F360565

General Info

Members Datasets Scaffolds Average Seq Length
249 123 498 290

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100371074|Ga0070699_1003710741
Length 330
Sequence MNVSRAIRSEDPPLRRGGSASEASRGGVTPSRTPPTPAPPRKGEGSFADIGAHMSIAGGLHLALERGHALGCGAVQIFLKNQRQWAARPLGADEIGAFHAARRRTRIRHVFAHASYLINLAAPGDPQRRQAVDAFVDELERAEALGLSCVVIHPGSHMGAGPEAGVARVVAALDEATRRTPGYRVKIALENTAGAGNVIGRRLSELGELIERAARPERLGVCLDTCHLYAAGYDIRAARGFAAAFDECAEHVGLSRVLAFHLNDARAPLGSGLDRHEHIGQGHLGLAPFRRLLNDARFTRIPKVLETAKEPEPLADIRNLTTLRRLRRRP

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
61 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
62 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
63 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 1.61
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 14.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100371074 3300005518 Bacteria 1291
2 Ga0065715_10122293 3300005293 Bacteria 2208
3 Ga0070680_100017503 3300005336 Bacteria 5652
4 Ga0070680_100201188 3300005336 Unclassified 1680
5 Ga0068868_100197487 3300005338 Bacteria 1675
6 Ga0070668_100068086 3300005347 Bacteria 2767
7 Ga0070669_100008414 3300005353 Bacteria 7364
8 Ga0070671_100493444 3300005355 Bacteria 1053
9 Ga0070713_100606800 3300005436 Bacteria 1040
10 Ga0070694_100021245 3300005444 Bacteria 4145
11 Ga0070708_100032223 3300005445 Bacteria 4544
12 Ga0070708_100053325 3300005445 Bacteria 3588
13 Ga0070662_100108546 3300005457 Bacteria 2111
14 Ga0070681_10093126 3300005458 Bacteria 2962
15 Ga0070681_10295743 3300005458 Bacteria 1529
16 Ga0068867_100101432 3300005459 Bacteria 2199
17 Ga0070706_100008643 3300005467 Bacteria 9489
18 Ga0070706_100133809 3300005467 Bacteria 2314
19 Ga0070707_100199450 3300005468 Bacteria 1950
20 Ga0070707_100307596 3300005468 Bacteria 1540
21 Ga0070707_100316562 3300005468 Bacteria 1516
22 Ga0070698_100276335 3300005471 Unclassified 1611
23 Ga0070699_100004758 3300005518 Bacteria 12000
24 Ga0070699_100053058 3300005518 Bacteria 3509
25 Ga0070699_100061429 3300005518 Bacteria 3256
26 Ga0070699_100091734 3300005518 Bacteria 2656
27 Ga0070697_100030912 3300005536 Unclassified 4303
28 Ga0070697_100243403 3300005536 Unclassified 1536
29 Ga0070697_100351263 3300005536 Bacteria 1273
30 Ga0070695_100041813 3300005545 Bacteria 2907
31 Ga0070696_100099840 3300005546 Bacteria 2078
32 Ga0070665_100700724 3300005548 Unclassified 1026
33 Ga0068855_100190037 3300005563 Bacteria 2317
34 Ga0068861_100031452 3300005719 Bacteria 3899
35 Ga0068858_100314644 3300005842 Unclassified 1495
36 Ga0081540_1054630 3300005983 Unclassified 1950
37 Ga0075365_10227201 3300006038 Unclassified 1310
38 Ga0075364_10066625 3300006051 Bacteria 2366
39 Ga0070716_100006866 3300006173 Bacteria 5581
40 Ga0070712_100123671 3300006175 Bacteria 1951
41 Ga0075367_10001364 3300006178 Bacteria 10406
42 Ga0075366_10008318 3300006195 Bacteria 5761
43 Ga0075366_10228143 3300006195 Unclassified 1135
