F360509

General Info

Members Datasets Scaffolds Average Seq Length
249 197 498 81

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100616117|Ga0070688_1006161172
Length 92
Sequence MSFIWMVIVGLIVGALAKLLMPGRDPGGMLITMLLGIAGSLVAGALGRAVGWYAPGQPAGFIASIVGAVILLALYRMLIGRAAGSGPLQRPL

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
110 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
111 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
112 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
113 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
123 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
124 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
125 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
126 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
127 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
128 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
194 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
195 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
196 2738541307 Variovorax sp. GV008 Isolate Unclassified
197 2738543013 Variovorax sp. BT01 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 5.22
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.84
Nodule 0
Rhizoplane 0.4
Rhizosphere 83.94
Stem 0
Stem Tuber 0
Unclassified 20.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100616117 3300005365 Unclassified 832
2 Ga0055533_1010285 3300003756 Bacteria 1068
3 Ga0058863_10087193 3300004799 Unclassified 1326
4 Ga0058861_10068031 3300004800 Unclassified 1502
5 Ga0065704_10126465 3300005289 Bacteria 1689
6 Ga0070658_10041251 3300005327 Bacteria 3723
7 Ga0070676_10263427 3300005328 Bacteria 1155
8 Ga0070670_100134288 3300005331 Bacteria 2138
9 Ga0070670_100277017 3300005331 Bacteria 1465
10 Ga0070677_10250202 3300005333 Bacteria 879
11 Ga0068869_100359008 3300005334 Bacteria 1189
12 Ga0070680_100851577 3300005336 Unclassified 786
13 Ga0068868_102049184 3300005338 Unclassified 544
14 Ga0070687_100491889 3300005343 Unclassified 824
15 Ga0070687_101407072 3300005343 Unclassified 521
16 Ga0070675_100579846 3300005354 Bacteria 1016
17 Ga0070671_100572777 3300005355 Bacteria 975
18 Ga0070671_100935722 3300005355 Unclassified 758
19 Ga0070673_100360713 3300005364 Bacteria 1292
20 Ga0070688_100782983 3300005365 Bacteria 745
21 Ga0070659_100359066 3300005366 Unclassified 1224
22 Ga0070714_100031641 3300005435 Bacteria 4416
23 Ga0070713_100001332 3300005436 Bacteria 15790
24 Ga0070711_100135506 3300005439 Bacteria 1840
25 Ga0070711_100592584 3300005439 Bacteria 924
26 Ga0070705_100927523 3300005440 Unclassified 702
27 Ga0068867_100452405 3300005459 Unclassified 1094
28 Ga0070685_10416734 3300005466 Bacteria 933
29 Ga0070679_101289515 3300005530 Bacteria 676
30 Ga0070672_100687549 3300005543 Bacteria 895
31 Ga0070664_100013022 3300005564 Bacteria 6767
32 Ga0070664_100018006 3300005564 Bacteria 5800
33 Ga0070702_100784632 3300005615 Unclassified 735
34 Ga0068859_100626925 3300005617 Bacteria 1168
35 Ga0068861_100723675 3300005719 Bacteria 927
36 Ga0068860_101088813 3300005843 Unclassified 818
37 Ga0070717_10007364 3300006028 Bacteria 8172
