 Ga0501039_0043152 3300049575 Bacteria 3484
171 Ga0501039_0048469 3300049575 Bacteria 3284
172 Ga0501039_0218267 3300049575 Bacteria 1499
173 Ga0501042_0004042 3300049578 Bacteria 9295
174 Ga0501042_0006011 3300049578 Bacteria 7861
175 Ga0501042_0049381 3300049578 Bacteria 3001
176 Ga0501043_0004801 3300049579 Bacteria 10947
177 Ga0501043_0049609 3300049579 Bacteria 3300
178 Ga0501043_0054944 3300049579 Bacteria 3128
179 Ga0501043_0153745 3300049579 Bacteria 1800
180 Ga0501043_0181230 3300049579 Bacteria 1641
181 Ga0501046_0000420 3300049580 Bacteria 42319
182 Ga0501046_0002448 3300049580 Bacteria 17403
183 Ga0501046_0010555 3300049580 Bacteria 7925
184 Ga0501046_0014188 3300049580 Bacteria 6730
185 Ga0501046_0260020 3300049580 Bacteria 1275
186 Ga0501047_0000092 3300049581 Bacteria 111389
187 Ga0501047_0004873 3300049581 Bacteria 12605
188 Ga0501047_0031436 3300049581 Bacteria 5120
189 Ga0501047_0034424 3300049581 Bacteria 4891
190 Ga0501047_0052087 3300049581 Bacteria 3955
191 Ga0501047_0074406 3300049581 Bacteria 3270
192 Ga0501047_0311191 3300049581 Bacteria 1415
193 Ga0501048_0015407 3300049582 Bacteria 5646
194 Ga0501048_0059836 3300049582 Bacteria 2699
195 Ga0501048_0078911 3300049582 Bacteria 2323
196 Ga0501070_0010512 3300049586 Bacteria 7825
197 Ga0501073_0012956 3300049589 Bacteria 6078
198 Ga0501073_0170369 3300049589 Bacteria 1507
199 Ga0501073_0438139 3300049589 Bacteria 903
200 Ga0501074_0000834 3300049590 Bacteria 19580
201 Ga0501080_0057630 3300049742 Bacteria 3617
202 Ga0501080_0331629 3300049742 Bacteria 1376
203 Ga0501083_0000285 3300049744 Bacteria 32138
204 Ga0501035_0000909 3300049822 Bacteria 31331
205 Ga0501035_0030426 3300049822 Bacteria 4921
206 Ga0501035_0084322 3300049822 Bacteria 2802
207 Ga0501035_0091537 3300049822 Bacteria 2676
208 Ga0501035_0148756 3300049822 Bacteria 2033
209 Ga0501044_0015322 3300049823 Bacteria 8257
210 Ga0501044_0025164 3300049823 Bacteria 6312
211 Ga0501044_0061852 3300049823 Bacteria 3829
212 Ga0501044_0143110 3300049823 Bacteria 2379
213 Ga0501044_0245482 3300049823 Bacteria 1733
214 Ga0501044_0362800 3300049823 Bacteria 1366
215 Ga0501044_0600366 3300049823 Bacteria 994
216 Ga0501045_0041699 3300049824 Bacteria 3340
217 nmdc:mga0yw44_285624_c1 3300050492 Bacteria 1103
218 nmdc:mga06z11_234321_c1 3300050494 Bacteria 1076
219 Ga0500556_0000467 3300053104 Bacteria 28516
220 Ga0500593_000077 3300053117 Bacteria 36560
221 Ga0590075_018317 3300059424 Bacteria 1731
222 Ga0466962_0032122 3300061719 Bacteria 2514
223 Ga0530510_0031594 3300061734 Bacteria 3807
224 2585296253 2582581312 Bacteria 7308206
225 2623586922 2622736626 Bacteria 7181580
226 2644609278 2643221711 Bacteria 4865335
227 2689963813 2687453737 Bacteria 11203906
228 2738892788 2738541308 Bacteria 7020677
229 2740167116 2739367898 Bacteria 4367674
230 2774380676 2773857758 Bacteria 3592392
231 2808874006 2808606365 Bacteria 4301966
232 2808895195 2808606370 Bacteria 4942454
233 2812348253 2811994878 Bacteria 5992952
234 2812483220 2811994917 Bacteria 7761064
235 2816506662 2816332139 Bacteria 9138787
236 2819428330 2818991318 Bacteria 5266538
237 2819730380 2818991469 Bacteria 4644110
238 2862512425 2862507626 Bacteria 9425308
239 2873315460 2873314349 Bacteria 8512634
240 2899364398 2899359706 Bacteria 10940472
241 2904512827 2904509784 Bacteria 3520416
242 2912729644 2912723979 Bacteria 8557534
243 2917736894 2917736166 Bacteria 9690793
244 2919073020 2919069694 Bacteria 3622919
245 2920883639 2920879853 Bacteria 4216831
