F360133

General Info

Members Datasets Scaffolds Average Seq Length
248 103 243 86

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_022769|Ga0495627_022769_81_359
Length 92
Sequence MVLGDPMKAKKSGFIPFANEADVLRVGNLEIQNRLDRITLAGDVDLTADKQGLELARQLHGLLGEVVAKLEGQELPDALPAPDVKTVDNPFS

Samples

Sample ID Description Type Environment
1 2857553236 Duganella sp. R-74557 Isolate Unclassified
2 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
3 2919476304 Duganella sp. 3397 Isolate Unclassified
4 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
5 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
8 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
9 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
10 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
11 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
12 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
13 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
15 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
16 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
17 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
18 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
19 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
20 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
21 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
22 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
23 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
24 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
25 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
26 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
27 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
28 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
29 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
30 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
31 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
32 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
33 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
34 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
35 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
36 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
37 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
38 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
39 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
40 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
41 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
42 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
43 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
44 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
45 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
46 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
47 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
48 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
49 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
50 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
51 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
52 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
53 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
54 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
57 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
58 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
59 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
62 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
68 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
71 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
72 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
77 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
80 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
91 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
92 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
101 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
102 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
103 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0.81
Rhizoplane 0.81
Rhizosphere 95.16
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001863 3300002738 Bacteria 6430
