F360551

General Info

Members Datasets Scaffolds Average Seq Length
249 147 498 145

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10409039|Ga0070681_104090393
Length 167
Sequence MDFHCMHDQMPTHCSGATMKAHLDVITLAVRDLEKAIAFYRDGLGLPTKGIVATEFQATPENAAGAVAFFVMESGLMLALYPRRELAKDAGIRDASPSSVEFSLGYIAESQSAVDELLARAVAAGASPTEPPRHRPWGIYSGYFRDPDGHLWEIIWNPKAAPTPSAS

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
147 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 1.2
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.4
Rhizoplane 12.85
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 20.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10409039 3300005458 Bacteria 1268
2 Ga0065704_10116413 3300005289 Bacteria 1854
3 Ga0070658_10148824 3300005327 Bacteria 1959
4 Ga0070683_100436255 3300005329 Bacteria 1250
5 Ga0070670_101328784 3300005331 Unclassified 658
6 Ga0068869_100920553 3300005334 Unclassified 757
7 Ga0070680_100449154 3300005336 Unclassified 1101
8 Ga0070682_100056027 3300005337 Bacteria 2478
9 Ga0070682_100734669 3300005337 Bacteria 795
10 Ga0070682_100912141 3300005337 Bacteria 723
11 Ga0070682_101270511 3300005337 Unclassified 624
12 Ga0070682_101424707 3300005337 Bacteria 593
13 Ga0068868_100303401 3300005338 Bacteria 1357
14 Ga0070660_100543067 3300005339 Unclassified 969
15 Ga0070691_10287050 3300005341 Bacteria 894
16 Ga0070691_10744227 3300005341 Unclassified 592
17 Ga0070661_100044231 3300005344 Bacteria 3253
18 Ga0070671_101118162 3300005355 Unclassified 692
19 Ga0070709_10230286 3300005434 Bacteria 1326
20 Ga0070714_100019987 3300005435 Bacteria 5464
21 Ga0070714_100103351 3300005435 Bacteria 2513
22 Ga0070714_100299865 3300005435 Bacteria 1498
23 Ga0070714_101158783 3300005435 Bacteria 754
24 Ga0070713_100004372 3300005436 Bacteria 9491
25 Ga0070713_100626003 3300005436 Bacteria 1024
26 Ga0070713_100886682 3300005436 Bacteria 858
27 Ga0070710_10619870 3300005437 Bacteria 755
28 Ga0070710_10722469 3300005437 Bacteria 705
29 Ga0070711_100265541 3300005439 Bacteria 1352
30 Ga0070705_100473621 3300005440 Bacteria 945
31 Ga0070708_100017821 3300005445 Bacteria 5933
32 Ga0070708_101855747 3300005445 Unclassified 559
33 Ga0070678_100252316 3300005456 Bacteria 1480
34 Ga0070662_100779517 3300005457 Unclassified 812
35 Ga0070681_10698389 3300005458 Bacteria 930
36 Ga0070685_10346397 3300005466 Bacteria 1014
37 Ga0070698_100004911 3300005471 Bacteria 14664
38 Ga0070699_100327393 3300005518 Bacteria 1378
39 Ga0070699_100635122 3300005518 Bacteria 974
40 Ga0070679_100630005 3300005530 Bacteria 1015
41 Ga0070684_101805035 3300005535 Bacteria 577
42 Ga0068853_100330923 3300005539 Bacteria 1413
43 Ga0070695_100000017 3300005545 Bacteria 63901
44 Ga0070696_100334954 3300005546 Bacteria 1168
45 Ga0068855_100286701 3300005563 Bacteria 1826
46 Ga0068855_100597461 3300005563 Unclassified 1190
47 Ga0068855_101633736 3300005563 Bacteria 659
48 Ga0070664_101163261 3300005564 Bacteria 727
49 Ga0068857_101195329 3300005577 Bacteria 736
50 Ga0068856_100153143 3300005614 Bacteria 2315
51 Ga0068856_100700922 3300005614 Bacteria 1033
52 Ga0068852_100290781 3300005616 Unclassified 1578
53 Ga0068861_100858773 3300005719 Bacteria 856
54 Ga0070717_10026296 3300006028 Bacteria 4642
