F360361

General Info

Members Datasets Scaffolds Average Seq Length
249 157 498 385

Family's Representative Sequence

Representative Sequence 3300000549|LJQas_1001054|LJQas_10010545
Length 403
Sequence MPATPPADRLASRLQGIPPTIFSAMSALAVRTQAVNLGQGFPDVDGPPEVIAHAVAALRGGHNQYAPGVGLPTLRQAIARHQQRHYGLELDPDSQVVVTTGCTEGIAAALLGLVNPGDEIVVLEPYYDSYVAMIQMAGGVRRPVTLRAPEFRLDVDELRAAVGPRTRFLLLNSPHNPTGTVLSREELAAVATVAIEHDLVVITDEVYEHLTFDGHEHVPLATLPGMFERTLSLSSAGKSYSFTGWKVGWATGPEELVGAVLAAKQWLTFTSGSPLQPAIAHALDETPDFPRRLAAELQERRDLLCAGLTKVGLDVRVPEGTYFATADVSALGWEDGMSFCLALPERAGVVAIPSQVFFDDPEAGRHLVRFAFCKQPEVIQEGIDRLLNADLTREQTTGRRFQA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2643221561 Nocardioides sp. Root151 Isolate Unclassified
141 2643221576 Nocardioides sp. Root614 Isolate Unclassified
142 2643221590 Nocardioides sp. Root682 Isolate Unclassified
143 2643221604 Nocardioides sp. Root190 Isolate Unclassified
144 2643221617 Nocardioides sp. Root79 Isolate Unclassified
145 2643221620 Nocardioides sp. Root240 Isolate Unclassified
146 2643221641 Nocardioides sp. Root122 Isolate Unclassified
147 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
148 2643221696 Nocardioides sp. Root140 Isolate Unclassified
149 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
150 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
151 2738541305 Nocardioides sp. CF167 Isolate Unclassified
152 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
153 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
154 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
155 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
156 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
157 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 0.4
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 0
Rhizoplane 9.24
Rhizosphere 67.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001054 3300000549 Bacteria 4203
2 JGI24740J21852_10023049 3300001979 Bacteria 2133
3 Ga0070658_10042191 3300005327 Bacteria 3683
4 Ga0070683_100009784 3300005329 Bacteria 8215
5 Ga0070680_100180290 3300005336 Bacteria 1779
6 Ga0070682_100179970 3300005337 Bacteria 1476
7 Ga0070660_100037327 3300005339 Bacteria 3684
8 Ga0070660_100057799 3300005339 Bacteria 3006
9 Ga0070660_100071290 3300005339 Bacteria 2713
10 Ga0070692_10055261 3300005345 Bacteria 2075
11 Ga0070659_100021133 3300005366 Bacteria 4951
12 Ga0070659_100042571 3300005366 Bacteria 3551
13 Ga0070659_100051259 3300005366 Bacteria 3245
14 Ga0070667_100049817 3300005367 Bacteria 3529
15 Ga0070663_100017563 3300005455 Bacteria 4672
16 Ga0070663_100120756 3300005455 Bacteria 1979
17 Ga0070679_100082168 3300005530 Bacteria 3212
18 Ga0070684_100002500 3300005535 Bacteria 13549
19 Ga0070684_100047543 3300005535 Bacteria 3718
20 Ga0070665_100001394 3300005548 Bacteria 28474
21 Ga0068855_100095595 3300005563 Bacteria 3424
22 Ga0070664_100066938 3300005564 Bacteria 3069
23 Ga0068856_100121013 3300005614 Bacteria 2619
24 Ga0068852_100025732 3300005616 Bacteria 4773
25 Ga0068861_100268559 3300005719 Bacteria 1464
26 Ga0068860_100000955 3300005843 Bacteria 31984
27 Ga0081539_10041135 3300005985 Bacteria 2705
28 Ga0075365_10001978 3300006038 Bacteria 9687