246 2977231182 2977228692 Bacteria 3450105
247 2977239974 2977236895 Bacteria 3569373
248 2984545755 2984542743 Bacteria 3569378
249 3006501558 3006493962 Bacteria 8825450
250 8016257733 8016254467 Bacteria 3797036
251 rootL2_10204657
252 JGI24739J22299_10035032
253 Ga0070683_100013229
254 Ga0070683_100324095
255 Ga0068868_100023933
256 Ga0070692_10010205
257 Ga0070668_100078124
258 Ga0070659_100258381
259 Ga0070667_100182562
260 Ga0070713_100011194
261 Ga0070701_10043821
262 Ga0070700_100104711
263 Ga0070708_100000869
264 Ga0070708_100012274
265 Ga0070708_100025180
266 Ga0070708_100085252
267 Ga0070678_100345457
268 Ga0070685_10023761
269 Ga0070706_100005869
270 Ga0070706_100059715
271 Ga0070706_100103418
272 Ga0070707_100005628
273 Ga0070707_100016520
274 Ga0070698_100052376
275 Ga0070699_100448090
276 Ga0070684_100030296
277 Ga0070697_100664686
278 Ga0070672_100193058
279 Ga0068861_100023132
280 Ga0068870_10020582
281 Ga0068863_100088188
282 Ga0068860_100049021
283 Ga0068860_100634142
284 Ga0068862_100149648
285 Ga0081455_10064172
286 Ga0068865_100167506
287 Ga0105245_10036190
288 Ga0105243_10008159
289 Ga0105243_10388831
290 Ga0105243_10566873
291 Ga0105243_10649470
292 Ga0105238_10702942
293 Ga0105246_10053281
294 Ga0157372_10073062
295 Ga0163163_10214039
296 Ga0209051_1001424
297 Ga0207647_10029979
298 Ga0207647_10159889
299 Ga0207643_10026815
300 Ga0207684_10008986
301 Ga0207684_10032084
302 Ga0207684_10085697
303 Ga0207646_10043945
304 Ga0207646_10049171
305 Ga0207650_10095302
306 Ga0207687_10336716
307 Ga0207664_10097277
308 Ga0207690_10198513
309 Ga0207709_10103768
310 Ga0207691_10181161
311 Ga0207661_10031738
312 Ga0207661_10490980
313 Ga0207677_10031383
314 Ga0207641_10144486
315 Ga0207648_10017973
316 Ga0207675_100037829
317 Ga0268264_10094363
318 Ga0265338_10013709
319 Ga0307511_10000546
320 Ga0307511_10001828
321 Ga0307512_10002417
322 Ga0307512_10168503
323 Ga0265327_10017868
324 Ga0265327_10049066
325 Ga0265327_10093693
326 Ga0307508_10087443
327 Ga0307508_10121934
328 Ga0307508_10180226
329 Ga0307516_10022660
330 Ga0307518_10147559
331 Ga0307518_10207634
332 Ga0307410_10231027
333 Ga0307416_100330978
334 Ga0307416_100394381
335 Ga0373962_0002506
336 Ga0373937_0152123
337 Ga0395898_0198533
338 Ga0395901_0425410
339 Ga0436365_0765781
340 Ga0451789_0334088
341 Ga0451791_0362825
342 Ga0451802_1244891
343 Ga0451853_1723901
344 Ga0466969_0048345
345 Ga0466966_0049357
346 Ga0466961_0002728
347 Ga0466971_0009988
348 Ga0466968_0135474
349 Ga0466970_0106885
350 Ga0466959_0042791
351 Ga0495617_005354
352 Ga0495603_0002760
353 Ga0495603_0009191
354 Ga0495629_0010318
355 Ga0495650_0015460
356 Ga0495585_0028636
357 Ga0495585_0050932
358 Ga0495594_0016210
359 Ga0495594_0061467
360 Ga0495628_0045329
361 Ga0495666_0008676
362 Ga0495652_0246574
363 Ga0495622_0000764
364 Ga0495668_0148356
365 Ga0495611_0000581
366 Ga0495611_0002298
367 Ga0495635_0152211
368 Ga0495613_0008088
369 Ga0495670_0048443
370 Ga0495589_0001697
371 Ga0495589_0006920
372 Ga0495589_0021635
373 Ga0495636_0068284
374 Ga0495676_0001027
375 Ga0495683_0015965
376 Ga0495685_000555
377 Ga0495685_016044
378 Ga0495614_0000357
379 Ga0496101_0188955
380 Ga0496105_0014159
381 Ga0496105_0139651
382 Ga0496108_0010857
383 Ga0496108_0151718
384 Ga0496108_0201110
385 Ga0496108_0273970
386 Ga0496109_0014609
387 Ga0496109_0346565
388 Ga0496109_0413988
389 Ga0496110_0057738
390 Ga0496111_0013972
391 Ga0496111_0175883
392 Ga0496112_0189845
393 Ga0496114_0001052
