F360475

General Info

Members Datasets Scaffolds Average Seq Length
249 151 498 142

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_101166273|Ga0070682_1011662731
Length 165
Sequence VDSHCQAAFVLASGEGGTGAKKGTIGKMAYAGDVTAQQAWERLSSDPRSELIDVRTTAEWSYVGVPDLSRLGKSLLRVQWQAYPSMTLNPQFTAELARAELSKDQTLFFLCRSGARSRAAAEAMTALGYPHCYNVADGFEGPRDPEGHRSRIAGWKASGLPWTQE

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
68 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
80 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
81 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
82 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
151 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.8
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 9.24
Rhizosphere 88.35
Stem 0
Stem Tuber 0
Unclassified 17.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101166273 3300005337 Unclassified 648
2 JGI24739J22299_10222051 3300001989 Unclassified 554
3 JGI24737J22298_10071553 3300001990 Bacteria 1035
4 JGI24735J21928_10036372 3300002067 Bacteria 1444
5 rootH2_10024294 3300003320 Bacteria 27838
6 Ga0065712_10134074 3300005290 Bacteria 1516
7 Ga0065715_10384921 3300005293 Unclassified 902
8 Ga0068869_100136533 3300005334 Bacteria 1890
9 Ga0070659_100204537 3300005366 Bacteria 1626
10 Ga0070711_101198955 3300005439 Unclassified 656
11 Ga0070705_100014475 3300005440 Bacteria 4059
12 Ga0070681_10204677 3300005458 Bacteria 1891
13 Ga0070697_100488987 3300005536 Unclassified 1075
14 Ga0068853_100388527 3300005539 Bacteria 1304
15 Ga0070693_100118417 3300005547 Bacteria 1639
16 Ga0070704_100006200 3300005549 Bacteria 7026
17 Ga0070664_100362002 3300005564 Bacteria 1321
18 Ga0070712_100000703 3300006175 Bacteria 19715
19 Ga0075367_10282715 3300006178 Unclassified 1043
20 Ga0075370_10267612 3300006353 Unclassified 1014
21 Ga0075434_100039508 3300006871 Bacteria 4676
22 Ga0075435_100086035 3300007076 Bacteria 2588
23 Ga0105244_10518972 3300009036 Unclassified 549
24 Ga0114129_10166655 3300009147 Bacteria 3006
25 Ga0105243_10423295 3300009148 Bacteria 1243
26 Ga0105248_10432502 3300009177 Bacteria 1482
27 Ga0105249_10223109 3300009553 Bacteria 1855
28 Ga0105249_10269955 3300009553 Unclassified 1694
29 Ga0105239_10310447 3300010375 Bacteria 1777
30 Ga0157372_10723407 3300013307 Bacteria 1158
31 Ga0182008_10246611 3300014497 Unclassified 920
32 Ga0207707_10338804 3300025912 Unclassified 1297
33 Ga0207693_10000079 3300025915 Bacteria 86388
34 Ga0207687_10284180 3300025927 Bacteria 1327
35 Ga0207690_10189202 3300025932 Bacteria 1556
36 Ga0207670_11769776 3300025936 Unclassified 525
37 Ga0207665_10437884 3300025939 Unclassified 1001
38 Ga0207661_10938652 3300025944 Bacteria 797
39 Ga0207712_10248280 3300025961 Bacteria 1437
40 Ga0207640_10422584 3300025981 Unclassified 1091