29 Ga0075365_10014582 3300006038 Bacteria 4732
30 Ga0075365_10020036 3300006038 Bacteria 4139
31 Ga0075365_10040654 3300006038 Bacteria 3033
32 Ga0075365_10064364 3300006038 Bacteria 2456
33 Ga0075365_10074789 3300006038 Bacteria 2285
34 Ga0075365_10096771 3300006038 Bacteria 2017
35 Ga0075368_10003200 3300006042 Bacteria 5438
36 Ga0075363_100015539 3300006048 Bacteria 3744
37 Ga0075363_100022579 3300006048 Bacteria 3182
38 Ga0075363_100054837 3300006048 Bacteria 2134
39 Ga0075363_100073757 3300006048 Bacteria 1857
40 Ga0075363_100136676 3300006048 Bacteria 1378
41 Ga0075364_10014808 3300006051 Bacteria 4825
42 Ga0075364_10130426 3300006051 Bacteria 1687
43 Ga0075367_10016815 3300006178 Bacteria 4001
44 Ga0068865_100042308 3300006881 Bacteria 3107
45 Ga0105240_10020258 3300009093 Bacteria 8877
46 Ga0105245_10213086 3300009098 Bacteria 1860
47 Ga0105243_10132068 3300009148 Bacteria 2119
48 Ga0105248_10156658 3300009177 Bacteria 2570
49 Ga0105239_10100260 3300010375 Bacteria 3203
50 Ga0105246_10005912 3300011119 Bacteria 7463
51 Ga0157370_10118416 3300013104 Bacteria 2474
52 Ga0157369_10032045 3300013105 Bacteria 5782
53 Ga0157369_10046130 3300013105 Bacteria 4737
54 Ga0163162_10005981 3300013306 Bacteria 11778
55 Ga0157372_10006032 3300013307 Bacteria 12871
56 Ga0157372_10290562 3300013307 Bacteria 1901
57 Ga0157372_10434740 3300013307 Bacteria 1530
58 Ga0157375_10064334 3300013308 Bacteria 3651
59 Ga0163163_10372735 3300014325 Bacteria 1485
60 Ga0157380_10105327 3300014326 Bacteria 2357
61 Ga0157377_10116229 3300014745 Bacteria 1615
62 Ga0157379_10024456 3300014968 Bacteria 5362
63 Ga0163161_10039382 3300017792 Bacteria 3393
64 Ga0206353_10583376 3300020082 Bacteria 2395
65 Ga0207688_10009541 3300025901 Bacteria 5282
66 Ga0207688_10061882 3300025901 Bacteria 2110
67 Ga0207647_10006965 3300025904 Bacteria 8192
68 Ga0207647_10011224 3300025904 Bacteria 6290
69 Ga0207705_10137870 3300025909 Bacteria 1820
70 Ga0207695_10039635 3300025913 Bacteria 5061
71 Ga0207671_10204761 3300025914 Bacteria 1542
72 Ga0207662_10094090 3300025918 Bacteria 1847
73 Ga0207657_10025219 3300025919 Bacteria 5486
74 Ga0207657_10309995 3300025919 Bacteria 1249
75 Ga0207652_10053373 3300025921 Bacteria 3472
76 Ga0207687_10013471 3300025927 Bacteria 5338
77 Ga0207687_10125699 3300025927 Bacteria 1925
78 Ga0207690_10068679 3300025932 Bacteria 2436
79 Ga0207704_10078893 3300025938 Bacteria 2119
80 Ga0207661_10054768 3300025944 Bacteria 3196
81 Ga0207661_10113767 3300025944 Bacteria 2293
82 Ga0207679_10003223 3300025945 Bacteria 10064
83 Ga0207667_10108664 3300025949 Bacteria 2861
84 Ga0207658_10027031 3300025986 Bacteria 4029
85 Ga0207678_10036669 3300026067 Bacteria 4268
86 Ga0207678_10115360 3300026067 Bacteria 2291
87 Ga0207708_10023252 3300026075 Bacteria 4682
88 Ga0207675_100050800 3300026118 Bacteria 3869
89 Ga0207675_100151759 3300026118 Bacteria 2205
90 Ga0207683_10039014 3300026121 Bacteria 4142
91 Ga0209813_10000915 3300027866 Bacteria 6639
92 Ga0268266_10150273 3300028379 Bacteria 2098
93 Ga0268264_10000249 3300028381 Bacteria 101309
94 Ga0268264_10066817 3300028381 Bacteria 3033
95 Ga0307410_10056329 3300031852 Bacteria 2673
96 Ga0307409_100054882 3300031995 Bacteria 3072