55 Ga0070715_10022025 3300006163 Bacteria 2480
56 Ga0070716_100002352 3300006173 Bacteria 8704
57 Ga0070716_100043342 3300006173 Bacteria 2515
58 Ga0070712_100132829 3300006175 Bacteria 1889
59 Ga0070712_100795946 3300006175 Bacteria 811
60 Ga0070712_101015601 3300006175 Unclassified 718
61 Ga0075431_100109611 3300006847 Unclassified 2850
62 Ga0068865_100436895 3300006881 Bacteria 1079
63 Ga0075436_100203591 3300006914 Bacteria 1402
64 Ga0105240_10029256 3300009093 Bacteria 7183
65 Ga0105240_10032792 3300009093 Bacteria 6720
66 Ga0105240_10269787 3300009093 Bacteria 1960
67 Ga0105240_10715470 3300009093 Unclassified 1092
68 Ga0105240_10864368 3300009093 Unclassified 975
69 Ga0105245_10046529 3300009098 Bacteria 3877
70 Ga0105247_10714036 3300009101 Unclassified 756
71 Ga0105241_10249742 3300009174 Bacteria 1503
72 Ga0105248_10124529 3300009177 Bacteria 2907
73 Ga0105237_10016946 3300009545 Bacteria 7559
74 Ga0105237_10171587 3300009545 Bacteria 2169
75 Ga0105237_10413550 3300009545 Unclassified 1354
76 Ga0105238_10211967 3300009551 Bacteria 1913
77 Ga0105238_10418126 3300009551 Unclassified 1335
78 Ga0105239_10704938 3300010375 Bacteria 1154
79 Ga0157373_10321443 3300013100 Bacteria 1101
80 Ga0157373_10983483 3300013100 Bacteria 629
81 Ga0157370_10016751 3300013104 Bacteria 7415
82 Ga0157370_10060355 3300013104 Unclassified 3600
83 Ga0157369_10442359 3300013105 Unclassified 1346
84 Ga0157369_10811191 3300013105 Unclassified 961
85 Ga0157369_11095535 3300013105 Unclassified 814
86 Ga0157369_11452004 3300013105 Unclassified 698
87 Ga0157374_10036883 3300013296 Bacteria 4481
88 Ga0157372_10010187 3300013307 Bacteria 9982
89 Ga0157372_10018905 3300013307 Bacteria 7415
90 Ga0157372_10043023 3300013307 Bacteria 4999
91 Ga0157372_10227902 3300013307 Bacteria 2160
92 Ga0157372_10367586 3300013307 Unclassified 1676
93 Ga0157372_10399501 3300013307 Unclassified 1602
94 Ga0157372_10776117 3300013307 Bacteria 1114
95 Ga0157375_10114444 3300013308 Bacteria 2799
96 Ga0157375_12722594 3300013308 Bacteria 591
97 Ga0206356_11336610 3300020070 Bacteria 1026
98 Ga0206354_10445484 3300020081 Unclassified 1188
99 Ga0224712_10113313 3300022467 Bacteria 1166
100 Ga0207688_10212311 3300025901 Bacteria 1163
101 Ga0207685_10034412 3300025905 Bacteria 1840
102 Ga0207705_10113467 3300025909 Bacteria 2004
103 Ga0207684_10000599 3300025910 Bacteria 43115
104 Ga0207684_10047883 3300025910 Bacteria 3625
105 Ga0207654_10144581 3300025911 Bacteria 1520
106 Ga0207707_10271695 3300025912 Bacteria 1469
107 Ga0207707_10271985 3300025912 Bacteria 1468
108 Ga0207707_10602210 3300025912 Bacteria 930
109 Ga0207695_10017388 3300025913 Bacteria 8367
110 Ga0207695_10059559 3300025913 Bacteria 3959
111 Ga0207695_10063947 3300025913 Bacteria 3791
112 Ga0207695_11174404 3300025913 Unclassified 648
113 Ga0207693_10137723 3300025915 Bacteria 1919
114 Ga0207663_10078252 3300025916 Bacteria 2155
115 Ga0207660_10686510 3300025917 Bacteria 835
116 Ga0207649_10028285 3300025920 Bacteria 3300
117 Ga0207649_10788393 3300025920 Unclassified 741
118 Ga0207652_10272153 3300025921 Bacteria 1528
119 Ga0207652_10994976 3300025921 Bacteria 737
120 Ga0207652_11133187 3300025921 Unclassified 683
121 Ga0207687_10030410 3300025927 Bacteria 3641
122 Ga0207700_10000004 3300025928 Bacteria 443409