41 Ga0207675_100361489 3300026118 Bacteria 1424
42 Ga0207683_11574907 3300026121 Bacteria 606
43 Ga0265318_10127761 3300028577 Unclassified 934
44 Ga0265338_10037107 3300028800 Bacteria 4646
45 Ga0265330_10128845 3300031235 Bacteria 1077
46 Ga0265330_10250177 3300031235 Unclassified 747
47 Ga0265325_10004568 3300031241 Bacteria 8709
48 Ga0265329_10205597 3300031242 Bacteria 649
49 Ga0265340_10016965 3300031247 Bacteria 3767
50 Ga0265340_10054870 3300031247 Bacteria 1921
51 Ga0265340_10079225 3300031247 Bacteria 1548
52 Ga0265339_10064575 3300031249 Bacteria 1964
53 Ga0265339_10097898 3300031249 Bacteria 1530
54 Ga0265339_10121986 3300031249 Bacteria 1339
55 Ga0265339_10211218 3300031249 Unclassified 953
56 Ga0265331_10061786 3300031250 Bacteria 1768
57 Ga0265331_10470591 3300031250 Unclassified 565
58 Ga0265316_10038784 3300031344 Bacteria 3833
59 Ga0265316_10106155 3300031344 Bacteria 2130
60 Ga0307408_100732195 3300031548 Bacteria 892
61 Ga0265313_10029064 3300031595 Bacteria 2864
62 Ga0265313_10036974 3300031595 Bacteria 2447
63 Ga0265313_10059175 3300031595 Bacteria 1803
64 Ga0265313_10158286 3300031595 Bacteria 963
65 Ga0316575_10147521 3300031665 Bacteria 969
66 Ga0316579_10035325 3300031691 Bacteria 2303
67 Ga0316579_10052125 3300031691 Bacteria 1915
68 Ga0265314_10019025 3300031711 Bacteria 5329
69 Ga0265314_10031527 3300031711 Bacteria 3911
70 Ga0265342_10031699 3300031712 Bacteria 3266
71 Ga0265342_10049462 3300031712 Bacteria 2515
72 Ga0265342_10062560 3300031712 Bacteria 2190
73 Ga0316576_10005231 3300031727 Bacteria 7894
74 Ga0316576_10008508 3300031727 Bacteria 6551
75 Ga0316578_10003996 3300031728 Bacteria 6879
76 Ga0316578_10062501 3300031728 Bacteria 2195
77 Ga0316578_10769827 3300031728 Bacteria 559
78 Ga0316577_10014870 3300031733 Bacteria 4278
79 Ga0307410_10360474 3300031852 Bacteria 1164
80 Ga0307406_10078086 3300031901 Bacteria 2192
81 Ga0307407_10433783 3300031903 Bacteria 950
82 Ga0307409_100109198 3300031995 Bacteria 2316
83 Ga0307409_100975262 3300031995 Bacteria 865
84 Ga0307416_100622765 3300032002 Bacteria 1161
85 Ga0316583_10026099 3300032133 Bacteria 2085
86 Ga0316583_10077360 3300032133 Bacteria 1163
87 Ga0316585_10015015 3300032137 Bacteria 2319
88 Ga0316580_10003502 3300032139 Bacteria 4466
89 Ga0373939_0038345 3300035114 Bacteria 1429
90 Ga0373955_0237899 3300035172 Bacteria 1090
91 Ga0316574_0008925 3300035398 Bacteria 5595
92 Ga0316574_0348039 3300035398 Bacteria 938
93 Ga0373937_0325613 3300036401 Bacteria 1454
94 Ga0316584_0008137 3300036712 Bacteria 7206
95 Ga0316584_0024306 3300036712 Bacteria 4433
96 Ga0395899_0075184 3300037312 Bacteria 2467
97 Ga0395900_0033125 3300037418 Bacteria 5318
98 Ga0395898_0009833 3300037466 Bacteria 10026
99 Ga0395898_0119196 3300037466 Bacteria 2528
100 Ga0316581_0132405 3300037588 Bacteria 769
101 Ga0395901_0038864 3300038443 Bacteria 4922