97 Ga0307409_100085582 3300031995 Bacteria 2563
98 Ga0307409_100095754 3300031995 Bacteria 2447
99 Ga0395899_0178522 3300037312 Bacteria 1492
100 Ga0395900_0015129 3300037418 Bacteria 7867
101 Ga0395900_0207547 3300037418 Bacteria 1979
102 Ga0395898_0243577 3300037466 Bacteria 1715
103 Ga0395898_0295804 3300037466 Bacteria 1544
104 Ga0395905_0086107 3300037471 Bacteria 2945
105 Ga0395901_0012500 3300038443 Bacteria 8615
106 Ga0395901_0386901 3300038443 Bacteria 1439
107 Ga0451853_2010066 3300041512 Bacteria 2840
108 Ga0451853_4034884 3300041512 Bacteria 1396
109 Ga0466972_0007628 3300044658 Bacteria 5430
110 Ga0466966_0061298 3300044684 Bacteria 2373
111 Ga0466961_0060791 3300044693 Bacteria 2402
112 Ga0466963_0011700 3300044694 Bacteria 5348
113 Ga0466963_0047544 3300044694 Bacteria 2832
114 Ga0466963_0063929 3300044694 Bacteria 2464
115 Ga0466964_0007558 3300044706 Bacteria 4066
116 Ga0466964_0088478 3300044706 Bacteria 1343
117 Ga0466970_0023529 3300044765 Bacteria 3218
118 Ga0466970_0110173 3300044765 Bacteria 1503
119 Ga0466957_0026927 3300044842 Bacteria 3413
120 Ga0466960_0000259 3300044901 Bacteria 18187
121 Ga0466960_0003102 3300044901 Bacteria 6362
122 Ga0466960_0023032 3300044901 Bacteria 2792
123 Ga0466960_0143030 3300044901 Bacteria 1272
124 Ga0466967_0000424 3300045976 Bacteria 20077
125 Ga0466967_0031925 3300045976 Bacteria 4440
126 Ga0466967_0144005 3300045976 Bacteria 2222
127 Ga0495581_0120463 3300047315 Bacteria 1527
128 Ga0496100_0162021 3300048903 Bacteria 1604
129 Ga0496101_0065907 3300048904 Bacteria 2640
130 Ga0496102_0035410 3300048905 Bacteria 4493
131 Ga0496103_0027302 3300048906 Bacteria 3458
132 Ga0496103_0054424 3300048906 Bacteria 2480
133 Ga0496104_0025011 3300048907 Bacteria 5501
134 Ga0496104_0074835 3300048907 Bacteria 3224
135 Ga0496104_0076075 3300048907 Bacteria 3197
136 Ga0496105_0025694 3300048908 Bacteria 4796
137 Ga0496105_0067287 3300048908 Bacteria 2958
138 Ga0496106_0006036 3300048909 Bacteria 8966
139 Ga0496108_0234273 3300048911 Bacteria 1597
140 Ga0496109_0056721 3300048912 Bacteria 3574
141 Ga0496109_0073442 3300048912 Bacteria 3143
142 Ga0496110_0167217 3300048913 Bacteria 1995
143 Ga0496110_0186287 3300048913 Bacteria 1885
144 Ga0496111_0001345 3300048914 Bacteria 13887
145 Ga0496112_0058084 3300048915 Bacteria 3810
146 Ga0496114_0003939 3300048917 Bacteria 11447
147 Ga0496114_0006400 3300048917 Bacteria 9276
148 Ga0496114_0015426 3300048917 Bacteria 6145
149 Ga0496115_0022498 3300048918 Bacteria 4885
150 Ga0496115_0022983 3300048918 Bacteria 4835
151 Ga0496124_0088927 3300048927 Bacteria 2523
152 Ga0501031_0025121 3300049568 Bacteria 3886
153 Ga0501031_0026193 3300049568 Bacteria 3803
154 Ga0501031_0088126 3300049568 Bacteria 2024
155 Ga0501032_0031253 3300049569 Bacteria 3651
156 Ga0501033_0099700 3300049570 Bacteria 2121
157 Ga0501034_0083639 3300049571 Bacteria 3193
158 Ga0501036_0036291 3300049572 Bacteria 4171
159 Ga0501036_0037939 3300049572 Bacteria 4076
160 Ga0501037_0135380 3300049573 Bacteria 1764
161 Ga0501038_0139664 3300049574 Bacteria 1983
162 Ga0501039_0019658 3300049575 Bacteria 5179
163 Ga0501039_0032704 3300049575 Bacteria 4010
164 Ga0501039_0186550 3300049575 Bacteria 1631