123 Ga0207700_10515126 3300025928 Bacteria 1059
124 Ga0207664_10114521 3300025929 Bacteria 2247
125 Ga0207664_10194458 3300025929 Bacteria 1748
126 Ga0207664_10456778 3300025929 Bacteria 1140
127 Ga0207664_10484686 3300025929 Bacteria 1106
128 Ga0207664_10684818 3300025929 Bacteria 922
129 Ga0207644_10521276 3300025931 Bacteria 982
130 Ga0207665_10000625 3300025939 Bacteria 23680
131 Ga0207711_10127901 3300025941 Bacteria 2274
132 Ga0207661_10100787 3300025944 Bacteria 2425
133 Ga0207679_10278309 3300025945 Bacteria 1434
134 Ga0207667_10220923 3300025949 Bacteria 1941
135 Ga0207640_10029602 3300025981 Bacteria 3363
136 Ga0207639_10209924 3300026041 Unclassified 1675
137 Ga0207702_10439879 3300026078 Bacteria 1264
138 Ga0207702_11113370 3300026078 Unclassified 784
139 Ga0207674_10173067 3300026116 Bacteria 2112
140 Ga0207674_10222008 3300026116 Bacteria 1838
141 Ga0207698_10174178 3300026142 Unclassified 1898
142 Ga0307410_10926446 3300031852 Bacteria 748
143 Ga0307406_10091328 3300031901 Bacteria 2051
144 Ga0307409_100144665 3300031995 Bacteria 2054
145 Ga0307409_100419042 3300031995 Bacteria 1284
146 Ga0307416_100221700 3300032002 Bacteria 1814
147 Ga0307411_10753878 3300032005 Bacteria 853
148 Ga0307415_100220382 3300032126 Bacteria 1520
149 Ga0373944_0026144 3300035089 Bacteria 1722
150 Ga0373945_0389479 3300035116 Unclassified 609
151 Ga0373955_0224035 3300035172 Bacteria 1124
152 Ga0373937_0063183 3300036401 Unclassified 3405
153 Ga0395899_0001078 3300037312 Bacteria 24590
154 Ga0395899_0081673 3300037312 Bacteria 2351
155 Ga0395899_0755074 3300037312 Bacteria 605
156 Ga0395900_0040005 3300037418 Bacteria 4831
157 Ga0395900_0074059 3300037418 Bacteria 3502
158 Ga0395900_0237142 3300037418 Bacteria 1831
159 Ga0395900_0295290 3300037418 Bacteria 1608
160 Ga0395900_0623164 3300037418 Bacteria 1017
161 Ga0395900_1179454 3300037418 Bacteria 681
162 Ga0395898_0007627 3300037466 Bacteria 11485
163 Ga0395898_0072422 3300037466 Bacteria 3329
164 Ga0395898_0131314 3300037466 Bacteria 2399
165 Ga0395898_0352081 3300037466 Bacteria 1404
166 Ga0395905_0000025 3300037471 Bacteria 317571
167 Ga0395905_0004888 3300037471 Bacteria 13807
168 Ga0395905_0004953 3300037471 Bacteria 13723
169 Ga0395905_0006729 3300037471 Bacteria 11509
170 Ga0395905_0080714 3300037471 Bacteria 3048
171 Ga0395905_1005187 3300037471 Unclassified 737
172 Ga0436364_1053316 3300037853 Bacteria 2172
173 Ga0395901_0019304 3300038443 Bacteria 6968
174 Ga0395901_0141060 3300038443 Bacteria 2532
175 Ga0395901_0202221 3300038443 Bacteria 2082
176 Ga0395901_1971124 3300038443 Unclassified 530
177 Ga0436365_0569073 3300039437 Bacteria 8629
178 Ga0436360_0212652 3300039438 Unclassified 1266
179 Ga0436361_0547779 3300039447 Bacteria 1632
180 Ga0466966_0465725 3300044684 Bacteria 760
181 Ga0466963_0074178 3300044694 Bacteria 2294
182 Ga0466963_0129802 3300044694 Bacteria 1740
183 Ga0466963_0167904 3300044694 Bacteria 1529
184 Ga0466968_0097381 3300044735 Unclassified 1310
185 Ga0466960_0112535 3300044901 Bacteria 1416
186 Ga0466959_0231718 3300045049 Bacteria 1278
187 Ga0466958_0064272 3300045836 Bacteria 2238
188 Ga0466958_0175313 3300045836 Bacteria 1359
189 Ga0466958_0356504 3300045836 Bacteria 942
190 Ga0466958_0431093 3300045836 Bacteria 853