2 Ga0079104_1014750 3300006946 Bacteria 2345
3 Ga0182006_1000008 3300015261 Bacteria 449652
4 Ga0182005_1000164 3300015265 Bacteria 45727
5 Ga0213872_10000298 3300021361 Bacteria 42359
6 Ga0209646_1000054 3300025246 Bacteria 279447
7 Ga0209564_1000002 3300025295 Bacteria 1636803
8 Ga0207655_1087780 3300025728 Bacteria 1102
9 Ga0209281_1039202 3300027111 Bacteria 805
10 Ga0316181_1210793 3300030744 Bacteria 3737
11 Ga0265314_10021987 3300031711 Bacteria 4892
12 Ga0436361_0067060 3300039447 Bacteria 222217
13 Ga0436361_0215143 3300039447 Bacteria 6578
14 Ga0436361_0866054 3300039447 Bacteria 74597
15 Ga0450898_008909 3300042134 Bacteria 1596
16 Ga0466981_0132256 3300044669 Bacteria 1734
17 Ga0466982_0027318 3300044672 Bacteria 3343
18 Ga0453684_0006785 3300044712 Bacteria 21538
19 Ga0453684_0088075 3300044712 Bacteria 3845
20 Ga0453684_0961653 3300044712 Unclassified 911
21 Ga0453684_1120721 3300044712 Unclassified 830
22 Ga0453684_1602478 3300044712 Unclassified 668
23 Ga0466970_0180151 3300044765 Bacteria 1172
24 Ga0451576_1264182 3300045051 Archaea 770
25 Ga0495627_000001 3300046453 Bacteria 1104709
26 Ga0495627_022769 3300046453 Bacteria 2058
27 Ga0495603_0030084 3300046455 Bacteria 3272
28 Ga0495603_0079142 3300046455 Bacteria 1927
29 Ga0495590_0001613 3300046457 Bacteria 9652
30 Ga0495629_0095706 3300046459 Bacteria 2071
31 Ga0495638_0000072 3300046460 Bacteria 164926
32 Ga0495638_0035815 3300046460 Bacteria 3162
33 Ga0495638_0233075 3300046460 Bacteria 1023
34 Ga0495638_0601058 3300046460 Bacteria 540
35 Ga0495653_0024250 3300046463 Bacteria 4891
36 Ga0495653_0027356 3300046463 Bacteria 4563
37 Ga0495653_0256046 3300046463 Bacteria 1159
38 Ga0495650_0000061 3300046471 Bacteria 283347
39 Ga0495650_0161395 3300046471 Bacteria 799
40 Ga0495580_0020288 3300046472 Bacteria 4921
41 Ga0495582_0011088 3300046473 Bacteria 4963
42 Ga0495582_0306476 3300046473 Bacteria 913
43 Ga0495605_0249104 3300046474 Bacteria 760
44 Ga0495584_0000002 3300046491 Bacteria 512179
45 Ga0495584_0000175 3300046491 Bacteria 45105
46 Ga0495584_0002585 3300046491 Bacteria 10202
47 Ga0495584_0032273 3300046491 Bacteria 2651
48 Ga0495584_0158149 3300046491 Bacteria 1151
49 Ga0495584_0190128 3300046491 Bacteria 1043
50 Ga0495584_0444272 3300046491 Bacteria 659
51 Ga0495584_0446865 3300046491 Bacteria 657
52 Ga0495585_0000257 3300046492 Bacteria 54605
53 Ga0495585_0000438 3300046492 Bacteria 39870
54 Ga0495585_0003267 3300046492 Bacteria 11042
55 Ga0495585_0005570 3300046492 Bacteria 7912
56 Ga0495585_0041999 3300046492 Bacteria 2563
57 Ga0495585_0049599 3300046492 Bacteria 2330
58 Ga0495585_0075921 3300046492 Bacteria 1826
59 Ga0495585_0080122 3300046492 Bacteria 1770
60 Ga0495585_0144751 3300046492 Bacteria 1242
61 Ga0495585_0439180 3300046492 Bacteria 625
62 Ga0495585_0539941 3300046492 Bacteria 551
63 Ga0495594_0006329 3300046499 Bacteria 6089
64 Ga0495594_0006686 3300046499 Bacteria 5932
65 Ga0495594_0055340 3300046499 Bacteria 2187
66 Ga0495594_0197827 3300046499 Bacteria 1145
67 Ga0495596_0000044 3300046500 Bacteria 90299
68 Ga0495596_0040724 3300046500 Bacteria 1833
69 Ga0495596_0196727 3300046500 Bacteria 783
70 Ga0495607_0004526 3300046501 Bacteria 10205
71 Ga0495607_0061478 3300046501 Bacteria 2134
72 Ga0495607_0086333 3300046501 Bacteria 1711
73 Ga0495607_0298959 3300046501 Bacteria 758
74 Ga0495583_0000243 3300046506 Bacteria 89875
75 Ga0495583_0024928 3300046506 Bacteria 2996
76 Ga0495583_0042032 3300046506 Bacteria 2137
77 Ga0495583_0312296 3300046506 Unclassified 623
78 Ga0495583_0415994 3300046506 Unclassified 527
79 Ga0495606_0000460 3300046507 Bacteria 66820
80 Ga0495606_0000590 3300046507 Bacteria 57441
81 Ga0495606_0005979 3300046507 Bacteria 11408
82 Ga0495606_0197189 3300046507 Bacteria 1150
83 Ga0495606_0233522 3300046507 Bacteria 1029
84 Ga0495606_0409202 3300046507 Unclassified 704
85 Ga0495610_0006813 3300046512 Bacteria 7751
86 Ga0495610_0036545 3300046512 Bacteria 2508
87 Ga0495616_0000448 3300046513 Bacteria 31436
88 Ga0495616_0009465 3300046513 Bacteria 5697
89 Ga0495616_0049756 3300046513 Bacteria 2099
90 Ga0495616_0120184 3300046513 Bacteria 1214
91 Ga0495616_0227524 3300046513 Bacteria 809
