F360304

General Info

Members Datasets Scaffolds Average Seq Length
248 174 247 220

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_020671|Ga0500645_020671_1244_1942
Length 232
Sequence MIENSALKLNTMKNATGSLRKLFLLAALTGSLTAAMAQEQQTTTETSLQPKIGIRGGINLSNLYVDDVKDENMKVGVNVGVFAKFPITKGFSIQPEVNYSSKGAKLTYDNIFGDGEYRFNLNYVEVPLLAVVNLGKNFNIHAGPYAAFLTSANIKRLDNESGEVDDIADLDADNFKRFDFGLVGGLGFDIQNFTIGARYNYGLNEIGDGGIAGEATKNSKNSAFTFYIGIGF

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
119 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
153 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 4.03
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0
Rhizoplane 1.21
Rhizosphere 80.24
Stem 0
Stem Tuber 0
Unclassified 10.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006777J48905_1028183 3300003308 Bacteria 770
2 rootH1_10002948 3300003316 Bacteria 59617
3 rootH1_10013446 3300003316 Bacteria 10023
4 rootH1_10020107 3300003316 Bacteria 7907
5 rootH1_10055612 3300003316 Bacteria 1453
6 rootH2_10038793 3300003320 Bacteria 23005
7 rootH2_10154567 3300003320 Bacteria 8794
8 rootL2_10065535 3300003322 Bacteria 16016
9 rootL2_10084436 3300003322 Unclassified 2739
10 rootL2_10216341 3300003322 Bacteria 6272
11 rootH1_10003164 3300003323 Bacteria 93415
12 rootH1_10068367 3300003323 Bacteria 5002
13 rootH1_10124439 3300003323 Bacteria 6275
14 rootH1_10157093 3300003323 Bacteria 1482
15 rootH1_10201866 3300003323 Unclassified 4225
16 Ga0032354_1020528 3300003693 Unclassified 1872
17 Ga0058862_12651262 3300004803 Bacteria 1382
18 Ga0070676_10005198 3300005328 Bacteria 6915
19 Ga0070666_10000265 3300005335 Bacteria 34771
20 Ga0070682_100010815 3300005337 Bacteria 5192
21 Ga0068868_100019538 3300005338 Bacteria 5077
22 Ga0070691_10011573 3300005341 Bacteria 4031
23 Ga0070668_100000036 3300005347 Bacteria 81256
24 Ga0070675_100255562 3300005354 Bacteria 1534
25 Ga0070675_100401854 3300005354 Unclassified 1222
26 Ga0070673_100000803 3300005364 Bacteria 17538
27 Ga0070667_100000151 3300005367 Bacteria 86629
28 Ga0070667_100913921 3300005367 Unclassified 817
29 Ga0070663_100397152 3300005455 Bacteria 1126
30 Ga0070678_100889955 3300005456 Bacteria 813
31 Ga0070662_100002810 3300005457 Bacteria 10791
32 Ga0070681_10004505 3300005458 Bacteria 13289
33 Ga0068867_100002246 3300005459 Bacteria 13578
34 Ga0070679_100058952 3300005530 Bacteria 3826
35 Ga0068853_100021915 3300005539 Bacteria 5329
36 Ga0068853_100099462 3300005539 Unclassified 2569
37 Ga0070672_100000481 3300005543 Bacteria 23169
38 Ga0070693_100151067 3300005547 Unclassified 1471
39 Ga0070665_100001651 3300005548 Bacteria 25701
40 Ga0068855_100121650 3300005563 Bacteria 2987
41 Ga0068855_100181771 3300005563 Bacteria 2377
42 Ga0068854_100069020 3300005578 Unclassified 2579
43 Ga0068854_100371994 3300005578 Bacteria 1175
44 Ga0068856_100010399 3300005614 Bacteria 9037
45 Ga0068856_100050870 3300005614 Unclassified 4086
46 Ga0068856_100186565 3300005614 Bacteria 2088
47 Ga0068852_100036766 3300005616 Bacteria 4101
48 Ga0068864_100019628 3300005618 Bacteria 5654
49 Ga0068861_100359301 3300005719 Bacteria 1280
50 Ga0068851_10003720 3300005834 Bacteria 6811
51 Ga0068863_100004069 3300005841 Bacteria 14440
52 Ga0068858_100000760 3300005842 Bacteria 33815
53 Ga0068860_100002392 3300005843 Bacteria 19698
54 Ga0068862_100857625 3300005844 Bacteria 890
55 Ga0075366_10026081 3300006195 Unclassified 3421
56 Ga0097621_100003739 3300006237 Bacteria 10543
57 Ga0097621_100009281 3300006237 Bacteria 7138
58 Ga0068871_100001303 3300006358 Bacteria 16691
59 Ga0068871_100035863 3300006358 Unclassified 3944