44 Ga0075428_100000350 3300006844 Bacteria 45826
45 Ga0075428_100009178 3300006844 Bacteria 10971
46 Ga0075428_100019119 3300006844 Bacteria 7576
47 Ga0075428_100033009 3300006844 Bacteria 5716
48 Ga0075428_100134666 3300006844 Bacteria 2687
49 Ga0075430_100000008 3300006846 Bacteria 101688
50 Ga0075430_100000537 3300006846 Bacteria 28655
51 Ga0075430_100310094 3300006846 Unclassified 1305
52 Ga0075431_100000289 3300006847 Bacteria 39402
53 Ga0075431_100023582 3300006847 Bacteria 6298
54 Ga0075431_100059102 3300006847 Bacteria 3957
55 Ga0075431_100628489 3300006847 Unclassified 1056
56 Ga0075433_10000825 3300006852 Bacteria 21651
57 Ga0075433_10001196 3300006852 Bacteria 18893
58 Ga0075433_10080224 3300006852 Unclassified 2876
59 Ga0075433_10155867 3300006852 Bacteria 2032
60 Ga0075433_10168291 3300006852 Unclassified 1950
61 Ga0075433_10300373 3300006852 Bacteria 1422
62 Ga0075433_10389563 3300006852 Bacteria 1230
63 Ga0075434_100001806 3300006871 Bacteria 18509
64 Ga0075434_100002348 3300006871 Bacteria 16568
65 Ga0075434_100018575 3300006871 Bacteria 6718
66 Ga0075434_100183783 3300006871 Bacteria 2111
67 Ga0075434_100229410 3300006871 Bacteria 1876
68 Ga0075434_100506868 3300006871 Bacteria 1227
69 Ga0075429_100000111 3300006880 Bacteria 46835
70 Ga0075429_100061543 3300006880 Bacteria 3270
71 Ga0068865_100169983 3300006881 Unclassified 1670
72 Ga0075436_100021109 3300006914 Bacteria 4468
73 Ga0075435_100010136 3300007076 Bacteria 6882
74 Ga0075435_100039919 3300007076 Unclassified 3747
75 Ga0075435_100148074 3300007076 Bacteria 1972
76 Ga0075435_100263839 3300007076 Bacteria 1468
77 Ga0099794_10004336 3300007265 Bacteria 5555
78 Ga0111539_10011454 3300009094 Bacteria 11133
79 Ga0111539_10029172 3300009094 Bacteria 6725
80 Ga0111539_10444736 3300009094 Bacteria 1509
81 Ga0111539_10724634 3300009094 Bacteria 1158
82 Ga0114129_10005193 3300009147 Bacteria 18341
83 Ga0114129_10019333 3300009147 Bacteria 9701
84 Ga0114129_10034365 3300009147 Bacteria 7160
85 Ga0114129_10073863 3300009147 Bacteria 4751
86 Ga0114129_10150669 3300009147 Bacteria 3183
87 Ga0114129_10373852 3300009147 Unclassified 1883
88 Ga0114129_10442281 3300009147 Bacteria 1706
89 Ga0114129_10649559 3300009147 Bacteria 1362
90 Ga0114129_10975482 3300009147 Bacteria 1069
91 Ga0105242_10234334 3300009176 Bacteria 1647
92 Ga0157372_10141598 3300013307 Unclassified 2771
93 Ga0163163_10065559 3300014325 Unclassified 3605
94 Ga0207684_10088492 3300025910 Unclassified 2638
95 Ga0207684_10145404 3300025910 Unclassified 2039
96 Ga0207684_10192311 3300025910 Bacteria 1760
97 Ga0207660_10011418 3300025917 Bacteria 5780
98 Ga0207646_10094594 3300025922 Bacteria 2676
99 Ga0207646_10201741 3300025922 Bacteria 1797
100 Ga0207706_10086822 3300025933 Bacteria 2750
101 Ga0207704_10115587 3300025938 Bacteria 1824
102 Ga0207665_10002311 3300025939 Bacteria 12868
103 Ga0207668_10040144 3300025972 Bacteria 3156
104 Ga0207708_10095585 3300026075 Bacteria 2295
105 Ga0207648_10071494 3300026089 Bacteria 3023