92 Ga0495620_0172011 3300046515 Bacteria 839
93 Ga0495630_0015859 3300046517 Bacteria 5506
94 Ga0495631_0001307 3300046518 Bacteria 15264
95 Ga0495631_0025269 3300046518 Bacteria 2737
96 Ga0495631_0174980 3300046518 Bacteria 920
97 Ga0495631_0407801 3300046518 Unclassified 579
98 Ga0495632_0015686 3300046519 Bacteria 4236
99 Ga0495643_0000135 3300046522 Bacteria 118587
100 Ga0495643_0000521 3300046522 Bacteria 47921
101 Ga0495643_0082467 3300046522 Bacteria 1670
102 Ga0495643_0159741 3300046522 Bacteria 1109
103 Ga0495643_0181577 3300046522 Bacteria 1022
104 Ga0495644_0004287 3300046523 Bacteria 5604
105 Ga0495644_0009395 3300046523 Bacteria 3771
106 Ga0495644_0022026 3300046523 Bacteria 2429
107 Ga0495644_0053120 3300046523 Bacteria 1522
108 Ga0495644_0139541 3300046523 Bacteria 925
109 Ga0495648_0010344 3300046524 Bacteria 7111
110 Ga0495648_0066565 3300046524 Bacteria 2112
111 Ga0495663_0002118 3300046525 Bacteria 6074
112 Ga0495666_0004661 3300046526 Bacteria 6939
113 Ga0495666_0037614 3300046526 Bacteria 2354
114 Ga0495666_0073667 3300046526 Bacteria 1620
115 Ga0495642_0001775 3300046528 Bacteria 9306
116 Ga0495642_0003656 3300046528 Bacteria 6043
117 Ga0495642_0133744 3300046528 Bacteria 1068
118 Ga0495642_0155308 3300046528 Bacteria 991
119 Ga0495652_0003096 3300046529 Bacteria 16621
120 Ga0495654_0193612 3300046530 Bacteria 874
121 Ga0495665_0001948 3300046531 Bacteria 11142
122 Ga0495665_0020742 3300046531 Bacteria 3529
123 Ga0495665_0023447 3300046531 Bacteria 3315
124 Ga0495586_0009108 3300046535 Bacteria 5280
125 Ga0495586_0027907 3300046535 Bacteria 3020
126 Ga0495586_0050243 3300046535 Bacteria 2256
127 Ga0495587_0026605 3300046536 Bacteria 3527
128 Ga0495587_0042015 3300046536 Bacteria 2727
129 Ga0495587_0044958 3300046536 Bacteria 2625
130 Ga0495609_0000667 3300046538 Bacteria 26626
131 Ga0495609_0014164 3300046538 Bacteria 3754
132 Ga0495609_0015221 3300046538 Bacteria 3602
133 Ga0495609_0035636 3300046538 Bacteria 2251
134 Ga0495609_0229917 3300046538 Bacteria 768
135 Ga0495597_0000156 3300046542 Bacteria 60520
136 Ga0495597_0006412 3300046542 Bacteria 6089
137 Ga0495622_0000010 3300046557 Bacteria 212375
138 Ga0495622_0015750 3300046557 Bacteria 3516
139 Ga0495622_0037888 3300046557 Bacteria 2245
140 Ga0495622_0082670 3300046557 Bacteria 1477
141 Ga0495633_0002808 3300046558 Bacteria 12041
142 Ga0495633_0005313 3300046558 Bacteria 7911
143 Ga0495633_0034626 3300046558 Bacteria 2427
144 Ga0495633_0092024 3300046558 Bacteria 1409
145 Ga0495633_0098051 3300046558 Bacteria 1361
146 Ga0495633_0145510 3300046558 Bacteria 1095
147 Ga0495633_0165507 3300046558 Bacteria 1020
148 Ga0495633_0532360 3300046558 Bacteria 529
149 Ga0495656_0005059 3300046615 Bacteria 4544
150 Ga0495656_0077850 3300046615 Bacteria 1489
151 Ga0495656_0081074 3300046615 Bacteria 1464
152 Ga0495656_0169237 3300046615 Bacteria 1067
153 Ga0495668_0000404 3300046616 Bacteria 56317
154 Ga0495668_0047227 3300046616 Bacteria 2390
155 Ga0495668_0065178 3300046616 Bacteria 2005
156 Ga0495668_0240775 3300046616 Bacteria 990
157 Ga0495668_0867019 3300046616 Bacteria 500
158 Ga0495634_0028836 3300046642 Bacteria 3848
159 Ga0495611_0002468 3300046648 Bacteria 8445
160 Ga0495611_0039898 3300046648 Bacteria 2091
161 Ga0495611_0042670 3300046648 Bacteria 2025
162 Ga0495611_0045690 3300046648 Bacteria 1962
163 Ga0495625_0031037 3300046660 Bacteria 3978
164 Ga0495625_0034511 3300046660 Bacteria 3732
165 Ga0495635_0220849 3300046663 Bacteria 1281
166 Ga0495661_0015625 3300046665 Bacteria 5063
167 Ga0495661_0047766 3300046665 Bacteria 2604
168 Ga0495661_0053190 3300046665 Bacteria 2436
169 Ga0495588_0017492 3300046674 Bacteria 3483
170 Ga0495588_0041824 3300046674 Bacteria 2341
171 Ga0495588_0084316 3300046674 Bacteria 1660
172 Ga0495588_0401543 3300046674 Bacteria 719
173 Ga0495599_0145177 3300046678 Bacteria 1471
174 Ga0495623_0006301 3300046679 Bacteria 7714
175 Ga0495623_0189724 3300046679 Bacteria 1188
176 Ga0495646_0065673 3300046680 Bacteria 2148
177 Ga0495669_0000812 3300046684 Bacteria 13318
178 Ga0495669_0387778 3300046684 Bacteria 676
179 Ga0495670_0000207 3300046691 Bacteria 26631
180 Ga0495670_0003686 3300046691 Bacteria 7530