38 Ga0075363_100051673 3300006048 Bacteria 2193
39 Ga0075363_100095969 3300006048 Bacteria 1637
40 Ga0075364_10472650 3300006051 Bacteria 857
41 Ga0075364_10512465 3300006051 Bacteria 820
42 Ga0075362_10001615 3300006177 Bacteria 7311
43 Ga0075362_10452274 3300006177 Bacteria 652
44 Ga0075362_10601966 3300006177 Bacteria 568
45 Ga0075366_10060953 3300006195 Bacteria 2241
46 Ga0075370_10402773 3300006353 Bacteria 821
47 Ga0068871_100950748 3300006358 Bacteria 798
48 Ga0068871_101242822 3300006358 Unclassified 699
49 Ga0075428_101460782 3300006844 Bacteria 717
50 Ga0075430_100426954 3300006846 Bacteria 1094
51 Ga0075429_100025231 3300006880 Bacteria 5160
52 Ga0068865_100296749 3300006881 Unclassified 1292
53 Ga0097620_100626952 3300006931 Bacteria 1168
54 Ga0105240_11626469 3300009093 Unclassified 675
55 Ga0111539_12974811 3300009094 Unclassified 548
56 Ga0114129_12589588 3300009147 Unclassified 605
57 Ga0105248_11776081 3300009177 Unclassified 699
58 Ga0105248_12303580 3300009177 Unclassified 613
59 Ga0105248_12556009 3300009177 Bacteria 582
60 Ga0105237_10432333 3300009545 Bacteria 1322
61 Ga0105246_10189512 3300011119 Bacteria 1591
62 Ga0157370_10486586 3300013104 Bacteria 1134
63 Ga0157378_10854528 3300013297 Bacteria 938
64 Ga0157378_11452368 3300013297 Unclassified 730
65 Ga0163162_10172346 3300013306 Unclassified 2289
66 Ga0157375_10012820 3300013308 Bacteria 7444
67 Ga0157375_12199416 3300013308 Bacteria 657
68 Ga0157380_10823379 3300014326 Bacteria 947
69 Ga0157380_10963053 3300014326 Bacteria 884
70 Ga0182008_10022796 3300014497 Bacteria 3204
71 Ga0157376_10119245 3300014969 Bacteria 2335
72 Ga0157376_11113090 3300014969 Bacteria 816
73 Ga0182007_10041722 3300015262 Bacteria 1529
74 Ga0163161_10098702 3300017792 Unclassified 2171
75 Ga0163161_10326165 3300017792 Bacteria 1215
76 Ga0206356_10103389 3300020070 Unclassified 1527
77 Ga0206351_10834464 3300020077 Unclassified 1102
78 Ga0206352_11014085 3300020078 Unclassified 1460
79 Ga0206350_10441049 3300020080 Unclassified 1019
80 Ga0206350_11447234 3300020080 Bacteria 1755
81 Ga0206354_10343204 3300020081 Bacteria 595
82 Ga0213876_10770068 3300021384 Bacteria 512
83 Ga0213871_10001174 3300021441 Bacteria 4205
84 Ga0209674_102540 3300025226 Bacteria 3853
85 Ga0207643_10286754 3300025908 Bacteria 1022
86 Ga0207705_10032556 3300025909 Bacteria 3726
87 Ga0207707_10040090 3300025912 Bacteria 4092
88 Ga0207693_10273349 3300025915 Bacteria 1324
89 Ga0207693_10563478 3300025915 Bacteria 888
90 Ga0207660_10565994 3300025917 Unclassified 925
91 Ga0207662_10690830 3300025918 Unclassified 715
92 Ga0207649_11654250 3300025920 Bacteria 507
93 Ga0207652_10181766 3300025921 Unclassified 1890
94 Ga0207650_10124895 3300025925 Bacteria 2008
95 Ga0207650_11226443 3300025925 Bacteria 638
96 Ga0207700_10001219 3300025928 Bacteria 14743
97 Ga0207664_10016050 3300025929 Bacteria 5455
98 Ga0207644_10384573 3300025931 Bacteria 1145
99 Ga0207644_11402691 3300025931 Unclassified 587
100 Ga0207690_10445102 3300025932 Unclassified 1040
101 Ga0207706_10811078 3300025933 Unclassified 794
102 Ga0207670_10318215 3300025936 Unclassified 1223
103 Ga0207689_10386394 3300025942 Bacteria 1166