60 Ga0068871_100313840 3300006358 Bacteria 1379
61 Ga0105240_10007119 3300009093 Bacteria 16295
62 Ga0105240_10060507 3300009093 Bacteria 4722
63 Ga0105240_10158485 3300009093 Unclassified 2690
64 Ga0105245_10039187 3300009098 Bacteria 4217
65 Ga0114129_10004171 3300009147 Bacteria 20411
66 Ga0105243_10100376 3300009148 Bacteria 2401
67 Ga0105241_10007589 3300009174 Bacteria 7976
68 Ga0105241_10017541 3300009174 Bacteria 5263
69 Ga0105241_10053873 3300009174 Bacteria 3078
70 Ga0105241_10091697 3300009174 Bacteria 2398
71 Ga0105241_10431494 3300009174 Bacteria 1162
72 Ga0105242_10070894 3300009176 Bacteria 2890
73 Ga0105237_10180700 3300009545 Bacteria 2110
74 Ga0105237_10189007 3300009545 Bacteria 2060
75 Ga0105237_10552343 3300009545 Bacteria 1158
76 Ga0105238_10008640 3300009551 Bacteria 10192
77 Ga0105238_10008647 3300009551 Bacteria 10188
78 Ga0105249_10000514 3300009553 Bacteria 35783
79 Ga0105239_10000746 3300010375 Bacteria 46202
80 Ga0105239_10015520 3300010375 Bacteria 8435
81 Ga0105239_10329408 3300010375 Bacteria 1722
82 Ga0105239_11179536 3300010375 Unclassified 882
83 Ga0105239_11458434 3300010375 Unclassified 790
84 Ga0105246_10392003 3300011119 Bacteria 1151
85 Ga0157371_10048151 3300013102 Unclassified 3030
86 Ga0157371_10187349 3300013102 Bacteria 1481
87 Ga0157370_10017363 3300013104 Bacteria 7263
88 Ga0157370_10035168 3300013104 Bacteria 4872
89 Ga0157369_10010939 3300013105 Bacteria 10330
90 Ga0157369_10862975 3300013105 Bacteria 929
91 Ga0157374_10000153 3300013296 Bacteria 63211
92 Ga0157374_10019653 3300013296 Bacteria 5981
93 Ga0157374_10276287 3300013296 Bacteria 1658
94 Ga0157374_11313136 3300013296 Bacteria 745
95 Ga0157378_10002091 3300013297 Bacteria 17834
96 Ga0163162_10000040 3300013306 Bacteria 133855
97 Ga0163162_10024785 3300013306 Bacteria 5926
98 Ga0163162_10100918 3300013306 Unclassified 2977
99 Ga0163162_10120381 3300013306 Bacteria 2729
100 Ga0157372_10001557 3300013307 Bacteria 24967
101 Ga0157372_10174643 3300013307 Bacteria 2487
102 Ga0157372_11088870 3300013307 Bacteria 924
103 Ga0157375_10000407 3300013308 Bacteria 39103
104 Ga0157380_10793678 3300014326 Unclassified 963
105 Ga0157379_10000173 3300014968 Bacteria 48672
106 Ga0157379_10125354 3300014968 Bacteria 2311
107 Ga0157376_10000278 3300014969 Bacteria 34737
108 Ga0157376_10069139 3300014969 Unclassified 2993
109 Ga0157376_10070092 3300014969 Unclassified 2974
110 Ga0157376_10133153 3300014969 Bacteria 2221
111 Ga0157376_10232637 3300014969 Bacteria 1713
112 Ga0163161_10026301 3300017792 Bacteria 4122
113 Ga0163161_10323923 3300017792 Unclassified 1219
114 Ga0197907_11090403 3300020069 Bacteria 699
115 Ga0206355_1099252 3300020076 Bacteria 708
116 Ga0206351_10734328 3300020077 Bacteria 709
117 Ga0206352_10383259 3300020078 Unclassified 804
118 Ga0206353_10547220 3300020082 Bacteria 706
119 Ga0209646_1004246 3300025246 Bacteria 2639
120 Ga0207656_10004384 3300025321 Unclassified 4924
121 Ga0207680_10000508 3300025903 Bacteria 18576
122 Ga0207647_10031998 3300025904 Bacteria 3383
123 Ga0207645_10009004 3300025907 Bacteria 6929
124 Ga0207705_10220605 3300025909 Bacteria 1440
125 Ga0207654_10007644 3300025911 Bacteria 5451
126 Ga0207654_10351281 3300025911 Bacteria 1015
127 Ga0207707_10008228 3300025912 Bacteria 9054
128 Ga0207707_10079400 3300025912 Unclassified 2865
129 Ga0207695_10026860 3300025913 Bacteria 6419
130 Ga0207695_10049180 3300025913 Bacteria 4446
131 Ga0207671_10006526 3300025914 Bacteria 10369
132 Ga0207671_10101601 3300025914 Bacteria 2179
133 Ga0207660_10039530 3300025917 Bacteria 3298
134 Ga0207652_10027439 3300025921 Bacteria 4745
135 Ga0207694_10006125 3300025924 Bacteria 9192