102 Ga0395901_0305266 3300038443 Bacteria 1649
103 Ga0395901_0600117 3300038443 Bacteria 1110
104 Ga0439466_0170631 3300041411 Bacteria 664
105 Ga0451843_0206897 3300041509 Bacteria 954
106 Ga0451843_0402297 3300041509 Bacteria 1007
107 Ga0450906_049620 3300042145 Bacteria 741
108 Ga0439458_0181198 3300042157 Bacteria 572
109 Ga0450909_027748 3300042185 Bacteria 855
110 Ga0466960_0086503 3300044901 Bacteria 1589
111 Ga0466960_0622383 3300044901 Bacteria 642
112 Ga0451576_0070982 3300045051 Bacteria 3625
113 Ga0451576_1390411 3300045051 Bacteria 730
114 Ga0451576_2381147 3300045051 Unclassified 542
115 Ga0495592_0192356 3300046454 Bacteria 1382
116 Ga0495653_0264771 3300046463 Bacteria 1135
117 Ga0495608_0373530 3300046511 Unclassified 875
118 Ga0495608_0468794 3300046511 Bacteria 765
119 Ga0495628_0188533 3300046516 Bacteria 1558
120 Ga0495628_0400676 3300046516 Unclassified 1002
121 Ga0495587_0562729 3300046536 Unclassified 629
122 Ga0495645_0378477 3300046543 Unclassified 906
123 Ga0495667_0474481 3300046559 Bacteria 785
124 Ga0495599_0153539 3300046678 Bacteria 1425
125 Ga0495613_1114633 3300046689 Bacteria 503
126 Ga0495684_0211794 3300047471 Bacteria 1425
127 Ga0495684_0819659 3300047471 Unclassified 606
128 Ga0495614_0085130 3300048089 Bacteria 1372
129 Ga0496100_0025788 3300048903 Bacteria 3597
130 Ga0496100_0066461 3300048903 Bacteria 2392
131 Ga0496101_0120137 3300048904 Bacteria 1986
132 Ga0496101_0242720 3300048904 Bacteria 1402
133 Ga0496102_0011649 3300048905 Bacteria 7588
134 Ga0496102_0023737 3300048905 Bacteria 5450
135 Ga0496102_0026648 3300048905 Bacteria 5159
136 Ga0496102_0381662 3300048905 Bacteria 1326
137 Ga0496103_0008934 3300048906 Bacteria 5941
138 Ga0496103_0127406 3300048906 Bacteria 1624
139 Ga0496106_0174416 3300048909 Bacteria 1705
140 Ga0496106_0325043 3300048909 Bacteria 1235
141 Ga0496106_0426069 3300048909 Bacteria 1066
142 Ga0496107_0074052 3300048910 Bacteria 2478
143 Ga0496107_0136175 3300048910 Bacteria 1814
144 Ga0496107_0190872 3300048910 Bacteria 1522
145 Ga0496108_0599456 3300048911 Unclassified 960
146 Ga0496109_1098517 3300048912 Unclassified 732
147 Ga0496110_0250354 3300048913 Bacteria 1612
148 Ga0496111_0054498 3300048914 Bacteria 2891
149 Ga0496112_0368811 3300048915 Bacteria 1377
150 Ga0496114_0007984 3300048917 Bacteria 8374
151 Ga0496114_0012324 3300048917 Bacteria 6841
152 Ga0501031_0032042 3300049568 Bacteria 3427
153 Ga0501032_0118073 3300049569 Bacteria 1754
154 Ga0501033_0013139 3300049570 Bacteria 6308
155 Ga0501033_0227103 3300049570 Bacteria 1327
156 Ga0501034_0503884 3300049571 Bacteria 1124
157 Ga0501034_1648822 3300049571 Unclassified 514
158 Ga0501036_0001837 3300049572 Bacteria 16480
159 Ga0501036_0703137 3300049572 Bacteria 835
160 Ga0501036_1264668 3300049572 Unclassified 600