394 Ga0496114_0053344
395 Ga0496114_0218379
396 Ga0496126_0007532
397 Ga0501031_0337388
398 Ga0501032_0013378
399 Ga0501032_0035427
400 Ga0501032_0085998
401 Ga0501032_0241320
402 Ga0501033_0000203
403 Ga0501033_0004864
404 Ga0501034_0002407
405 Ga0501034_0006277
406 Ga0501034_0159268
407 Ga0501036_0000355
408 Ga0501036_0010928
409 Ga0501036_0177889
410 Ga0501036_0197350
411 Ga0501037_0012141
412 Ga0501037_0018015
413 Ga0501037_0019828
414 Ga0501037_0041227
415 Ga0501038_0000736
416 Ga0501038_0001817
417 Ga0501038_0026170
418 Ga0501038_0040539
419 Ga0501038_0058899
420 Ga0501039_0043152
421 Ga0501039_0048469
422 Ga0501039_0218267
423 Ga0501042_0004042
424 Ga0501042_0006011
425 Ga0501042_0049381
426 Ga0501043_0004801
427 Ga0501043_0049609
428 Ga0501043_0054944
429 Ga0501043_0153745
430 Ga0501043_0181230
431 Ga0501046_0000420
432 Ga0501046_0002448
433 Ga0501046_0010555
434 Ga0501046_0014188
435 Ga0501046_0260020
436 Ga0501047_0000092
437 Ga0501047_0004873
438 Ga0501047_0031436
439 Ga0501047_0034424
440 Ga0501047_0052087
441 Ga0501047_0074406
442 Ga0501047_0311191
443 Ga0501048_0015407
444 Ga0501048_0059836
445 Ga0501048_0078911
446 Ga0501070_0010512
447 Ga0501073_0012956
448 Ga0501073_0170369
449 Ga0501073_0438139
450 Ga0501074_0000834
451 Ga0501080_0057630
452 Ga0501080_0331629
453 Ga0501083_0000285
454 Ga0501035_0000909
455 Ga0501035_0030426
456 Ga0501035_0084322
457 Ga0501035_0091537
458 Ga0501035_0148756
459 Ga0501044_0015322
460 Ga0501044_0025164
461 Ga0501044_0061852
462 Ga0501044_0143110
463 Ga0501044_0245482
464 Ga0501044_0362800
465 Ga0501044_0600366
466 Ga0501045_0041699
467 nmdc:mga0yw44_285624_c1
468 nmdc:mga06z11_234321_c1
469 Ga0500556_0000467
470 Ga0500593_000077
471 Ga0590075_018317
472 Ga0466962_0032122
473 Ga0530510_0031594
474 2585296253
475 2623586922
476 2644609278
477 2689963813
478 2738892788
479 2740167116
480 2774380676
481 2808874006
482 2808895195
483 2812348253
484 2812483220
485 2816506662
486 2819428330
487 2819730380
488 2862512425
489 2873315460
490 2899364398
491 2904512827
492 2912729644
493 2917736894
494 2919073020
495 2920883639
496 2977231182
497 2977239974
498 2984545755
499 3006501558
500 8016257733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

70

280

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j5x-assembly1.cif.gz_B crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate 0.9376 1 276
6j5x-assembly1.cif.gz_B crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate 0.9311 1 276
1i7o-assembly4.cif.gz_D crystal structure of hpce 0.9205 67 275
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.9063 1 275
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.9038 1 276
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9502 62 276 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9478 59 273 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9458 62 276 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9353 62 274 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.933 65 275 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A7W1ZFW6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.964 59 277 GO:0016787
GO:0044281
AF-A0A7T9I9J5-F1-model_v4 deleted 0.9634 1 187
AF-A0A535EL10-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9627 15 231 GO:0016787
GO:0044281
AF-A0A6I3EIT8-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9584 65 272 GO:0016853
GO:0044281
AF-W5XZH9-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.957 59 277 GO:0016853
GO:0046872

Map