136 Ga0207694_10173953 3300025924 Unclassified 1744
137 Ga0207659_10229476 3300025926 Bacteria 1497
138 Ga0207687_10704319 3300025927 Bacteria 857
139 Ga0207690_10364926 3300025932 Bacteria 1145
140 Ga0207706_10006547 3300025933 Bacteria 10791
141 Ga0207709_10081997 3300025935 Bacteria 2081
142 Ga0207704_10006448 3300025938 Bacteria 5477
143 Ga0207691_10000067 3300025940 Bacteria 84512
144 Ga0207691_10133226 3300025940 Bacteria 2194
145 Ga0207667_10000519 3300025949 Bacteria 50770
146 Ga0207667_10097466 3300025949 Bacteria 3035
147 Ga0207667_10152648 3300025949 Bacteria 2377
148 Ga0207651_10000309 3300025960 Bacteria 20977
149 Ga0207712_10002122 3300025961 Bacteria 12960
150 Ga0207668_10000274 3300025972 Bacteria 34337
151 Ga0207640_10014596 3300025981 Unclassified 4526
152 Ga0207658_10000225 3300025986 Bacteria 59285
153 Ga0207677_10011296 3300026023 Bacteria 5085
154 Ga0207703_10002889 3300026035 Bacteria 14629
155 Ga0207639_10006238 3300026041 Bacteria 8100
156 Ga0207639_10357852 3300026041 Bacteria 1305
157 Ga0207678_10385622 3300026067 Bacteria 1212
158 Ga0207702_10009820 3300026078 Bacteria 8024
159 Ga0207702_10033918 3300026078 Bacteria 4265
160 Ga0207702_10081036 3300026078 Bacteria 2818
161 Ga0207641_10034682 3300026088 Bacteria 4199
162 Ga0207648_10002613 3300026089 Bacteria 19296
163 Ga0207676_10004694 3300026095 Bacteria 9680
164 Ga0207698_10647822 3300026142 Bacteria 1046
165 Ga0268266_10028165 3300028379 Bacteria 4776
166 Ga0268265_10930061 3300028380 Bacteria 855
167 Ga0268264_10015647 3300028381 Bacteria 6211
168 Ga0307513_10029028 3300031456 Bacteria 6314
169 Ga0307513_10180370 3300031456 Unclassified 1976
170 Ga0307513_10261043 3300031456 Bacteria 1522
171 Ga0307509_10035663 3300031507 Bacteria 5457
172 Ga0307509_10112572 3300031507 Bacteria 2721
173 Ga0307508_10001107 3300031616 Bacteria 31214
174 Ga0307516_10179512 3300031730 Bacteria 1851
175 Ga0373931_0337152 3300035691 Bacteria 941
176 Ga0373935_0159638 3300035692 Bacteria 1536
177 Ga0373933_0227705 3300035724 Unclassified 1197
178 Ga0373925_0104750 3300037068 Bacteria 2179
179 Ga0439439_0000381 3300041406 Bacteria 7295
180 Ga0451791_1935389 3300041451 Bacteria 1305
181 Ga0451798_0772835 3300041458 Unclassified 1302
182 Ga0451841_1381834 3300041498 Unclassified 801
183 Ga0451853_0967589 3300041512 Unclassified 1185
184 Ga0439449_0001255 3300042007 Bacteria 9955
185 Ga0439457_004018 3300042014 Bacteria 3903
186 Ga0439462_0000035 3300042015 Bacteria 19556
187 Ga0466969_0000201 3300044656 Bacteria 32555
188 Ga0466972_0000075 3300044658 Bacteria 94290
189 Ga0466972_0012370 3300044658 Bacteria 4289
190 Ga0466966_0000022 3300044684 Bacteria 112729
191 Ga0466961_0288641 3300044693 Bacteria 1003
192 Ga0466957_0002266 3300044842 Bacteria 10306
193 Ga0466959_0000055 3300045049 Bacteria 78801
194 Ga0495629_0103794 3300046459 Bacteria 1983
195 Ga0495638_0049025 3300046460 Unclassified 2641
196 Ga0495638_0187225 3300046460 Bacteria 1177
197 Ga0495580_0102164 3300046472 Bacteria 1993
198 Ga0495630_0043370 3300046517 Bacteria 3360
199 Ga0495586_0164850 3300046535 Bacteria 1251
200 Ga0495668_0004385 3300046616 Bacteria 10056
201 Ga0495647_0070980 3300046681 Bacteria 1394
202 Ga0495658_0019261 3300046683 Bacteria 3560
203 Ga0495674_0048666 3300047319 Bacteria 3751
204 Ga0495676_0479593 3300047321 Bacteria 818
205 Ga0495686_0000058 3300047472 Bacteria 240089
206 Ga0496109_0023100 3300048912 Bacteria 5517
207 Ga0496126_0589768 3300048929 Unclassified 877
208 Ga0501308_034345 3300049128 Unclassified 693
209 Ga0501307_038956 3300049162 Unclassified 685
210 Ga0501290_001301 3300049513 Bacteria 3462