106 Ga0207675_100097305 3300026118 Bacteria 2771
107 Ga0207428_10007975 3300027907 Bacteria 9612
108 Ga0207428_10023551 3300027907 Bacteria 5177
109 Ga0207428_10307088 3300027907 Bacteria 1173
110 Ga0268264_10289588 3300028381 Bacteria 1538
111 Ga0316579_10069279 3300031691 Bacteria 1669
112 Ga0316577_10002245 3300031733 Bacteria 9501
113 Ga0373940_0009400 3300035088 Unclassified 2273
114 Ga0373939_0069262 3300035114 Bacteria 1144
115 Ga0373941_0008031 3300035115 Bacteria 2607
116 Ga0373962_0012909 3300035242 Bacteria 2109
117 Ga0373962_0020438 3300035242 Bacteria 1739
118 Ga0373931_0032729 3300035691 Bacteria 2691
119 Ga0373931_0244212 3300035691 Bacteria 1089
120 Ga0373937_0634865 3300036401 Bacteria 1013
121 Ga0316582_0032858 3300036647 Bacteria 3182
122 Ga0395899_0049549 3300037312 Bacteria 3122
123 Ga0395900_0014035 3300037418 Bacteria 8180
124 Ga0395898_0008526 3300037466 Bacteria 10828
125 Ga0451577_0378236 3300042876 Bacteria 1285
126 Ga0451577_0460748 3300042876 Bacteria 1154
127 Ga0453683_0152505 3300044673 Bacteria 1460
128 Ga0453684_0303638 3300044712 Bacteria 1813
129 Ga0451576_0073598 3300045051 Unclassified 3555
130 Ga0451576_0168397 3300045051 Bacteria 2286
131 Ga0451576_0200438 3300045051 Bacteria 2085
132 Ga0495584_0153279 3300046491 Unclassified 1171
133 Ga0495594_0039079 3300046499 Bacteria 2593
134 Ga0495583_0067075 3300046506 Unclassified 1586
135 Ga0495645_0021836 3300046543 Bacteria 4627
136 Ga0495656_0091723 3300046615 Bacteria 1390
137 Ga0495659_0130801 3300046664 Unclassified 995
138 Ga0495613_0364110 3300046689 Bacteria 991
139 Ga0495674_0374938 3300047319 Bacteria 1152
140 Ga0496102_0018105 3300048905 Bacteria 6183
141 Ga0496108_0505072 3300048911 Bacteria 1056
142 Ga0496110_0311380 3300048913 Bacteria 1434
143 Ga0496114_0029723 3300048917 Bacteria 4493
144 Ga0501034_0090778 3300049571 Bacteria 3052
145 Ga0501036_0009781 3300049572 Bacteria 7897
146 Ga0501037_0136593 3300049573 Bacteria 1756
147 Ga0501038_0130383 3300049574 Bacteria 2065
148 Ga0501038_0144652 3300049574 Bacteria 1942
149 Ga0501038_0147912 3300049574 Bacteria 1917
150 Ga0501039_0022073 3300049575 Bacteria 4885
151 Ga0501039_0500991 3300049575 Bacteria 954
152 Ga0501040_0080757 3300049576 Bacteria 2253
153 Ga0501040_0095322 3300049576 Bacteria 2071
154 Ga0501040_0112036 3300049576 Bacteria 1908
155 Ga0501040_0115149 3300049576 Unclassified 1882
156 Ga0501041_0026624 3300049577 Bacteria 3479
157 Ga0501042_0077475 3300049578 Bacteria 2381
158 Ga0501042_0136818 3300049578 Bacteria 1766
159 Ga0501042_0205881 3300049578 Bacteria 1419
160 Ga0501042_0299243 3300049578 Bacteria 1162
161 Ga0501046_0021601 3300049580 Bacteria 5311
162 Ga0501046_0135704 3300049580 Bacteria 1864
163 Ga0501047_0112109 3300049581 Bacteria 2610
164 Ga0501048_0115038 3300049582 Bacteria 1900
165 Ga0501048_0284708 3300049582 Unclassified 1175
166 Ga0501068_0025643 3300049584 Bacteria 3469
167 Ga0501071_0116487 3300049587 Bacteria 1978