165 Ga0501040_0049736 3300049576 Bacteria 2867
166 Ga0501041_0006053 3300049577 Bacteria 7079
167 Ga0501042_0006998 3300049578 Bacteria 7364
168 Ga0501042_0120703 3300049578 Bacteria 1887
169 Ga0501042_0122621 3300049578 Bacteria 1872
170 Ga0501046_0008650 3300049580 Bacteria 8850
171 Ga0501046_0209409 3300049580 Bacteria 1448
172 Ga0501047_0086461 3300049581 Bacteria 3013
173 Ga0501067_0000687 3300049583 Bacteria 18200
174 Ga0501067_0045901 3300049583 Bacteria 2425
175 Ga0501068_0008042 3300049584 Bacteria 5848
176 Ga0501068_0042214 3300049584 Bacteria 2743
177 Ga0501068_0209729 3300049584 Bacteria 1237
178 Ga0501069_0072291 3300049585 Bacteria 1934
179 Ga0501069_0120479 3300049585 Bacteria 1498
180 Ga0501070_0004128 3300049586 Bacteria 12497
181 Ga0501070_0017588 3300049586 Bacteria 6001
182 Ga0501070_0070203 3300049586 Bacteria 2901
183 Ga0501070_0208362 3300049586 Bacteria 1605
184 Ga0501071_0018741 3300049587 Bacteria 4798
185 Ga0501071_0022216 3300049587 Bacteria 4422
186 Ga0501071_0039966 3300049587 Bacteria 3357
187 Ga0501072_0050360 3300049588 Bacteria 3279
188 Ga0501072_0098060 3300049588 Bacteria 2329
189 Ga0501073_0002776 3300049589 Bacteria 13117
190 Ga0501073_0046478 3300049589 Bacteria 3053
191 Ga0501074_0002789 3300049590 Bacteria 12223
192 Ga0501074_0024583 3300049590 Bacteria 4378
193 Ga0501074_0094407 3300049590 Bacteria 2142
194 Ga0501075_0010500 3300049591 Bacteria 6507
195 Ga0501075_0072879 3300049591 Bacteria 2597
196 Ga0501076_0007375 3300049592 Bacteria 8002
197 Ga0501079_0016668 3300049741 Bacteria 5610
198 Ga0501080_0053528 3300049742 Bacteria 3758
199 Ga0501080_0060348 3300049742 Bacteria 3530
200 Ga0501080_0063164 3300049742 Bacteria 3447
201 Ga0501081_0054112 3300049743 Bacteria 2773
202 Ga0501035_0028795 3300049822 Bacteria 5069
203 Ga0501035_0127656 3300049822 Bacteria 2219
204 Ga0501044_0160217 3300049823 Bacteria 2227
205 Ga0501045_0172803 3300049824 Bacteria 1609
206 nmdc:mga03683_19725_c1 3300050489 Bacteria 2577
207 nmdc:mga00v17_106700_c1 3300050491 Bacteria 1773
208 nmdc:mga00v17_16508_c1 3300050491 Bacteria 4160
209 nmdc:mga00v17_32566_c1 3300050491 Bacteria 3082
210 nmdc:mga00v17_5313_c1 3300050491 Bacteria 6784
211 nmdc:mga00v17_643_c1 3300050491 Bacteria 14602
212 nmdc:mga00v17_83368_c1 3300050491 Bacteria 1999
213 nmdc:mga0yw44_104478_c1 3300050492 Bacteria 1808
214 nmdc:mga0yw44_10765_c1 3300050492 Bacteria 4687
215 nmdc:mga0yw44_113434_c1 3300050492 Bacteria 1739
216 nmdc:mga0yw44_2780_c1 3300050492 Bacteria 7579
217 nmdc:mga0yw44_4678_c1 3300050492 Bacteria 6327
218 nmdc:mga0yw44_58052_c1 3300050492 Bacteria 2363
219 nmdc:mga06z11_127095_c1 3300050494 Bacteria 1427
220 nmdc:mga06z11_1366_c1 3300050494 Bacteria 9033
221 nmdc:mga04h51_965_c1 3300050495 Bacteria 6639
222 nmdc:mga07m45_120905_c1 3300050496 Bacteria 1512
223 nmdc:mga07m45_13900_c1 3300050496 Bacteria 4279
224 Ga0500644_0000201 3300053088 Bacteria 36319
225 Ga0500556_0000514 3300053104 Bacteria 26445
226 Ga0501084_0040263 3300054114 Bacteria 3908
227 Ga0501084_0215383 3300054114 Bacteria 1620
228 Ga0501082_0014113 3300060353 Bacteria 6874
229 Ga0501082_0073382 3300060353 Bacteria 2948
230 Ga0501082_0143393 3300060353 Bacteria 2073
231 Ga0530510_0225003 3300061734 Bacteria 1395