161 Ga0501037_0018783 3300049573 Bacteria 5094
162 Ga0501037_0039652 3300049573 Bacteria 3467
163 Ga0501037_0423125 3300049573 Unclassified 911
164 Ga0501038_0025172 3300049574 Bacteria 5306
165 Ga0501039_0007376 3300049575 Bacteria 8386
166 Ga0501039_0212821 3300049575 Unclassified 1520
167 Ga0501039_0393195 3300049575 Bacteria 1089
168 Ga0501040_0004729 3300049576 Bacteria 8838
169 Ga0501041_0005225 3300049577 Bacteria 7581
170 Ga0501042_0324989 3300049578 Bacteria 1111
171 Ga0501042_0531214 3300049578 Bacteria 855
172 Ga0501042_0930421 3300049578 Bacteria 633
173 Ga0501043_0169124 3300049579 Bacteria 1706
174 Ga0501043_0193441 3300049579 Unclassified 1581
175 Ga0501043_0672244 3300049579 Unclassified 759
176 Ga0501046_0009207 3300049580 Bacteria 8550
177 Ga0501046_0156847 3300049580 Unclassified 1714
178 Ga0501047_0173051 3300049581 Unclassified 2028
179 Ga0501047_0191454 3300049581 Bacteria 1908
180 Ga0501048_0004847 3300049582 Bacteria 10255
181 Ga0501048_0197212 3300049582 Unclassified 1427
182 Ga0501048_0578614 3300049582 Bacteria 806
183 Ga0501067_0000488 3300049583 Bacteria 21685
184 Ga0501067_0022999 3300049583 Bacteria 3452
185 Ga0501067_0041896 3300049583 Bacteria 2543
186 Ga0501067_0056268 3300049583 Bacteria 2179
187 Ga0501067_0623727 3300049583 Bacteria 605
188 Ga0501068_0119210 3300049584 Bacteria 1644
189 Ga0501068_0221640 3300049584 Unclassified 1202
190 Ga0501069_0111812 3300049585 Bacteria 1556
191 Ga0501070_0260438 3300049586 Bacteria 1417
192 Ga0501070_0645073 3300049586 Unclassified 841
193 Ga0501071_0009727 3300049587 Bacteria 6414
194 Ga0501071_0564073 3300049587 Unclassified 875
195 Ga0501072_0027871 3300049588 Bacteria 4408
196 Ga0501072_0164100 3300049588 Unclassified 1772
197 Ga0501072_0215281 3300049588 Bacteria 1531
198 Ga0501073_0023884 3300049589 Bacteria 4390
199 Ga0501073_0182599 3300049589 Bacteria 1452
200 Ga0501073_0190825 3300049589 Bacteria 1418
201 Ga0501074_0013727 3300049590 Bacteria 5888
202 Ga0501074_0037257 3300049590 Bacteria 3526
203 Ga0501074_0132487 3300049590 Bacteria 1783
204 Ga0501075_0002684 3300049591 Bacteria 11894
205 Ga0501075_0249083 3300049591 Bacteria 1354
206 Ga0501076_0000929 3300049592 Bacteria 19077
207 Ga0501076_0127785 3300049592 Bacteria 2060
208 Ga0501076_0173438 3300049592 Unclassified 1758
209 Ga0501076_0263448 3300049592 Unclassified 1411
210 Ga0501077_0033748 3300049593 Bacteria 3257
211 Ga0501077_0114090 3300049593 Bacteria 1713
212 Ga0501077_0149248 3300049593 Bacteria 1483
213 Ga0501079_0001868 3300049741 Bacteria 15106
214 Ga0501079_0049728 3300049741 Bacteria 3236
215 Ga0501080_0034712 3300049742 Bacteria 4710
216 Ga0501080_0103722 3300049742 Bacteria 2637
217 Ga0501080_0576341 3300049742 Bacteria 1001
218 Ga0501081_0092108 3300049743 Bacteria 2132
219 Ga0501083_0000802 3300049744 Bacteria 20586