168 Ga0501072_0013994 3300049588 Bacteria 6148
169 Ga0501072_0089071 3300049588 Bacteria 2449
170 Ga0501072_0145348 3300049588 Bacteria 1891
171 Ga0501072_0221097 3300049588 Bacteria 1509
172 Ga0501074_0123467 3300049590 Bacteria 1852
173 Ga0501075_0029283 3300049591 Bacteria 4071
174 Ga0501075_0043969 3300049591 Bacteria 3351
175 Ga0501075_0153008 3300049591 Bacteria 1758
176 Ga0501075_0266249 3300049591 Bacteria 1306
177 Ga0501076_0000424 3300049592 Bacteria 26612
178 Ga0501076_0023957 3300049592 Bacteria 4711
179 Ga0501076_0056951 3300049592 Bacteria 3103
180 Ga0501076_0077615 3300049592 Bacteria 2665
181 Ga0501076_0405390 3300049592 Unclassified 1121
182 Ga0501077_0039559 3300049593 Bacteria 3004
183 Ga0501077_0050043 3300049593 Bacteria 2656
184 Ga0501077_0124590 3300049593 Bacteria 1633
185 Ga0501079_0032498 3300049741 Bacteria 4012
186 Ga0501079_0050401 3300049741 Bacteria 3214
187 Ga0501079_0063985 3300049741 Bacteria 2838
188 Ga0501079_0278528 3300049741 Bacteria 1308
189 Ga0501079_0290400 3300049741 Bacteria 1279
190 Ga0501080_0050063 3300049742 Bacteria 3889
191 Ga0501080_0069521 3300049742 Bacteria 3275
192 Ga0501081_0005206 3300049743 Bacteria 8373
193 Ga0501081_0118493 3300049743 Bacteria 1883
194 Ga0501081_0140925 3300049743 Bacteria 1728
195 nmdc:mga00v17_15248_c1 3300050491 Bacteria 4310
196 nmdc:mga00v17_63238_c1 3300050491 Bacteria 2279
197 nmdc:mga0yw44_21345_c1 3300050492 Bacteria 3610
198 nmdc:mga0yw44_7577_c1 3300050492 Bacteria 3385
199 nmdc:mga0k408_4333_c1 3300050493 Bacteria 6208
200 nmdc:mga06z11_2889_c1 3300050494 Bacteria 6605
201 nmdc:mga05p37_11218_c1 3300050507 Bacteria 10653
202 nmdc:mga05p37_131595_c1 3300050507 Bacteria 3070
203 nmdc:mga05p37_158524_c1 3300050507 Bacteria 2765
204 nmdc:mga05p37_20814_c1 3300050507 Bacteria 7939
205 nmdc:mga05p37_461863_c1 3300050507 Unclassified 1467
206 nmdc:mga05p37_539240_c1 3300050507 Unclassified 1331
207 nmdc:mga09592_1592_c1 3300050508 Bacteria 18282
208 nmdc:mga09592_18833_c1 3300050508 Bacteria 5664
209 nmdc:mga09592_39166_c1 3300050508 Bacteria 3980
210 nmdc:mga09592_97306_c1 3300050508 Unclassified 2519
211 nmdc:mga0qj67_8934_c1 3300050509 Bacteria 7433
212 nmdc:mga06r32_151295_c1 3300050510 Bacteria 2299
213 nmdc:mga06r32_284860_c1 3300050510 Bacteria 1639
214 nmdc:mga08y16_12103_c1 3300050511 Bacteria 9066
215 nmdc:mga08y16_126151_c1 3300050511 Bacteria 2663
216 nmdc:mga08y16_143870_c1 3300050511 Bacteria 2479
217 nmdc:mga08y16_24679_c1 3300050511 Bacteria 6345
218 nmdc:mga08y16_378425_c1 3300050511 Bacteria 1451
219 nmdc:mga0n895_19324_c1 3300050512 Bacteria 6331
220 nmdc:mga0n895_218906_c1 3300050512 Bacteria 1933
221 nmdc:mga0n895_27311_c1 3300050512 Bacteria 5421
222 nmdc:mga0n895_5784_c1 3300050512 Bacteria 10379
223 nmdc:mga0n895_63507_c1 3300050512 Bacteria 3652
224 nmdc:mga0rr50_118542_c1 3300050513 Bacteria 2103
225 nmdc:mga0rr50_13235_c1 3300050513 Bacteria 5365
226 nmdc:mga0rr50_377268_c1 3300050513 Bacteria 1195