104 Ga0207679_10399934 3300025945 Unclassified 1208
105 Ga0207651_11041056 3300025960 Bacteria 732
106 Ga0207648_10764274 3300026089 Unclassified 898
107 Ga0207676_10442346 3300026095 Bacteria 1224
108 Ga0207683_10080171 3300026121 Bacteria 2895
109 Ga0207683_11882635 3300026121 Unclassified 547
110 Ga0207698_10521303 3300026142 Bacteria 1160
111 Ga0268265_11547952 3300028380 Bacteria 667
112 Ga0268264_10207944 3300028381 Bacteria 1795
113 Ga0307515_10010437 3300028794 Bacteria 17795
114 Ga0307515_10487111 3300028794 Bacteria 845
115 Ga0265332_10294003 3300031238 Bacteria 671
116 Ga0307408_100133327 3300031548 Bacteria 1940
117 Ga0307408_102038246 3300031548 Bacteria 552
118 Ga0307508_10324251 3300031616 Unclassified 1132
119 Ga0316578_10196472 3300031728 Bacteria 1215
120 Ga0307405_10387079 3300031731 Bacteria 1090
121 Ga0307412_10046588 3300031911 Bacteria 2841
122 Ga0307412_11174137 3300031911 Bacteria 686
123 Ga0307416_100017062 3300032002 Bacteria 5067
124 Ga0307416_100056724 3300032002 Bacteria 3163
125 Ga0307416_100412717 3300032002 Bacteria 1392
126 Ga0307416_101052370 3300032002 Unclassified 918
127 Ga0307411_10056530 3300032005 Bacteria 2587
128 Ga0373939_0132113 3300035114 Unclassified 892
129 Ga0373931_0116752 3300035691 Bacteria 1521
130 Ga0373947_0867248 3300035725 Unclassified 616
131 Ga0436364_0718421 3300037853 Bacteria 922
132 Ga0436364_0863812 3300037853 Unclassified 736
133 Ga0436364_1387816 3300037853 Bacteria 700
134 Ga0436365_0739501 3300039437 Bacteria 1377
135 Ga0436360_1106222 3300039438 Bacteria 6379
136 Ga0436360_1343000 3300039438 Bacteria 598
137 Ga0436363_0472164 3300039450 Bacteria 1524
138 Ga0436362_0694761 3300039453 Bacteria 1182
139 Ga0439436_0047639 3300041404 Bacteria 1216
140 Ga0439439_0003522 3300041406 Bacteria 3459
141 Ga0439447_008609 3300041407 Bacteria 3151
142 Ga0439461_0037843 3300041410 Bacteria 1032
143 Ga0439466_0014241 3300041411 Bacteria 2899
144 Ga0451833_0065676 3300041491 Bacteria 776
145 Ga0451839_1469121 3300041496 Bacteria 536
146 Ga0439431_0022000 3300041997 Bacteria 1534
147 Ga0439433_0005036 3300041999 Bacteria 2834
148 Ga0439442_023268 3300042002 Bacteria 1287
149 Ga0439442_133345 3300042002 Bacteria 547
150 Ga0439445_0010385 3300042004 Bacteria 2202
151 Ga0439432_011446 3300042006 Bacteria 3058
152 Ga0439449_0003803 3300042007 Bacteria 5841
153 Ga0439452_023649 3300042010 Bacteria 1579
154 Ga0439462_0064016 3300042015 Bacteria 995
155 Ga0450923_005313 3300042125 Bacteria 2072
156 Ga0450897_010218 3300042128 Bacteria 899
157 Ga0450894_057434 3300042131 Bacteria 581
158 Ga0450896_007651 3300042133 Bacteria 1490
159 Ga0450898_031330 3300042134 Bacteria 977
160 Ga0450898_124189 3300042134 Bacteria 552
161 Ga0450899_002990 3300042135 Bacteria 1821
162 Ga0450907_072158 3300042146 Bacteria 598
163 Ga0439446_0099177 3300042156 Bacteria 919
164 Ga0450908_057455 3300042184 Bacteria 681
165 Ga0439434_0017599 3300042435 Bacteria 2138
166 Ga0453683_0181036 3300044673 Bacteria 1337
167 Ga0466963_1265616 3300044694 Unclassified 518
168 Ga0466959_0835431 3300045049 Bacteria 615
169 Ga0451576_0279009 3300045051 Bacteria 1747
170 Ga0466958_0885483 3300045836 Bacteria 582