191 Ga0466967_0276703 3300045976 Bacteria 1610
192 Ga0466967_0304506 3300045976 Unclassified 1534
193 Ga0466967_0392248 3300045976 Bacteria 1349
194 Ga0466967_1194430 3300045976 Bacteria 758
195 Ga0466967_1884752 3300045976 Unclassified 595
196 Ga0495592_0115499 3300046454 Bacteria 1895
197 Ga0495641_0267624 3300046461 Bacteria 769
198 Ga0495639_0243856 3300046475 Bacteria 887
199 Ga0495608_0262950 3300046511 Bacteria 1074
200 Ga0495666_0141979 3300046526 Bacteria 1119
201 Ga0495665_0268033 3300046531 Bacteria 877
202 Ga0495640_0214971 3300046533 Bacteria 1214
203 Ga0495587_0047695 3300046536 Bacteria 2539
204 Ga0495668_0389254 3300046616 Unclassified 766
205 Ga0495634_0200032 3300046642 Unclassified 1241
206 Ga0495613_0049552 3300046689 Unclassified 3099
207 Ga0495624_0230147 3300046690 Unclassified 1123
208 Ga0495680_0252639 3300047322 Bacteria 1249
209 Ga0495684_0426649 3300047471 Bacteria 926
210 Ga0495602_0231698 3300048088 Bacteria 1387
211 Ga0495602_0522735 3300048088 Unclassified 826
212 Ga0495602_0777363 3300048088 Bacteria 644
213 Ga0496100_0318410 3300048903 Unclassified 1168
214 Ga0496101_0135834 3300048904 Bacteria 1871
215 Ga0496102_0053120 3300048905 Bacteria 3694
216 Ga0496102_0221836 3300048905 Bacteria 1782
217 Ga0496103_0039313 3300048906 Bacteria 2907
218 Ga0496103_0345170 3300048906 Bacteria 957
219 Ga0496104_0005580 3300048907 Bacteria 11018
220 Ga0496104_0094364 3300048907 Bacteria 2862
221 Ga0496105_0157321 3300048908 Bacteria 1866
222 Ga0496105_0325327 3300048908 Bacteria 1231
223 Ga0496105_0905768 3300048908 Unclassified 664
224 Ga0496107_0194735 3300048910 Bacteria 1506
225 Ga0496107_0213316 3300048910 Unclassified 1436
226 Ga0496108_0049600 3300048911 Bacteria 3511
227 Ga0496108_0284106 3300048911 Bacteria 1440
228 Ga0496109_0000950 3300048912 Bacteria 23960
229 Ga0496109_0215966 3300048912 Bacteria 1803
230 Ga0496109_1527826 3300048912 Bacteria 602
231 Ga0496109_1948750 3300048912 Bacteria 520
232 Ga0496110_0008718 3300048913 Bacteria 8167
233 Ga0496110_0010328 3300048913 Bacteria 7588
234 Ga0496110_1611801 3300048913 Bacteria 559
235 Ga0496111_0018834 3300048914 Bacteria 4786
236 Ga0496111_0021796 3300048914 Bacteria 4476
237 Ga0496112_0042264 3300048915 Bacteria 4459
238 Ga0496112_0130216 3300048915 Bacteria 2487
239 Ga0496112_0165603 3300048915 Bacteria 2177
240 Ga0496112_1103055 3300048915 Bacteria 712
241 Ga0496113_0089050 3300048916 Bacteria 2375
242 Ga0496114_0049359 3300048917 Bacteria 3501
243 Ga0496114_0050276 3300048917 Bacteria 3470
244 Ga0501080_0356592 3300049742 Unclassified 1320
245 nmdc:mga06r32_164101_c1 3300050510 Unclassified 2204
246 nmdc:mga0n895_668817_c1 3300050512 Bacteria 1036
247 nmdc:mga08x19_320950_c1 3300050514 Bacteria 1078
248 2765469227 2765235802 Bacteria 5618596
249 2874126389 2874123672 Bacteria 7238285
250 Ga0070681_10409039
251 Ga0065704_10116413
252 Ga0070658_10148824
253 Ga0070683_100436255
254 Ga0070670_101328784
255 Ga0068869_100920553
256 Ga0070680_100449154
257 Ga0070682_100056027
258 Ga0070682_100734669
259 Ga0070682_100912141
260 Ga0070682_101270511
261 Ga0070682_101424707
262 Ga0068868_100303401
263 Ga0070660_100543067
264 Ga0070691_10287050
265 Ga0070691_10744227
266 Ga0070661_100044231
267 Ga0070671_101118162