211 Ga0501034_0748778 3300049571 Bacteria 873
212 Ga0501047_0006731 3300049581 Bacteria 10804
213 Ga0501047_0009810 3300049581 Bacteria 9047
214 Ga0501047_0219101 3300049581 Bacteria 1760
215 Ga0501069_0082740 3300049585 Bacteria 1809
216 Ga0501070_0166656 3300049586 Bacteria 1815
217 Ga0501073_0049707 3300049589 Bacteria 2939
218 Ga0501074_0252263 3300049590 Bacteria 1255
219 Ga0501199_004363 3300049650 Bacteria 1391
220 Ga0501242_002710 3300049674 Bacteria 1874
221 Ga0501257_000771 3300049686 Bacteria 6381
222 Ga0501259_004626 3300049688 Bacteria 2184
223 Ga0501083_0372588 3300049744 Bacteria 928
224 Ga0501044_0016620 3300049823 Bacteria 7899
225 Ga0501044_0215062 3300049823 Bacteria 1875
226 nmdc:mga0k408_21669_c1 3300050493 Unclassified 3611
227 nmdc:mga0k408_416903_c1 3300050493 Bacteria 798
228 nmdc:mga05p37_2780_c1 3300050507 Bacteria 20350
229 Ga0495619_0196655 3300053085 Bacteria 1396
230 Ga0500578_0000572 3300053086 Bacteria 44844
231 Ga0500578_0032221 3300053086 Bacteria 3369
232 Ga0500646_0005892 3300053090 Bacteria 3109
233 Ga0500583_0000011 3300053092 Bacteria 160380
234 Ga0500583_0011187 3300053092 Bacteria 3371
235 Ga0500651_0243935 3300053093 Bacteria 1047
236 Ga0500650_0165370 3300053098 Bacteria 1019
237 Ga0500568_0117357 3300053139 Bacteria 993
238 Ga0500588_0003701 3300053146 Bacteria 3250
239 Ga0500589_002893 3300053147 Bacteria 5959
240 Ga0500604_0007574 3300053151 Unclassified 2877
241 Ga0500616_0028668 3300053153 Unclassified 3067
242 Ga0500616_0045848 3300053153 Unclassified 2327
243 Ga0500622_0001915 3300053156 Bacteria 15695
244 Ga0500622_0005501 3300053156 Bacteria 7593
245 Ga0500636_0118589 3300053177 Bacteria 1487
246 Ga0500645_020671 3300053730 Bacteria 2038
247 Ga0501084_0098795 3300054114 Unclassified 2451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10013446 rootH1_100134464 190
2 3300010375 Ga0105239_10015520 Ga0105239_100155203 190
3 3300025913 Ga0207695_10026860 Ga0207695_100268606 190
4 3300005367 Ga0070667_100913921 Ga0070667_1009139211 192
5 3300005539 Ga0068853_100099462 Ga0068853_1000994622 192
6 3300009174 Ga0105241_10091697 Ga0105241_100916971 192
7 3300009551 Ga0105238_10008640 Ga0105238_100086402 192
8 3300013307 Ga0157372_11088870 Ga0157372_110888702 192
9 3300026041 Ga0207639_10006238 Ga0207639_100062384 192
10 3300035692 Ga0373935_0159638 Ga0373935_0159638_437_1108 197
11 3300006237 Ga0097621_100009281 Ga0097621_1000092816 199
12 3300006358 Ga0068871_100035863 Ga0068871_1000358633 199
13 3300013306 Ga0163162_10024785 Ga0163162_100247856 199
14 3300014969 Ga0157376_10069139 Ga0157376_100691394 199
15 3300009093 Ga0105240_10007119 Ga0105240_100071196 200
16 3300009545 Ga0105237_10180700 Ga0105237_101807002 200
17 3300009545 Ga0105237_10189007 Ga0105237_101890073 200
18 3300009551 Ga0105238_10008647 Ga0105238_100086474 200
19 3300013104 Ga0157370_10035168 Ga0157370_100351683 200
20 3300013105 Ga0157369_10010939 Ga0157369_100109393 200
21 3300013307 Ga0157372_10001557 Ga0157372_1000155718 200
22 3300025911 Ga0207654_10351281 Ga0207654_103512811 200
23 3300025949 Ga0207667_10000519 Ga0207667_1000051934 200
24 3300047472 Ga0495686_0000058 Ga0495686_0000058_168862_169467 200
25 3300005578 Ga0068854_100069020 Ga0068854_1000690203 202
26 3300005614 Ga0068856_100050870 Ga0068856_1000508703 202
27 3300009174 Ga0105241_10431494 Ga0105241_104314942 202
28 3300020077 Ga0206351_10734328 Ga0206351_107343281 202
29 3300025904 Ga0207647_10031998 Ga0207647_100319982 202
30 3300025913 Ga0207695_10049180 Ga0207695_100491803 202
31 3300025914 Ga0207671_10101601 Ga0207671_101016012 202