171 Ga0495616_0000022 3300046513 Bacteria 149720
172 Ga0495628_0575034 3300046516 Bacteria 807
173 Ga0495628_0892702 3300046516 Bacteria 617
174 Ga0495630_1405209 3300046517 Unclassified 525
175 Ga0495648_0216150 3300046524 Bacteria 949
176 Ga0495587_0072871 3300046536 Bacteria 1996
177 Ga0495645_0285622 3300046543 Bacteria 1083
178 Ga0495645_0420623 3300046543 Bacteria 848
179 Ga0495668_0122250 3300046616 Bacteria 1424
180 Ga0495588_0303531 3300046674 Bacteria 840
181 Ga0495658_0134095 3300046683 Bacteria 1510
182 Ga0495670_0744032 3300046691 Unclassified 535
183 Ga0495636_0549199 3300047318 Bacteria 562
184 Ga0496102_0105133 3300048905 Bacteria 2626
185 Ga0496117_0074713 3300048920 Bacteria 2255
186 Ga0501306_062815 3300049127 Bacteria 614
187 Ga0501308_053546 3300049128 Bacteria 596
188 Ga0501308_074044 3300049128 Unclassified 533
189 Ga0501305_107752 3300049161 Bacteria 524
190 Ga0501307_032889 3300049162 Bacteria 726
191 Ga0501032_0664912 3300049569 Bacteria 661
192 Ga0501034_0035200 3300049571 Bacteria 5077
193 Ga0501034_0382248 3300049571 Unclassified 1333
194 Ga0501034_0573136 3300049571 Bacteria 1036
195 Ga0501036_0566904 3300049572 Bacteria 943
196 Ga0501038_1002858 3300049574 Bacteria 613
197 Ga0501043_0000010 3300049579 Bacteria 206374
198 Ga0501043_0627961 3300049579 Bacteria 791
199 Ga0501046_0000261 3300049580 Bacteria 53675
200 Ga0501046_1042490 3300049580 Bacteria 567
201 Ga0501047_0000026 3300049581 Bacteria 225296
202 Ga0501047_0619103 3300049581 Unclassified 903
203 Ga0501047_1152804 3300049581 Bacteria 589
204 Ga0501048_0002433 3300049582 Bacteria 14208
205 Ga0501067_0055664 3300049583 Bacteria 2191
206 Ga0501068_0173225 3300049584 Bacteria 1362
207 Ga0501069_0003973 3300049585 Bacteria 7627
208 Ga0501070_0007226 3300049586 Bacteria 9429
209 Ga0501070_0034858 3300049586 Bacteria 4206
210 Ga0501071_0389373 3300049587 Bacteria 1063
211 Ga0501073_0004836 3300049589 Bacteria 10110
212 Ga0501074_0203807 3300049590 Bacteria 1409
213 Ga0501257_070680 3300049686 Bacteria 892
214 Ga0501079_0828416 3300049741 Bacteria 728
215 Ga0501080_0011264 3300049742 Bacteria 8185
216 Ga0501080_0959537 3300049742 Unclassified 743
217 Ga0501081_0156768 3300049743 Bacteria 1638
218 Ga0501083_0179318 3300049744 Bacteria 1383
219 Ga0501271_059811 3300049768 Bacteria 533
220 Ga0501035_0126760 3300049822 Bacteria 2228
221 Ga0501035_0548114 3300049822 Bacteria 947
222 Ga0501035_1328093 3300049822 Bacteria 553
223 Ga0501044_0000253 3300049823 Bacteria 67988
224 Ga0501044_1251477 3300049823 Bacteria 609
225 Ga0501045_0024066 3300049824 Bacteria 4370
226 nmdc:mga03683_10500_c1 3300050489 Bacteria 3322
227 nmdc:mga03683_47079_c1 3300050489 Bacteria 1789
228 nmdc:mga03n38_30849_c1 3300050490 Bacteria 2257
229 nmdc:mga00v17_563154_c1 3300050491 Bacteria 736
230 nmdc:mga00v17_627741_c1 3300050491 Bacteria 692
231 nmdc:mga0k408_7671_c1 3300050493 Bacteria 5765
232 nmdc:mga05p37_2251536_c1 3300050507 Unclassified 504
233 nmdc:mga09592_275307_c1 3300050508 Bacteria 1460
234 nmdc:mga0qj67_38694_c1 3300050509 Bacteria 3742
235 nmdc:mga0a205_1293303_c1 3300050515 Bacteria 577
236 Ga0500559_0407220 3300053136 Bacteria 632