220 Ga0501083_0015279 3300049744 Bacteria 5376
221 Ga0501083_0072990 3300049744 Bacteria 2281
222 Ga0501083_0089675 3300049744 Bacteria 2031
223 Ga0501083_0276782 3300049744 Bacteria 1092
224 Ga0501035_0077178 3300049822 Bacteria 2944
225 Ga0501035_0447912 3300049822 Bacteria 1068
226 Ga0501044_0508320 3300049823 Bacteria 1105
227 Ga0501045_0001132 3300049824 Bacteria 17640
228 Ga0501045_0055685 3300049824 Bacteria 2892
229 nmdc:mga05p37_180522_c1 3300050507 Bacteria 2568
230 nmdc:mga0n895_36953_c1 3300050512 Bacteria 4720
231 nmdc:mga0rr50_163690_c1 3300050513 Bacteria 1807
232 Ga0495619_0622842 3300053085 Bacteria 737
233 Ga0501084_0039238 3300054114 Bacteria 3960
234 Ga0501084_0110835 3300054114 Bacteria 2306
235 Ga0501084_0129703 3300054114 Bacteria 2122
236 Ga0501084_0150341 3300054114 Bacteria 1962
237 Ga0501084_0165109 3300054114 Bacteria 1869
238 Ga0501084_0240676 3300054114 Bacteria 1527
239 Ga0587086_007862 3300059507 Bacteria 1232
240 Ga0587107_060113 3300059652 Unclassified 668
241 Ga0501082_0023705 3300060353 Bacteria 5292
242 Ga0501082_0136760 3300060353 Bacteria 2126
243 Ga0501082_0253348 3300060353 Bacteria 1531
244 Ga0501082_1156060 3300060353 Bacteria 676
245 Ga0530510_0005157 3300061734 Bacteria 9013
246 Ga0530510_0442973 3300061734 Bacteria 982
247 Ga0530510_1517945 3300061734 Unclassified 514
248 2837683223 2837678835 Bacteria 5252418
249 2919450816 2919446982 Bacteria 3994487
250 Ga0070682_101166273
251 JGI24739J22299_10222051
252 JGI24737J22298_10071553
253 JGI24735J21928_10036372
254 rootH2_10024294
255 Ga0065712_10134074
256 Ga0065715_10384921
257 Ga0068869_100136533
258 Ga0070659_100204537
259 Ga0070711_101198955
260 Ga0070705_100014475
261 Ga0070681_10204677
262 Ga0070697_100488987
263 Ga0068853_100388527
264 Ga0070693_100118417
265 Ga0070704_100006200
266 Ga0070664_100362002
267 Ga0070712_100000703
268 Ga0075367_10282715
269 Ga0075370_10267612
270 Ga0075434_100039508
271 Ga0075435_100086035
272 Ga0105244_10518972
273 Ga0114129_10166655
274 Ga0105243_10423295
275 Ga0105248_10432502
276 Ga0105249_10223109
277 Ga0105249_10269955
278 Ga0105239_10310447
279 Ga0157372_10723407
280 Ga0182008_10246611
281 Ga0207707_10338804
282 Ga0207693_10000079
283 Ga0207687_10284180
284 Ga0207690_10189202
285 Ga0207670_11769776
286 Ga0207665_10437884
287 Ga0207661_10938652
288 Ga0207712_10248280
289 Ga0207640_10422584
290 Ga0207675_100361489
291 Ga0207683_11574907
292 Ga0265318_10127761
293 Ga0265338_10037107
294 Ga0265330_10128845
295 Ga0265330_10250177
296 Ga0265325_10004568
297 Ga0265329_10205597
298 Ga0265340_10016965
299 Ga0265340_10054870
300 Ga0265340_10079225
301 Ga0265339_10064575
302 Ga0265339_10097898
303 Ga0265339_10121986
304 Ga0265339_10211218
305 Ga0265331_10061786
306 Ga0265331_10470591
307 Ga0265316_10038784
308 Ga0265316_10106155
309 Ga0307408_100732195