32 3300025924 Ga0207694_10006125 Ga0207694_100061254 202
33 3300025981 Ga0207640_10014596 Ga0207640_100145962 202
34 3300026078 Ga0207702_10081036 Ga0207702_100810362 202
35 3300006358 Ga0068871_100313840 Ga0068871_1003138401 204
36 3300025924 Ga0207694_10173953 Ga0207694_101739532 204
37 3300026067 Ga0207678_10385622 Ga0207678_103856222 204
38 3300003320 rootH2_10154567 rootH2_101545672 205
39 3300048929 Ga0496126_0589768 Ga0496126_0589768_14_634 205
40 3300031456 Ga0307513_10029028 Ga0307513_100290284 209
41 3300049128 Ga0501308_034345 Ga0501308_034345_23_679 209
42 3300049162 Ga0501307_038956 Ga0501307_038956_15_653 209
43 3300049513 Ga0501290_001301 Ga0501290_001301_1367_2002 209
44 3300049650 Ga0501199_004363 Ga0501199_004363_704_1339 209
45 3300049674 Ga0501242_002710 Ga0501242_002710_282_917 209
46 3300049686 Ga0501257_000771 Ga0501257_000771_1190_1831 209
47 3300049688 Ga0501259_004626 Ga0501259_004626_626_1261 209
48 3300003323 rootH1_10003164 rootH1_1000316454 210
49 3300005614 Ga0068856_100010399 Ga0068856_1000103993 210
50 3300026078 Ga0207702_10033918 Ga0207702_100339183 210
51 3300013296 Ga0157374_10019653 Ga0157374_100196532 212
52 3300041406 Ga0439439_0000381 Ga0439439_0000381_2369_3013 212
53 3300041451 Ga0451791_1935389 Ga0451791_1935389_130_777 212
54 3300041458 Ga0451798_0772835 Ga0451798_0772835_153_800 212
55 3300041498 Ga0451841_1381834 Ga0451841_1381834_97_744 212
56 3300042007 Ga0439449_0001255 Ga0439449_0001255_8978_9622 212
57 3300042014 Ga0439457_004018 Ga0439457_004018_1369_2013 212
58 3300042015 Ga0439462_0000035 Ga0439462_0000035_1605_2249 212
59 3300044656 Ga0466969_0000201 Ga0466969_0000201_15858_16505 212
60 3300044684 Ga0466966_0000022 Ga0466966_0000022_2244_2891 212
61 3300044693 Ga0466961_0288641 Ga0466961_0288641_241_888 212
62 3300044842 Ga0466957_0002266 Ga0466957_0002266_2003_2650 212
63 3300045049 Ga0466959_0000055 Ga0466959_0000055_2267_2914 212
64 3300050493 nmdc:mga0k408_21669_c1 nmdc:mga0k408_21669_c1_1787_2434 212
65 3300053086 Ga0500578_0000572 Ga0500578_0000572_16444_17091 212
66 3300053086 Ga0500578_0032221 Ga0500578_0032221_2090_2737 212
67 3300053090 Ga0500646_0005892 Ga0500646_0005892_1294_1941 212
68 3300053093 Ga0500651_0243935 Ga0500651_0243935_18_665 212
69 3300053098 Ga0500650_0165370 Ga0500650_0165370_319_966 212
70 3300053156 Ga0500622_0005501 Ga0500622_0005501_796_1443 212
71 iso_pu_bacteria 2738541278 2738724827 212
72 3300003316 rootH1_10020107 rootH1_100201075 213
73 3300003322 rootL2_10216341 rootL2_102163413 214
74 3300004803 Ga0058862_12651262 Ga0058862_126512622 214
75 3300025927 Ga0207687_10704319 Ga0207687_107043191 214
76 3300028380 Ga0268265_10930061 Ga0268265_109300611 214
77 3300044658 Ga0466972_0012370 Ga0466972_0012370_3058_3714 214
78 3300046616 Ga0495668_0004385 Ga0495668_0004385_510_1175 214
79 3300049581 Ga0501047_0009810 Ga0501047_0009810_1678_2334 214
80 3300053151 Ga0500604_0007574 Ga0500604_0007574_1610_2275 214
81 3300053730 Ga0500645_020671 Ga0500645_020671_1244_1942 214
82 3300003320 rootH2_10038793 rootH2_1003879317 215
83 3300003322 rootL2_10084436 rootL2_100844363 215
84 3300003323 rootH1_10068367 rootH1_100683672 215
85 3300005354 Ga0070675_100401854 Ga0070675_1004018542 215
86 3300005455 Ga0070663_100397152 Ga0070663_1003971522 215
87 3300005456 Ga0070678_100889955 Ga0070678_1008899551 215
88 3300005563 Ga0068855_100181771 Ga0068855_1001817711 215
89 3300005614 Ga0068856_100186565 Ga0068856_1001865652 215
90 3300005719 Ga0068861_100359301 Ga0068861_1003593013 215
91 3300006195 Ga0075366_10026081 Ga0075366_100260812 215
92 3300009147 Ga0114129_10004171 Ga0114129_1000417112 215