237 Ga0500568_0001585 3300053139 Bacteria 14392
238 Ga0500604_0002288 3300053151 Bacteria 5243
239 Ga0500616_0077084 3300053153 Bacteria 1684
240 Ga0500627_0003788 3300053158 Bacteria 4748
241 Ga0501084_0476827 3300054114 Bacteria 1054
242 Ga0501082_0223089 3300060353 Bacteria 1640
243 Ga0501082_0506162 3300060353 Bacteria 1055
244 Ga0501082_1391200 3300060353 Bacteria 613
245 2643895127 2643221577 Bacteria 3710843
246 2644304561 2643221654 Bacteria 5273570
247 2644477286 2643221685 Bacteria 3673288
248 2738886209 2738541307 Bacteria 8606193
249 2739249804 2738543013 Bacteria 5618633
250 Ga0070688_100616117
251 Ga0055533_1010285
252 Ga0058863_10087193
253 Ga0058861_10068031
254 Ga0065704_10126465
255 Ga0070658_10041251
256 Ga0070676_10263427
257 Ga0070670_100134288
258 Ga0070670_100277017
259 Ga0070677_10250202
260 Ga0068869_100359008
261 Ga0070680_100851577
262 Ga0068868_102049184
263 Ga0070687_100491889
264 Ga0070687_101407072
265 Ga0070675_100579846
266 Ga0070671_100572777
267 Ga0070671_100935722
268 Ga0070673_100360713
269 Ga0070688_100782983
270 Ga0070659_100359066
271 Ga0070714_100031641
272 Ga0070713_100001332
273 Ga0070711_100135506
274 Ga0070711_100592584
275 Ga0070705_100927523
276 Ga0068867_100452405
277 Ga0070685_10416734
278 Ga0070679_101289515
279 Ga0070672_100687549
280 Ga0070664_100013022
281 Ga0070664_100018006
282 Ga0070702_100784632
283 Ga0068859_100626925
284 Ga0068861_100723675
285 Ga0068860_101088813
286 Ga0070717_10007364
287 Ga0075363_100051673
288 Ga0075363_100095969
289 Ga0075364_10472650
290 Ga0075364_10512465
291 Ga0075362_10001615
292 Ga0075362_10452274
293 Ga0075362_10601966
294 Ga0075366_10060953
295 Ga0075370_10402773
296 Ga0068871_100950748
297 Ga0068871_101242822
298 Ga0075428_101460782
299 Ga0075430_100426954
300 Ga0075429_100025231
301 Ga0068865_100296749
302 Ga0097620_100626952
303 Ga0105240_11626469
304 Ga0111539_12974811
305 Ga0114129_12589588
306 Ga0105248_11776081
307 Ga0105248_12303580
308 Ga0105248_12556009
309 Ga0105237_10432333
310 Ga0105246_10189512
311 Ga0157370_10486586
312 Ga0157378_10854528
313 Ga0157378_11452368
314 Ga0163162_10172346
315 Ga0157375_10012820
316 Ga0157375_12199416
317 Ga0157380_10823379
318 Ga0157380_10963053
319 Ga0182008_10022796
320 Ga0157376_10119245
321 Ga0157376_11113090
322 Ga0182007_10041722
323 Ga0163161_10098702
324 Ga0163161_10326165
325 Ga0206356_10103389
326 Ga0206351_10834464
327 Ga0206352_11014085
328 Ga0206350_10441049
329 Ga0206350_11447234
330 Ga0206354_10343204
331 Ga0213876_10770068
332 Ga0213871_10001174
333 Ga0209674_102540
334 Ga0207643_10286754
335 Ga0207705_10032556
336 Ga0207707_10040090
337 Ga0207693_10273349
338 Ga0207693_10563478
339 Ga0207660_10565994
340 Ga0207662_10690830
341 Ga0207649_11654250
342 Ga0207652_10181766
343 Ga0207650_10124895
344 Ga0207650_11226443
345 Ga0207700_10001219
346 Ga0207664_10016050
347 Ga0207644_10384573
348 Ga0207644_11402691
349 Ga0207690_10445102
350 Ga0207706_10811078
351 Ga0207670_10318215
352 Ga0207689_10386394
353 Ga0207679_10399934
354 Ga0207651_11041056
355 Ga0207648_10764274
356 Ga0207676_10442346
357 Ga0207683_10080171
358 Ga0207683_11882635
359 Ga0207698_10521303