227 nmdc:mga0rr50_55943_c1 3300050513 Bacteria 2946
228 nmdc:mga0rr50_80064_c1 3300050513 Unclassified 2518
229 nmdc:mga0rr50_9457_c1 3300050513 Bacteria 6129
230 nmdc:mga08x19_43393_c1 3300050514 Bacteria 2869
231 nmdc:mga0a205_1039_c1 3300050515 Bacteria 23124
232 nmdc:mga0a205_1806_c1 3300050515 Bacteria 18502
233 nmdc:mga0a205_192290_c1 3300050515 Bacteria 1932
234 nmdc:mga0a205_29536_c1 3300050515 Bacteria 5247
235 nmdc:mga0a205_335508_c1 3300050515 Bacteria 1381
236 nmdc:mga0a205_58074_c1 3300050515 Unclassified 3737
237 nmdc:mga0a205_75961_c1 3300050515 Bacteria 3246
238 Ga0495619_0017580 3300053085 Bacteria 4529
239 Ga0501084_0179761 3300054114 Bacteria 1786
240 Ga0501082_0005052 3300060353 Bacteria 11504
241 Ga0501082_0060938 3300060353 Bacteria 3248
242 Ga0501082_0145806 3300060353 Bacteria 2055
243 Ga0501082_0319847 3300060353 Unclassified 1352
244 Ga0501082_0431615 3300060353 Unclassified 1151
245 Ga0530510_0001929 3300061734 Bacteria 14190
246 Ga0530510_0002243 3300061734 Bacteria 13253
247 Ga0530510_0012255 3300061734 Bacteria 6018
248 Ga0530510_0052759 3300061734 Bacteria 2937
249 Ga0530510_0095095 3300061734 Bacteria 2176
250 Ga0070699_100371074
251 Ga0065715_10122293
252 Ga0070680_100017503
253 Ga0070680_100201188
254 Ga0068868_100197487
255 Ga0070668_100068086
256 Ga0070669_100008414
257 Ga0070671_100493444
258 Ga0070713_100606800
259 Ga0070694_100021245
260 Ga0070708_100032223
261 Ga0070708_100053325
262 Ga0070662_100108546
263 Ga0070681_10093126
264 Ga0070681_10295743
265 Ga0068867_100101432
266 Ga0070706_100008643
267 Ga0070706_100133809
268 Ga0070707_100199450
269 Ga0070707_100307596
270 Ga0070707_100316562
271 Ga0070698_100276335
272 Ga0070699_100004758
273 Ga0070699_100053058
274 Ga0070699_100061429
275 Ga0070699_100091734
276 Ga0070697_100030912
277 Ga0070697_100243403
278 Ga0070697_100351263
279 Ga0070695_100041813
280 Ga0070696_100099840
281 Ga0070665_100700724
282 Ga0068855_100190037
283 Ga0068861_100031452
284 Ga0068858_100314644
285 Ga0081540_1054630
286 Ga0075365_10227201
287 Ga0075364_10066625
288 Ga0070716_100006866
289 Ga0070712_100123671
290 Ga0075367_10001364
291 Ga0075366_10008318
292 Ga0075366_10228143
293 Ga0075428_100000350
294 Ga0075428_100009178
295 Ga0075428_100019119
296 Ga0075428_100033009
297 Ga0075428_100134666
298 Ga0075430_100000008
299 Ga0075430_100000537
300 Ga0075430_100310094
301 Ga0075431_100000289
302 Ga0075431_100023582
303 Ga0075431_100059102
304 Ga0075431_100628489
305 Ga0075433_10000825
306 Ga0075433_10001196
307 Ga0075433_10080224
308 Ga0075433_10155867
309 Ga0075433_10168291
310 Ga0075433_10300373
311 Ga0075433_10389563
312 Ga0075434_100001806
313 Ga0075434_100002348
314 Ga0075434_100018575
315 Ga0075434_100183783
316 Ga0075434_100229410
317 Ga0075434_100506868
318 Ga0075429_100000111
319 Ga0075429_100061543
320 Ga0068865_100169983
321 Ga0075436_100021109
322 Ga0075435_100010136
323 Ga0075435_100039919
324 Ga0075435_100148074