310 Ga0265313_10029064
311 Ga0265313_10036974
312 Ga0265313_10059175
313 Ga0265313_10158286
314 Ga0316575_10147521
315 Ga0316579_10035325
316 Ga0316579_10052125
317 Ga0265314_10019025
318 Ga0265314_10031527
319 Ga0265342_10031699
320 Ga0265342_10049462
321 Ga0265342_10062560
322 Ga0316576_10005231
323 Ga0316576_10008508
324 Ga0316578_10003996
325 Ga0316578_10062501
326 Ga0316578_10769827
327 Ga0316577_10014870
328 Ga0307410_10360474
329 Ga0307406_10078086
330 Ga0307407_10433783
331 Ga0307409_100109198
332 Ga0307409_100975262
333 Ga0307416_100622765
334 Ga0316583_10026099
335 Ga0316583_10077360
336 Ga0316585_10015015
337 Ga0316580_10003502
338 Ga0373939_0038345
339 Ga0373955_0237899
340 Ga0316574_0008925
341 Ga0316574_0348039
342 Ga0373937_0325613
343 Ga0316584_0008137
344 Ga0316584_0024306
345 Ga0395899_0075184
346 Ga0395900_0033125
347 Ga0395898_0009833
348 Ga0395898_0119196
349 Ga0316581_0132405
350 Ga0395901_0038864
351 Ga0395901_0305266
352 Ga0395901_0600117
353 Ga0439466_0170631
354 Ga0451843_0206897
355 Ga0451843_0402297
356 Ga0450906_049620
357 Ga0439458_0181198
358 Ga0450909_027748
359 Ga0466960_0086503
360 Ga0466960_0622383
361 Ga0451576_0070982
362 Ga0451576_1390411
363 Ga0451576_2381147
364 Ga0495592_0192356
365 Ga0495653_0264771
366 Ga0495608_0373530
367 Ga0495608_0468794
368 Ga0495628_0188533
369 Ga0495628_0400676
370 Ga0495587_0562729
371 Ga0495645_0378477
372 Ga0495667_0474481
373 Ga0495599_0153539
374 Ga0495613_1114633
375 Ga0495684_0211794
376 Ga0495684_0819659
377 Ga0495614_0085130
378 Ga0496100_0025788
379 Ga0496100_0066461
380 Ga0496101_0120137
381 Ga0496101_0242720
382 Ga0496102_0011649
383 Ga0496102_0023737
384 Ga0496102_0026648
385 Ga0496102_0381662
386 Ga0496103_0008934
387 Ga0496103_0127406
388 Ga0496106_0174416
389 Ga0496106_0325043
390 Ga0496106_0426069
391 Ga0496107_0074052
392 Ga0496107_0136175
393 Ga0496107_0190872
394 Ga0496108_0599456
395 Ga0496109_1098517
396 Ga0496110_0250354
397 Ga0496111_0054498
398 Ga0496112_0368811
399 Ga0496114_0007984
400 Ga0496114_0012324
401 Ga0501031_0032042
402 Ga0501032_0118073
403 Ga0501033_0013139
404 Ga0501033_0227103
405 Ga0501034_0503884
406 Ga0501034_1648822
407 Ga0501036_0001837
408 Ga0501036_0703137
409 Ga0501036_1264668
410 Ga0501037_0018783
411 Ga0501037_0039652
412 Ga0501037_0423125
413 Ga0501038_0025172
414 Ga0501039_0007376
415 Ga0501039_0212821
416 Ga0501039_0393195
417 Ga0501040_0004729
418 Ga0501041_0005225
419 Ga0501042_0324989
420 Ga0501042_0531214
421 Ga0501042_0930421
422 Ga0501043_0169124
423 Ga0501043_0193441
424 Ga0501043_0672244
425 Ga0501046_0009207
426 Ga0501046_0156847
427 Ga0501047_0173051
428 Ga0501047_0191454
429 Ga0501048_0004847
430 Ga0501048_0197212
431 Ga0501048_0578614
432 Ga0501067_0000488
433 Ga0501067_0022999
434 Ga0501067_0041896
435 Ga0501067_0056268
436 Ga0501067_0623727