232 2643826662 2643221561 Bacteria 4984412
233 2643890529 2643221576 Bacteria 5214352
234 2643959585 2643221590 Bacteria 5214697
235 2644032963 2643221604 Bacteria 5014917
236 2644100545 2643221617 Bacteria 5139111
237 2644116953 2643221620 Bacteria 5134593
238 2644228336 2643221641 Bacteria 4490190
239 2644454843 2643221681 Bacteria 3707866
240 2644534019 2643221696 Bacteria 5431823
241 2645722040 2643221961 Bacteria 3919167
242 2645724891 2643221962 Bacteria 3874254
243 2738869431 2738541305 Bacteria 4910150
244 2774396073 2773857762 Bacteria 5971770
245 2809197713 2808606439 Bacteria 5952208
246 2812347799 2811994878 Bacteria 5992952
247 2855388795 2855386786 Bacteria 4752232
248 2857486210 2857481737 Bacteria 4761446
249 2891968792 2891968417 Bacteria 5821697
250 LJQas_1001054
251 JGI24740J21852_10023049
252 Ga0070658_10042191
253 Ga0070683_100009784
254 Ga0070680_100180290
255 Ga0070682_100179970
256 Ga0070660_100037327
257 Ga0070660_100057799
258 Ga0070660_100071290
259 Ga0070692_10055261
260 Ga0070659_100021133
261 Ga0070659_100042571
262 Ga0070659_100051259
263 Ga0070667_100049817
264 Ga0070663_100017563
265 Ga0070663_100120756
266 Ga0070679_100082168
267 Ga0070684_100002500
268 Ga0070684_100047543
269 Ga0070665_100001394
270 Ga0068855_100095595
271 Ga0070664_100066938
272 Ga0068856_100121013
273 Ga0068852_100025732
274 Ga0068861_100268559
275 Ga0068860_100000955
276 Ga0081539_10041135
277 Ga0075365_10001978
278 Ga0075365_10014582
279 Ga0075365_10020036
280 Ga0075365_10040654
281 Ga0075365_10064364
282 Ga0075365_10074789
283 Ga0075365_10096771
284 Ga0075368_10003200
285 Ga0075363_100015539
286 Ga0075363_100022579
287 Ga0075363_100054837
288 Ga0075363_100073757
289 Ga0075363_100136676
290 Ga0075364_10014808
291 Ga0075364_10130426
292 Ga0075367_10016815
293 Ga0068865_100042308
294 Ga0105240_10020258
295 Ga0105245_10213086
296 Ga0105243_10132068
297 Ga0105248_10156658
298 Ga0105239_10100260
299 Ga0105246_10005912
300 Ga0157370_10118416
301 Ga0157369_10032045
302 Ga0157369_10046130
303 Ga0163162_10005981
304 Ga0157372_10006032
305 Ga0157372_10290562
306 Ga0157372_10434740
307 Ga0157375_10064334
308 Ga0163163_10372735
309 Ga0157380_10105327
310 Ga0157377_10116229
311 Ga0157379_10024456
312 Ga0163161_10039382
313 Ga0206353_10583376
314 Ga0207688_10009541
315 Ga0207688_10061882
316 Ga0207647_10006965
317 Ga0207647_10011224
318 Ga0207705_10137870
319 Ga0207695_10039635
320 Ga0207671_10204761
321 Ga0207662_10094090
322 Ga0207657_10025219
323 Ga0207657_10309995
324 Ga0207652_10053373
325 Ga0207687_10013471
326 Ga0207687_10125699
327 Ga0207690_10068679
328 Ga0207704_10078893
329 Ga0207661_10054768
330 Ga0207661_10113767
331 Ga0207679_10003223
332 Ga0207667_10108664
333 Ga0207658_10027031
334 Ga0207678_10036669
335 Ga0207678_10115360
336 Ga0207708_10023252
337 Ga0207675_100050800
338 Ga0207675_100151759
339 Ga0207683_10039014
340 Ga0209813_10000915
341 Ga0268266_10150273
342 Ga0268264_10000249
343 Ga0268264_10066817
344 Ga0307410_10056329
345 Ga0307409_100054882
346 Ga0307409_100085582
347 Ga0307409_100095754
348 Ga0395899_0178522
349 Ga0395900_0015129
350 Ga0395900_0207547
351 Ga0395898_0243577
352 Ga0395898_0295804
353 Ga0395905_0086107