325 Ga0075435_100263839
326 Ga0099794_10004336
327 Ga0111539_10011454
328 Ga0111539_10029172
329 Ga0111539_10444736
330 Ga0111539_10724634
331 Ga0114129_10005193
332 Ga0114129_10019333
333 Ga0114129_10034365
334 Ga0114129_10073863
335 Ga0114129_10150669
336 Ga0114129_10373852
337 Ga0114129_10442281
338 Ga0114129_10649559
339 Ga0114129_10975482
340 Ga0105242_10234334
341 Ga0157372_10141598
342 Ga0163163_10065559
343 Ga0207684_10088492
344 Ga0207684_10145404
345 Ga0207684_10192311
346 Ga0207660_10011418
347 Ga0207646_10094594
348 Ga0207646_10201741
349 Ga0207706_10086822
350 Ga0207704_10115587
351 Ga0207665_10002311
352 Ga0207668_10040144
353 Ga0207708_10095585
354 Ga0207648_10071494
355 Ga0207675_100097305
356 Ga0207428_10007975
357 Ga0207428_10023551
358 Ga0207428_10307088
359 Ga0268264_10289588
360 Ga0316579_10069279
361 Ga0316577_10002245
362 Ga0373940_0009400
363 Ga0373939_0069262
364 Ga0373941_0008031
365 Ga0373962_0012909
366 Ga0373962_0020438
367 Ga0373931_0032729
368 Ga0373931_0244212
369 Ga0373937_0634865
370 Ga0316582_0032858
371 Ga0395899_0049549
372 Ga0395900_0014035
373 Ga0395898_0008526
374 Ga0451577_0378236
375 Ga0451577_0460748
376 Ga0453683_0152505
377 Ga0453684_0303638
378 Ga0451576_0073598
379 Ga0451576_0168397
380 Ga0451576_0200438
381 Ga0495584_0153279
382 Ga0495594_0039079
383 Ga0495583_0067075
384 Ga0495645_0021836
385 Ga0495656_0091723
386 Ga0495659_0130801
387 Ga0495613_0364110
388 Ga0495674_0374938
389 Ga0496102_0018105
390 Ga0496108_0505072
391 Ga0496110_0311380
392 Ga0496114_0029723
393 Ga0501034_0090778
394 Ga0501036_0009781
395 Ga0501037_0136593
396 Ga0501038_0130383
397 Ga0501038_0144652
398 Ga0501038_0147912
399 Ga0501039_0022073
400 Ga0501039_0500991
401 Ga0501040_0080757
402 Ga0501040_0095322
403 Ga0501040_0112036
404 Ga0501040_0115149
405 Ga0501041_0026624
406 Ga0501042_0077475
407 Ga0501042_0136818
408 Ga0501042_0205881
409 Ga0501042_0299243
410 Ga0501046_0021601
411 Ga0501046_0135704
412 Ga0501047_0112109
413 Ga0501048_0115038
414 Ga0501048_0284708
415 Ga0501068_0025643
416 Ga0501071_0116487
417 Ga0501072_0013994
418 Ga0501072_0089071
419 Ga0501072_0145348
420 Ga0501072_0221097
421 Ga0501074_0123467
422 Ga0501075_0029283
423 Ga0501075_0043969
424 Ga0501075_0153008
425 Ga0501075_0266249
426 Ga0501076_0000424
427 Ga0501076_0023957
428 Ga0501076_0056951
429 Ga0501076_0077615
430 Ga0501076_0405390
431 Ga0501077_0039559
432 Ga0501077_0050043
433 Ga0501077_0124590
434 Ga0501079_0032498
435 Ga0501079_0050401
436 Ga0501079_0063985
437 Ga0501079_0278528
438 Ga0501079_0290400
439 Ga0501080_0050063
440 Ga0501080_0069521
441 Ga0501081_0005206
442 Ga0501081_0118493
443 Ga0501081_0140925
444 nmdc:mga00v17_15248_c1
445 nmdc:mga00v17_63238_c1
446 nmdc:mga0yw44_21345_c1
447 nmdc:mga0yw44_7577_c1
448 nmdc:mga0k408_4333_c1
449 nmdc:mga06z11_2889_c1
450 nmdc:mga05p37_11218_c1
451 nmdc:mga05p37_131595_c1
452 nmdc:mga05p37_158524_c1
453 nmdc:mga05p37_20814_c1
454 nmdc:mga05p37_461863_c1