93 3300009174 Ga0105241_10017541 Ga0105241_100175412 215
94 3300009545 Ga0105237_10552343 Ga0105237_105523432 215
95 3300010375 Ga0105239_10000746 Ga0105239_100007462 215
96 3300010375 Ga0105239_11179536 Ga0105239_111795362 215
97 3300010375 Ga0105239_11458434 Ga0105239_114584341 215
98 3300013306 Ga0163162_10100918 Ga0163162_101009182 215
99 3300014326 Ga0157380_10793678 Ga0157380_107936781 215
100 3300017792 Ga0163161_10323923 Ga0163161_103239231 215
101 3300020069 Ga0197907_11090403 Ga0197907_110904031 215
102 3300020076 Ga0206355_1099252 Ga0206355_10992521 215
103 3300020078 Ga0206352_10383259 Ga0206352_103832591 215
104 3300020082 Ga0206353_10547220 Ga0206353_105472201 215
105 3300025246 Ga0209646_1004246 Ga0209646_10042462 215
106 3300025940 Ga0207691_10133226 Ga0207691_101332262 215
107 3300025949 Ga0207667_10152648 Ga0207667_101526482 215
108 3300026078 Ga0207702_10009820 Ga0207702_100098204 215
109 3300026142 Ga0207698_10647822 Ga0207698_106478221 215
110 3300031456 Ga0307513_10180370 Ga0307513_101803703 215
111 3300031456 Ga0307513_10261043 Ga0307513_102610432 215
112 3300031507 Ga0307509_10035663 Ga0307509_100356633 215
113 3300031507 Ga0307509_10112572 Ga0307509_101125722 215
114 3300031616 Ga0307508_10001107 Ga0307508_1000110715 215
115 3300031730 Ga0307516_10179512 Ga0307516_101795122 215
116 3300037068 Ga0373925_0104750 Ga0373925_0104750_474_1223 215
117 3300044658 Ga0466972_0000075 Ga0466972_0000075_14821_15480 215
118 3300046460 Ga0495638_0187225 Ga0495638_0187225_209_979 215
119 3300049581 Ga0501047_0006731 Ga0501047_0006731_3666_4325 215
120 3300049823 Ga0501044_0016620 Ga0501044_0016620_5757_6416 215
121 3300050493 nmdc:mga0k408_416903_c1 nmdc:mga0k408_416903_c1_41_706 215
122 3300050507 nmdc:mga05p37_2780_c1 nmdc:mga05p37_2780_c1_14192_14854 215
123 3300053092 Ga0500583_0000011 Ga0500583_0000011_59042_59779 215
124 3300053092 Ga0500583_0011187 Ga0500583_0011187_550_1320 215
125 3300053139 Ga0500568_0117357 Ga0500568_0117357_185_955 215
126 3300053146 Ga0500588_0003701 Ga0500588_0003701_317_1012 215
127 3300053147 Ga0500589_002893 Ga0500589_002893_4745_5515 215
128 3300053153 Ga0500616_0045848 Ga0500616_0045848_257_931 215
129 3300053177 Ga0500636_0118589 Ga0500636_0118589_207_869 215
130 3300003308 Ga0006777J48905_1028183 Ga0006777J48905_10281831 216
131 3300003316 rootH1_10002948 rootH1_100029484 216
132 3300003316 rootH1_10055612 rootH1_100556121 216
133 3300003322 rootL2_10065535 rootL2_100655356 216
134 3300003323 rootH1_10124439 rootH1_101244395 216
135 3300003323 rootH1_10157093 rootH1_101570934 216
136 3300003323 rootH1_10201866 rootH1_102018666 216
137 3300003693 Ga0032354_1020528 Ga0032354_10205283 216
138 3300005328 Ga0070676_10005198 Ga0070676_100051986 216
139 3300005335 Ga0070666_10000265 Ga0070666_1000026525 216
140 3300005337 Ga0070682_100010815 Ga0070682_1000108155 216
141 3300005338 Ga0068868_100019538 Ga0068868_1000195381 216
142 3300005341 Ga0070691_10011573 Ga0070691_100115731 216
143 3300005347 Ga0070668_100000036 Ga0070668_10000003653 216
144 3300005354 Ga0070675_100255562 Ga0070675_1002555621 216
145 3300005364 Ga0070673_100000803 Ga0070673_10000080316 216
146 3300005367 Ga0070667_100000151 Ga0070667_10000015138 216
147 3300005457 Ga0070662_100002810 Ga0070662_1000028108 216
148 3300005458 Ga0070681_10004505 Ga0070681_100045052 216
149 3300005459 Ga0068867_100002246 Ga0068867_1000022464 216
150 3300005530 Ga0070679_100058952 Ga0070679_1000589523 216
151 3300005539 Ga0068853_100021915 Ga0068853_1000219153 216
152 3300005543 Ga0070672_100000481 Ga0070672_1000004817 216
153 3300005547 Ga0070693_100151067 Ga0070693_1001510671 216