268 Ga0070709_10230286
269 Ga0070714_100019987
270 Ga0070714_100103351
271 Ga0070714_100299865
272 Ga0070714_101158783
273 Ga0070713_100004372
274 Ga0070713_100626003
275 Ga0070713_100886682
276 Ga0070710_10619870
277 Ga0070710_10722469
278 Ga0070711_100265541
279 Ga0070705_100473621
280 Ga0070708_100017821
281 Ga0070708_101855747
282 Ga0070678_100252316
283 Ga0070662_100779517
284 Ga0070681_10698389
285 Ga0070685_10346397
286 Ga0070698_100004911
287 Ga0070699_100327393
288 Ga0070699_100635122
289 Ga0070679_100630005
290 Ga0070684_101805035
291 Ga0068853_100330923
292 Ga0070695_100000017
293 Ga0070696_100334954
294 Ga0068855_100286701
295 Ga0068855_100597461
296 Ga0068855_101633736
297 Ga0070664_101163261
298 Ga0068857_101195329
299 Ga0068856_100153143
300 Ga0068856_100700922
301 Ga0068852_100290781
302 Ga0068861_100858773
303 Ga0070717_10026296
304 Ga0070715_10022025
305 Ga0070716_100002352
306 Ga0070716_100043342
307 Ga0070712_100132829
308 Ga0070712_100795946
309 Ga0070712_101015601
310 Ga0075431_100109611
311 Ga0068865_100436895
312 Ga0075436_100203591
313 Ga0105240_10029256
314 Ga0105240_10032792
315 Ga0105240_10269787
316 Ga0105240_10715470
317 Ga0105240_10864368
318 Ga0105245_10046529
319 Ga0105247_10714036
320 Ga0105241_10249742
321 Ga0105248_10124529
322 Ga0105237_10016946
323 Ga0105237_10171587
324 Ga0105237_10413550
325 Ga0105238_10211967
326 Ga0105238_10418126
327 Ga0105239_10704938
328 Ga0157373_10321443
329 Ga0157373_10983483
330 Ga0157370_10016751
331 Ga0157370_10060355
332 Ga0157369_10442359
333 Ga0157369_10811191
334 Ga0157369_11095535
335 Ga0157369_11452004
336 Ga0157374_10036883
337 Ga0157372_10010187
338 Ga0157372_10018905
339 Ga0157372_10043023
340 Ga0157372_10227902
341 Ga0157372_10367586
342 Ga0157372_10399501
343 Ga0157372_10776117
344 Ga0157375_10114444
345 Ga0157375_12722594
346 Ga0206356_11336610
347 Ga0206354_10445484
348 Ga0224712_10113313
349 Ga0207688_10212311
350 Ga0207685_10034412
351 Ga0207705_10113467
352 Ga0207684_10000599
353 Ga0207684_10047883
354 Ga0207654_10144581
355 Ga0207707_10271695
356 Ga0207707_10271985
357 Ga0207707_10602210
358 Ga0207695_10017388
359 Ga0207695_10059559
360 Ga0207695_10063947
361 Ga0207695_11174404
362 Ga0207693_10137723
363 Ga0207663_10078252
364 Ga0207660_10686510
365 Ga0207649_10028285
366 Ga0207649_10788393
367 Ga0207652_10272153
368 Ga0207652_10994976
369 Ga0207652_11133187
370 Ga0207687_10030410
371 Ga0207700_10000004
372 Ga0207700_10515126
373 Ga0207664_10114521
374 Ga0207664_10194458
375 Ga0207664_10456778
376 Ga0207664_10484686
377 Ga0207664_10684818
378 Ga0207644_10521276
379 Ga0207665_10000625
380 Ga0207711_10127901
381 Ga0207661_10100787
382 Ga0207679_10278309
383 Ga0207667_10220923
384 Ga0207640_10029602
385 Ga0207639_10209924
386 Ga0207702_10439879
387 Ga0207702_11113370
388 Ga0207674_10173067
389 Ga0207674_10222008
390 Ga0207698_10174178
391 Ga0307410_10926446
392 Ga0307406_10091328
393 Ga0307409_100144665
394 Ga0307409_100419042
395 Ga0307416_100221700
396 Ga0307411_10753878
397 Ga0307415_100220382
398 Ga0373944_0026144
399 Ga0373945_0389479
400 Ga0373955_0224035
401 Ga0373937_0063183
402 Ga0395899_0001078
403 Ga0395899_0081673
404 Ga0395899_0755074
405 Ga0395900_0040005
406 Ga0395900_0074059
407 Ga0395900_0237142
408 Ga0395900_0295290