354 Ga0395901_0012500
355 Ga0395901_0386901
356 Ga0451853_2010066
357 Ga0451853_4034884
358 Ga0466972_0007628
359 Ga0466966_0061298
360 Ga0466961_0060791
361 Ga0466963_0011700
362 Ga0466963_0047544
363 Ga0466963_0063929
364 Ga0466964_0007558
365 Ga0466964_0088478
366 Ga0466970_0023529
367 Ga0466970_0110173
368 Ga0466957_0026927
369 Ga0466960_0000259
370 Ga0466960_0003102
371 Ga0466960_0023032
372 Ga0466960_0143030
373 Ga0466967_0000424
374 Ga0466967_0031925
375 Ga0466967_0144005
376 Ga0495581_0120463
377 Ga0496100_0162021
378 Ga0496101_0065907
379 Ga0496102_0035410
380 Ga0496103_0027302
381 Ga0496103_0054424
382 Ga0496104_0025011
383 Ga0496104_0074835
384 Ga0496104_0076075
385 Ga0496105_0025694
386 Ga0496105_0067287
387 Ga0496106_0006036
388 Ga0496108_0234273
389 Ga0496109_0056721
390 Ga0496109_0073442
391 Ga0496110_0167217
392 Ga0496110_0186287
393 Ga0496111_0001345
394 Ga0496112_0058084
395 Ga0496114_0003939
396 Ga0496114_0006400
397 Ga0496114_0015426
398 Ga0496115_0022498
399 Ga0496115_0022983
400 Ga0496124_0088927
401 Ga0501031_0025121
402 Ga0501031_0026193
403 Ga0501031_0088126
404 Ga0501032_0031253
405 Ga0501033_0099700
406 Ga0501034_0083639
407 Ga0501036_0036291
408 Ga0501036_0037939
409 Ga0501037_0135380
410 Ga0501038_0139664
411 Ga0501039_0019658
412 Ga0501039_0032704
413 Ga0501039_0186550
414 Ga0501040_0049736
415 Ga0501041_0006053
416 Ga0501042_0006998
417 Ga0501042_0120703
418 Ga0501042_0122621
419 Ga0501046_0008650
420 Ga0501046_0209409
421 Ga0501047_0086461
422 Ga0501067_0000687
423 Ga0501067_0045901
424 Ga0501068_0008042
425 Ga0501068_0042214
426 Ga0501068_0209729
427 Ga0501069_0072291
428 Ga0501069_0120479
429 Ga0501070_0004128
430 Ga0501070_0017588
431 Ga0501070_0070203
432 Ga0501070_0208362
433 Ga0501071_0018741
434 Ga0501071_0022216
435 Ga0501071_0039966
436 Ga0501072_0050360
437 Ga0501072_0098060
438 Ga0501073_0002776
439 Ga0501073_0046478
440 Ga0501074_0002789
441 Ga0501074_0024583
442 Ga0501074_0094407
443 Ga0501075_0010500
444 Ga0501075_0072879
445 Ga0501076_0007375
446 Ga0501079_0016668
447 Ga0501080_0053528
448 Ga0501080_0060348
449 Ga0501080_0063164
450 Ga0501081_0054112
451 Ga0501035_0028795
452 Ga0501035_0127656
453 Ga0501044_0160217
454 Ga0501045_0172803
455 nmdc:mga03683_19725_c1
456 nmdc:mga00v17_106700_c1
457 nmdc:mga00v17_16508_c1
458 nmdc:mga00v17_32566_c1
459 nmdc:mga00v17_5313_c1
460 nmdc:mga00v17_643_c1
461 nmdc:mga00v17_83368_c1
462 nmdc:mga0yw44_104478_c1
463 nmdc:mga0yw44_10765_c1
464 nmdc:mga0yw44_113434_c1
465 nmdc:mga0yw44_2780_c1
466 nmdc:mga0yw44_4678_c1
467 nmdc:mga0yw44_58052_c1
468 nmdc:mga06z11_127095_c1
469 nmdc:mga06z11_1366_c1
470 nmdc:mga04h51_965_c1
471 nmdc:mga07m45_120905_c1
472 nmdc:mga07m45_13900_c1
473 Ga0500644_0000201
474 Ga0500556_0000514
475 Ga0501084_0040263
476 Ga0501084_0215383
477 Ga0501082_0014113
478 Ga0501082_0073382
479 Ga0501082_0143393
480 Ga0530510_0225003
481 2643826662
482 2643890529
483 2643959585
484 2644032963
485 2644100545
486 2644116953
487 2644228336
488 2644454843
489 2644534019
490 2645722040
491 2645724891
492 2738869431
493 2774396073
494 2809197713
495 2812347799
496 2855388795
497 2857486210
498 2891968792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