437 Ga0501068_0119210
438 Ga0501068_0221640
439 Ga0501069_0111812
440 Ga0501070_0260438
441 Ga0501070_0645073
442 Ga0501071_0009727
443 Ga0501071_0564073
444 Ga0501072_0027871
445 Ga0501072_0164100
446 Ga0501072_0215281
447 Ga0501073_0023884
448 Ga0501073_0182599
449 Ga0501073_0190825
450 Ga0501074_0013727
451 Ga0501074_0037257
452 Ga0501074_0132487
453 Ga0501075_0002684
454 Ga0501075_0249083
455 Ga0501076_0000929
456 Ga0501076_0127785
457 Ga0501076_0173438
458 Ga0501076_0263448
459 Ga0501077_0033748
460 Ga0501077_0114090
461 Ga0501077_0149248
462 Ga0501079_0001868
463 Ga0501079_0049728
464 Ga0501080_0034712
465 Ga0501080_0103722
466 Ga0501080_0576341
467 Ga0501081_0092108
468 Ga0501083_0000802
469 Ga0501083_0015279
470 Ga0501083_0072990
471 Ga0501083_0089675
472 Ga0501083_0276782
473 Ga0501035_0077178
474 Ga0501035_0447912
475 Ga0501044_0508320
476 Ga0501045_0001132
477 Ga0501045_0055685
478 nmdc:mga05p37_180522_c1
479 nmdc:mga0n895_36953_c1
480 nmdc:mga0rr50_163690_c1
481 Ga0495619_0622842
482 Ga0501084_0039238
483 Ga0501084_0110835
484 Ga0501084_0129703
485 Ga0501084_0150341
486 Ga0501084_0165109
487 Ga0501084_0240676
488 Ga0587086_007862
489 Ga0587107_060113
490 Ga0501082_0023705
491 Ga0501082_0136760
492 Ga0501082_0253348
493 Ga0501082_1156060
494 Ga0530510_0005157
495 Ga0530510_0442973
496 Ga0530510_1517945
497 2837683223
498 2919450816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

35

143

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fsx-assembly1.cif.gz_A crystal structure of rv0390 from m. tuberculosis 0.9579 2 137
2fsx-assembly1.cif.gz_A crystal structure of rv0390 from m. tuberculosis 0.9508 2 137
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.884 1 135
8a56-assembly1.cif.gz_B coenzyme a-persulfide reductase (coapr) from enterococcus faecalis 0.8766 5 112
2dcq-assembly1.cif.gz_A fully automated nmr structure determination of the rhodanese homology domain at4g01050(175-295) from arabidopsis thaliana 0.8708 5 136
ID Description Score Start End Superfamily
2fsxA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9579 2 137 3.40.250.10
2fsxA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9508 2 137 3.40.250.10
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8804 5 135 3.40.250.10
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8643 5 135 3.40.250.10
af_Q38853_56_181_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8576 1 135 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A1H0PY37-F1-model_v4 Rhodanese-related sulfurtransferase 0.998 3 137 GO:0016740
AF-A0A1I0T5R9-F1-model_v4 Rhodanese-related sulfurtransferase 0.9887 3 137 GO:0016740
AF-A0A2E4NIN1-F1-model_v4 Sulfurtransferase 0.985 3 137 GO:0016740
AF-A0A849BZ18-F1-model_v4 Rhodanese-like domain-containing protein 0.9847 2 137
AF-A0A7Y2W1V1-F1-model_v4 deleted 0.9846 3 137

Map