154 3300005548 Ga0070665_100001651 Ga0070665_10000165117 216
155 3300005563 Ga0068855_100121650 Ga0068855_1001216503 216
156 3300005578 Ga0068854_100371994 Ga0068854_1003719942 216
157 3300005616 Ga0068852_100036766 Ga0068852_1000367662 216
158 3300005618 Ga0068864_100019628 Ga0068864_1000196284 216
159 3300005834 Ga0068851_10003720 Ga0068851_100037202 216
160 3300005841 Ga0068863_100004069 Ga0068863_1000040693 216
161 3300005842 Ga0068858_100000760 Ga0068858_10000076022 216
162 3300005843 Ga0068860_100002392 Ga0068860_1000023922 216
163 3300005844 Ga0068862_100857625 Ga0068862_1008576251 216
164 3300006237 Ga0097621_100003739 Ga0097621_10000373910 216
165 3300006358 Ga0068871_100001303 Ga0068871_10000130317 216
166 3300009093 Ga0105240_10060507 Ga0105240_100605073 216
167 3300009093 Ga0105240_10158485 Ga0105240_101584854 216
168 3300009098 Ga0105245_10039187 Ga0105245_100391872 216
169 3300009148 Ga0105243_10100376 Ga0105243_101003762 216
170 3300009174 Ga0105241_10007589 Ga0105241_100075896 216
171 3300009174 Ga0105241_10053873 Ga0105241_100538732 216
172 3300009176 Ga0105242_10070894 Ga0105242_100708943 216
173 3300009553 Ga0105249_10000514 Ga0105249_1000051431 216
174 3300010375 Ga0105239_10329408 Ga0105239_103294082 216
175 3300011119 Ga0105246_10392003 Ga0105246_103920031 216
176 3300013102 Ga0157371_10048151 Ga0157371_100481513 216
177 3300013102 Ga0157371_10187349 Ga0157371_101873492 216
178 3300013104 Ga0157370_10017363 Ga0157370_100173636 216
179 3300013105 Ga0157369_10862975 Ga0157369_108629752 216
180 3300013296 Ga0157374_10000153 Ga0157374_1000015337 216
181 3300013296 Ga0157374_10276287 Ga0157374_102762872 216
182 3300013296 Ga0157374_11313136 Ga0157374_113131361 216
183 3300013297 Ga0157378_10002091 Ga0157378_100020913 216
184 3300013306 Ga0163162_10000040 Ga0163162_10000040109 216
185 3300013306 Ga0163162_10120381 Ga0163162_101203812 216
186 3300013307 Ga0157372_10174643 Ga0157372_101746432 216
187 3300013308 Ga0157375_10000407 Ga0157375_100004073 216
188 3300014968 Ga0157379_10000173 Ga0157379_1000017348 216
189 3300014968 Ga0157379_10125354 Ga0157379_101253543 216
190 3300014969 Ga0157376_10000278 Ga0157376_1000027816 216
191 3300014969 Ga0157376_10070092 Ga0157376_100700922 216
192 3300014969 Ga0157376_10133153 Ga0157376_101331532 216
193 3300014969 Ga0157376_10232637 Ga0157376_102326372 216
194 3300017792 Ga0163161_10026301 Ga0163161_100263014 216
195 3300025321 Ga0207656_10004384 Ga0207656_100043842 216
196 3300025903 Ga0207680_10000508 Ga0207680_100005084 216
197 3300025907 Ga0207645_10009004 Ga0207645_100090043 216
198 3300025909 Ga0207705_10220605 Ga0207705_102206052 216
199 3300025911 Ga0207654_10007644 Ga0207654_100076443 216
200 3300025912 Ga0207707_10008228 Ga0207707_100082284 216
201 3300025912 Ga0207707_10079400 Ga0207707_100794003 216
202 3300025914 Ga0207671_10006526 Ga0207671_100065263 216
203 3300025917 Ga0207660_10039530 Ga0207660_100395303 216
204 3300025921 Ga0207652_10027439 Ga0207652_100274394 216
205 3300025926 Ga0207659_10229476 Ga0207659_102294761 216
206 3300025932 Ga0207690_10364926 Ga0207690_103649261 216
207 3300025933 Ga0207706_10006547 Ga0207706_100065478 216
208 3300025935 Ga0207709_10081997 Ga0207709_100819972 216
209 3300025938 Ga0207704_10006448 Ga0207704_100064487 216
210 3300025940 Ga0207691_10000067 Ga0207691_1000006762 216
211 3300025949 Ga0207667_10097466 Ga0207667_100974663 216
212 3300025960 Ga0207651_10000309 Ga0207651_1000030917 216
213 3300025961 Ga0207712_10002122 Ga0207712_100021225 216
214 3300025972 Ga0207668_10000274 Ga0207668_1000027423 216