455 nmdc:mga05p37_539240_c1
456 nmdc:mga09592_1592_c1
457 nmdc:mga09592_18833_c1
458 nmdc:mga09592_39166_c1
459 nmdc:mga09592_97306_c1
460 nmdc:mga0qj67_8934_c1
461 nmdc:mga06r32_151295_c1
462 nmdc:mga06r32_284860_c1
463 nmdc:mga08y16_12103_c1
464 nmdc:mga08y16_126151_c1
465 nmdc:mga08y16_143870_c1
466 nmdc:mga08y16_24679_c1
467 nmdc:mga08y16_378425_c1
468 nmdc:mga0n895_19324_c1
469 nmdc:mga0n895_218906_c1
470 nmdc:mga0n895_27311_c1
471 nmdc:mga0n895_5784_c1
472 nmdc:mga0n895_63507_c1
473 nmdc:mga0rr50_118542_c1
474 nmdc:mga0rr50_13235_c1
475 nmdc:mga0rr50_377268_c1
476 nmdc:mga0rr50_55943_c1
477 nmdc:mga0rr50_80064_c1
478 nmdc:mga0rr50_9457_c1
479 nmdc:mga08x19_43393_c1
480 nmdc:mga0a205_1039_c1
481 nmdc:mga0a205_1806_c1
482 nmdc:mga0a205_192290_c1
483 nmdc:mga0a205_29536_c1
484 nmdc:mga0a205_335508_c1
485 nmdc:mga0a205_58074_c1
486 nmdc:mga0a205_75961_c1
487 Ga0495619_0017580
488 Ga0501084_0179761
489 Ga0501082_0005052
490 Ga0501082_0060938
491 Ga0501082_0145806
492 Ga0501082_0319847
493 Ga0501082_0431615
494 Ga0530510_0001929
495 Ga0530510_0002243
496 Ga0530510_0012255
497 Ga0530510_0052759
498 Ga0530510_0095095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

64

326

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hno-assembly1.cif.gz_A high resolution crystal structure of dna apurinic/apyrimidinic (ap) endonuclease iv nfo from thermatoga maritima 0.9574 1 289
2nq9-assembly1.cif.gz_A high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna 0.9473 1 289
2nqj-assembly1.cif.gz_A crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna 0.945 1 289
4k1g-assembly2.cif.gz_B structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair 0.9432 1 289
2nq9-assembly1.cif.gz_A high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna 0.9407 1 289
ID Description Score Start End Superfamily
af_Q10002_117_395_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9632 1 291 3.20.20.150
af_Q10002_117_395_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9598 1 291 3.20.20.150
af_Q966U0_262_539_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9553 3 292 3.20.20.150
2x7wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9524 1 289 3.20.20.150
af_Q8IE02_304_597_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9501 2 289 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A7Z9ZHM6-F1-model_v4 Deoxyribonuclease IV (EC 3.1.21.2) 0.9934 3 94 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A2V8BTB3-F1-model_v4 Deoxyribonuclease IV (EC 3.1.21.2) 0.9917 26 154 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A2N1W2B7-F1-model_v4 Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV) 0.9864 1 292 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-X1FZ92-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9862 18 246 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
AF-A0A1G1DDZ9-F1-model_v4 Deoxyribonuclease IV 0.9856 8 249 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270

Map