409 Ga0395900_0623164
410 Ga0395900_1179454
411 Ga0395898_0007627
412 Ga0395898_0072422
413 Ga0395898_0131314
414 Ga0395898_0352081
415 Ga0395905_0000025
416 Ga0395905_0004888
417 Ga0395905_0004953
418 Ga0395905_0006729
419 Ga0395905_0080714
420 Ga0395905_1005187
421 Ga0436364_1053316
422 Ga0395901_0019304
423 Ga0395901_0141060
424 Ga0395901_0202221
425 Ga0395901_1971124
426 Ga0436365_0569073
427 Ga0436360_0212652
428 Ga0436361_0547779
429 Ga0466966_0465725
430 Ga0466963_0074178
431 Ga0466963_0129802
432 Ga0466963_0167904
433 Ga0466968_0097381
434 Ga0466960_0112535
435 Ga0466959_0231718
436 Ga0466958_0064272
437 Ga0466958_0175313
438 Ga0466958_0356504
439 Ga0466958_0431093
440 Ga0466967_0276703
441 Ga0466967_0304506
442 Ga0466967_0392248
443 Ga0466967_1194430
444 Ga0466967_1884752
445 Ga0495592_0115499
446 Ga0495641_0267624
447 Ga0495639_0243856
448 Ga0495608_0262950
449 Ga0495666_0141979
450 Ga0495665_0268033
451 Ga0495640_0214971
452 Ga0495587_0047695
453 Ga0495668_0389254
454 Ga0495634_0200032
455 Ga0495613_0049552
456 Ga0495624_0230147
457 Ga0495680_0252639
458 Ga0495684_0426649
459 Ga0495602_0231698
460 Ga0495602_0522735
461 Ga0495602_0777363
462 Ga0496100_0318410
463 Ga0496101_0135834
464 Ga0496102_0053120
465 Ga0496102_0221836
466 Ga0496103_0039313
467 Ga0496103_0345170
468 Ga0496104_0005580
469 Ga0496104_0094364
470 Ga0496105_0157321
471 Ga0496105_0325327
472 Ga0496105_0905768
473 Ga0496107_0194735
474 Ga0496107_0213316
475 Ga0496108_0049600
476 Ga0496108_0284106
477 Ga0496109_0000950
478 Ga0496109_0215966
479 Ga0496109_1527826
480 Ga0496109_1948750
481 Ga0496110_0008718
482 Ga0496110_0010328
483 Ga0496110_1611801
484 Ga0496111_0018834
485 Ga0496111_0021796
486 Ga0496112_0042264
487 Ga0496112_0130216
488 Ga0496112_0165603
489 Ga0496112_1103055
490 Ga0496113_0089050
491 Ga0496114_0049359
492 Ga0496114_0050276
493 Ga0501080_0356592
494 nmdc:mga06r32_164101_c1
495 nmdc:mga0n895_668817_c1
496 nmdc:mga08x19_320950_c1
497 2765469227
498 2874126389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

22

154

0.83

PF18029

Glyoxalase_6

Glyoxalase-like domain

25

155

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.9102 2 145
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.8695 1 139
4pav-assembly2.cif.gz_B structure of hypothetical protein sa1046 from s. aureus. 0.8652 1 139
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8577 3 138
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.8561 1 139
ID Description Score Start End Superfamily
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9044 2 145 3.10.180.10
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8528 2 139 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8479 85 138 3.30.720.110
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8465 2 139 3.10.180.10
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8462 2 139 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1G6DGM2-F1-model_v4 Glyoxalase-like domain-containing protein 0.9816 82 138
AF-K2AJS8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9791 82 140 GO:0051213
AF-A0A7G1KVQ3-F1-model_v4 VOC domain-containing protein 0.9635 1 138
AF-A0A2V2U924-F1-model_v4 Glyoxalase 0.9619 1 142
AF-A0A6I7TK58-F1-model_v4 deleted 0.9564 16 144

Map