215 3300025986 Ga0207658_10000225 Ga0207658_1000022522 216
216 3300026023 Ga0207677_10011296 Ga0207677_100112962 216
217 3300026035 Ga0207703_10002889 Ga0207703_1000288915 216
218 3300026041 Ga0207639_10357852 Ga0207639_103578522 216
219 3300026088 Ga0207641_10034682 Ga0207641_100346823 216
220 3300026089 Ga0207648_10002613 Ga0207648_100026134 216
221 3300026095 Ga0207676_10004694 Ga0207676_100046949 216
222 3300028379 Ga0268266_10028165 Ga0268266_100281653 216
223 3300028381 Ga0268264_10015647 Ga0268264_100156475 216
224 3300035691 Ga0373931_0337152 Ga0373931_0337152_224_895 216
225 3300035724 Ga0373933_0227705 Ga0373933_0227705_351_1025 216
226 3300041512 Ga0451853_0967589 Ga0451853_0967589_346_996 216
227 3300046459 Ga0495629_0103794 Ga0495629_0103794_253_966 216
228 3300046460 Ga0495638_0049025 Ga0495638_0049025_759_1433 216
229 3300046472 Ga0495580_0102164 Ga0495580_0102164_437_1150 216
230 3300046517 Ga0495630_0043370 Ga0495630_0043370_1371_2084 216
231 3300046535 Ga0495586_0164850 Ga0495586_0164850_223_936 216
232 3300046681 Ga0495647_0070980 Ga0495647_0070980_512_1225 216
233 3300046683 Ga0495658_0019261 Ga0495658_0019261_1587_2300 216
234 3300047319 Ga0495674_0048666 Ga0495674_0048666_1153_1866 216
235 3300047321 Ga0495676_0479593 Ga0495676_0479593_22_735 216
236 3300048912 Ga0496109_0023100 Ga0496109_0023100_3630_4307 216
237 3300049571 Ga0501034_0748778 Ga0501034_0748778_174_848 216
238 3300049581 Ga0501047_0219101 Ga0501047_0219101_633_1307 216
239 3300049585 Ga0501069_0082740 Ga0501069_0082740_713_1387 216
240 3300049586 Ga0501070_0166656 Ga0501070_0166656_808_1482 216
241 3300049589 Ga0501073_0049707 Ga0501073_0049707_2221_2895 216
242 3300049590 Ga0501074_0252263 Ga0501074_0252263_511_1185 216
243 3300049744 Ga0501083_0372588 Ga0501083_0372588_48_722 216
244 3300049823 Ga0501044_0215062 Ga0501044_0215062_70_744 216
245 3300053085 Ga0495619_0196655 Ga0495619_0196655_646_1359 216
246 3300053153 Ga0500616_0028668 Ga0500616_0028668_2113_2763 216
247 3300053156 Ga0500622_0001915 Ga0500622_0001915_1300_1950 216
248 3300054114 Ga0501084_0098795 Ga0501084_0098795_69_743 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13568

OMP_b-brl_2

Outer membrane protein beta-barrel domain

36

208

0.9

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

23

232

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qj8-assembly1.cif.gz_A crystal structure of the outer membrane protein ompx from escherichia coli 0.6706 32 216
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.67 27 216
1qj8-assembly1.cif.gz_A crystal structure of the outer membrane protein ompx from escherichia coli 0.6668 32 216
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.6606 27 216
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.6572 32 216
ID Description Score Start End Superfamily
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6572 32 216 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6498 32 216 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6484 27 216 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6403 27 216 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.6009 34 216 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A3A1NQ46-F1-model_v4 PorT family protein 0.9006 32 216
AF-R5PDH0-F1-model_v4 deleted 0.885 33 216
AF-A0A1F3M8S6-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8669 32 216
AF-A0A0C1LAI1-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8601 25 216
AF-A0A0E9MXX1-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8586 31 216

Feature Viewer

pLDDT pTM Quality
81.02 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map