32

386

0.93

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

90

211

0.91

PF00266

Aminotran_5

Aminotransferase class-V

78

213

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o0r-assembly1.cif.gz_B the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis 0.9733 10 387
5veh-assembly1.cif.gz_A re-refinement of the pdb structure 1yiz of aedes aegypti kynurenine aminotransferase 0.9605 10 386
3e2y-assembly1.cif.gz_A crystal structure of mouse kynurenine aminotransferase iii in complex with glutamine 0.9566 10 386
2o0r-assembly1.cif.gz_B the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis 0.9558 10 387
5veh-assembly1.cif.gz_B re-refinement of the pdb structure 1yiz of aedes aegypti kynurenine aminotransferase 0.9549 10 386
ID Description Score Start End Superfamily
af_I1KA75_339_435_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9783 293 387 3.90.1150.10
af_A0A1D6I5Q5_417_505_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9758 299 385 3.90.1150.10
af_A0A1D6I5Q5_168_402_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9757 50 282 3.40.640.10
2o0rA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9715 47 285 3.40.640.10
af_P9WPZ5_1_390_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.97 10 387 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A354XP92-F1-model_v4 deleted 0.9804 20 207
AF-A0A6J7GZC0-F1-model_v4 Unannotated protein 0.9784 73 387 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A0K9P6L8-F1-model_v4 Aminotransferase 0.9778 9 389 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A2V9LUN2-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9775 9 386 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A538AAI3-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9748 15 387 GO:0003677
GO:0005737
GO:0008409
GO:0009058
GO:0016212
GO:0030170
GO:0140640

Map