360 Ga0268265_11547952
361 Ga0268264_10207944
362 Ga0307515_10010437
363 Ga0307515_10487111
364 Ga0265332_10294003
365 Ga0307408_100133327
366 Ga0307408_102038246
367 Ga0307508_10324251
368 Ga0316578_10196472
369 Ga0307405_10387079
370 Ga0307412_10046588
371 Ga0307412_11174137
372 Ga0307416_100017062
373 Ga0307416_100056724
374 Ga0307416_100412717
375 Ga0307416_101052370
376 Ga0307411_10056530
377 Ga0373939_0132113
378 Ga0373931_0116752
379 Ga0373947_0867248
380 Ga0436364_0718421
381 Ga0436364_0863812
382 Ga0436364_1387816
383 Ga0436365_0739501
384 Ga0436360_1106222
385 Ga0436360_1343000
386 Ga0436363_0472164
387 Ga0436362_0694761
388 Ga0439436_0047639
389 Ga0439439_0003522
390 Ga0439447_008609
391 Ga0439461_0037843
392 Ga0439466_0014241
393 Ga0451833_0065676
394 Ga0451839_1469121
395 Ga0439431_0022000
396 Ga0439433_0005036
397 Ga0439442_023268
398 Ga0439442_133345
399 Ga0439445_0010385
400 Ga0439432_011446
401 Ga0439449_0003803
402 Ga0439452_023649
403 Ga0439462_0064016
404 Ga0450923_005313
405 Ga0450897_010218
406 Ga0450894_057434
407 Ga0450896_007651
408 Ga0450898_031330
409 Ga0450898_124189
410 Ga0450899_002990
411 Ga0450907_072158
412 Ga0439446_0099177
413 Ga0450908_057455
414 Ga0439434_0017599
415 Ga0453683_0181036
416 Ga0466963_1265616
417 Ga0466959_0835431
418 Ga0451576_0279009
419 Ga0466958_0885483
420 Ga0495616_0000022
421 Ga0495628_0575034
422 Ga0495628_0892702
423 Ga0495630_1405209
424 Ga0495648_0216150
425 Ga0495587_0072871
426 Ga0495645_0285622
427 Ga0495645_0420623
428 Ga0495668_0122250
429 Ga0495588_0303531
430 Ga0495658_0134095
431 Ga0495670_0744032
432 Ga0495636_0549199
433 Ga0496102_0105133
434 Ga0496117_0074713
435 Ga0501306_062815
436 Ga0501308_053546
437 Ga0501308_074044
438 Ga0501305_107752
439 Ga0501307_032889
440 Ga0501032_0664912
441 Ga0501034_0035200
442 Ga0501034_0382248
443 Ga0501034_0573136
444 Ga0501036_0566904
445 Ga0501038_1002858
446 Ga0501043_0000010
447 Ga0501043_0627961
448 Ga0501046_0000261
449 Ga0501046_1042490
450 Ga0501047_0000026
451 Ga0501047_0619103
452 Ga0501047_1152804
453 Ga0501048_0002433
454 Ga0501067_0055664
455 Ga0501068_0173225
456 Ga0501069_0003973
457 Ga0501070_0007226
458 Ga0501070_0034858
459 Ga0501071_0389373
460 Ga0501073_0004836
461 Ga0501074_0203807
462 Ga0501257_070680
463 Ga0501079_0828416
464 Ga0501080_0011264
465 Ga0501080_0959537
466 Ga0501081_0156768
467 Ga0501083_0179318
468 Ga0501271_059811
469 Ga0501035_0126760
470 Ga0501035_0548114
471 Ga0501035_1328093
472 Ga0501044_0000253
473 Ga0501044_1251477
474 Ga0501045_0024066
475 nmdc:mga03683_10500_c1
476 nmdc:mga03683_47079_c1
477 nmdc:mga03n38_30849_c1
478 nmdc:mga00v17_563154_c1
479 nmdc:mga00v17_627741_c1
480 nmdc:mga0k408_7671_c1
481 nmdc:mga05p37_2251536_c1
482 nmdc:mga09592_275307_c1
483 nmdc:mga0qj67_38694_c1
484 nmdc:mga0a205_1293303_c1
485 Ga0500559_0407220
486 Ga0500568_0001585
487 Ga0500604_0002288
488 Ga0500616_0077084
489 Ga0500627_0003788
490 Ga0501084_0476827
491 Ga0501082_0223089
492 Ga0501082_0506162
493 Ga0501082_1391200
494 2643895127
495 2644304561
496 2644477286
497 2738886209
498 2739249804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

33

80

0.96

Map