181 Ga0495670_0006460 3300046691 Bacteria 5759
182 Ga0495670_0026168 3300046691 Bacteria 2888
183 Ga0495670_0028070 3300046691 Bacteria 2789
184 Ga0495670_0051321 3300046691 Bacteria 2064
185 Ga0495670_0067615 3300046691 Bacteria 1804
186 Ga0495670_0661503 3300046691 Bacteria 569
187 Ga0495671_0025063 3300046692 Bacteria 3103
188 Ga0495649_0230063 3300046694 Bacteria 957
189 Ga0495649_0400741 3300046694 Bacteria 689
190 Ga0495589_0086300 3300046794 Bacteria 1524
191 Ga0495589_0129750 3300046794 Bacteria 1211
192 Ga0495589_0221227 3300046794 Bacteria 889
193 Ga0495600_0070422 3300046809 Bacteria 2285
194 Ga0495660_0000400 3300046810 Bacteria 37396
195 Ga0495660_0012826 3300046810 Bacteria 4860
196 Ga0495660_0014750 3300046810 Bacteria 4520
197 Ga0495660_0058271 3300046810 Bacteria 2081
198 Ga0495581_0019259 3300047315 Bacteria 3961
199 Ga0495604_0007035 3300047317 Bacteria 8920
200 Ga0495636_0078731 3300047318 Bacteria 1416
201 Ga0495674_0016774 3300047319 Bacteria 6832
202 Ga0495672_0000036 3300047320 Bacteria 279648
203 Ga0495672_0248904 3300047320 Bacteria 863
204 Ga0495676_0020271 3300047321 Bacteria 5838
205 Ga0495676_0032481 3300047321 Bacteria 4405
206 Ga0495676_0081771 3300047321 Bacteria 2447
207 Ga0495676_0155167 3300047321 Bacteria 1625
208 Ga0495676_0345872 3300047321 Bacteria 995
209 Ga0495680_0012360 3300047322 Bacteria 7516
210 Ga0495680_0067913 3300047322 Bacteria 2725
211 Ga0495683_0000007 3300047323 Bacteria 268546
212 Ga0495683_0056909 3300047323 Bacteria 1944
213 Ga0495687_002609 3300047443 Bacteria 14166
214 Ga0495687_005796 3300047443 Bacteria 7753
215 Ga0495687_040291 3300047443 Bacteria 2059
216 Ga0495675_0020828 3300047444 Bacteria 4173
217 Ga0495675_0033238 3300047444 Bacteria 3292
218 Ga0495675_0069229 3300047444 Bacteria 2228
219 Ga0495677_0007751 3300047445 Bacteria 4001
220 Ga0495677_0076730 3300047445 Bacteria 1249
221 Ga0495673_0003823 3300047469 Bacteria 9723
222 Ga0495681_0001349 3300047470 Bacteria 18551
223 Ga0495681_0009894 3300047470 Bacteria 5825
224 Ga0495681_0155201 3300047470 Bacteria 957
225 Ga0495686_0157153 3300047472 Bacteria 1331
226 Ga0495593_0001842 3300047673 Bacteria 12614
227 Ga0495593_0234141 3300047673 Bacteria 921
228 Ga0495602_0157737 3300048088 Bacteria 1775
229 Ga0495614_0023250 3300048089 Bacteria 2674
230 Ga0495626_0000018 3300048091 Bacteria 230153
231 Ga0495626_0001918 3300048091 Bacteria 15464
232 Ga0495626_0025774 3300048091 Bacteria 2872
233 Ga0495626_0031895 3300048091 Bacteria 2533
234 Ga0495626_0046426 3300048091 Bacteria 2023
235 Ga0496115_0123072 3300048918 Bacteria 2135
236 Ga0496115_0278578 3300048918 Bacteria 1373
237 Ga0496116_0016777 3300048919 Bacteria 5715
238 Ga0495678_000002 3300049459 Bacteria 999613
239 Ga0495678_009496 3300049459 Bacteria 4809
240 Ga0495678_144142 3300049459 Bacteria 776
241 Ga0495682_0006025 3300049460 Bacteria 4949
242 Ga0501249_036572 3300049679 Bacteria 1106
243 Ga0501269_000230 3300049766 Bacteria 16425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0145177 Ga0495599_0145177_220_471 74
2 iso_pu_bacteria 2919476304 2919477538 77
3 3300046507 Ga0495606_0197189 Ga0495606_0197189_598_846 78
4 iso_pu_bacteria 2857553236 2857555190 80
5 iso_pu_bacteria 2885080285 2885080830 80
6 iso_pu_bacteria 2932410948 2932412123 80
7 iso_pu_bacteria 2932416698 2932418311 80
8 3300006946 Ga0079104_1014750 Ga0079104_10147502 81
9 3300015261 Ga0182006_1000008 Ga0182006_1000008193 81
10 3300015265 Ga0182005_1000164 Ga0182005_10001645 81
11 3300027111 Ga0209281_1039202 Ga0209281_10392022 81
12 3300002738 JGI25154J39366_1001863 JGI25154J39366_10018631 82
13 3300021361 Ga0213872_10000298 Ga0213872_1000029823 82
14 3300025246 Ga0209646_1000054 Ga0209646_1000054184 82
15 3300025295 Ga0209564_1000002 Ga0209564_1000002311 82
16 3300025728 Ga0207655_1087780 Ga0207655_10877802 82
17 3300030744 Ga0316181_1210793 Ga0316181_12107932 82
18 3300031711 Ga0265314_10021987 Ga0265314_100219874 82
19 3300039447 Ga0436361_0067060 Ga0436361_0067060_13069_13317 82
20 3300039447 Ga0436361_0215143 Ga0436361_0215143_3045_3293 82
21 3300039447 Ga0436361_0866054 Ga0436361_0866054_65232_65483 82
22 3300042134 Ga0450898_008909 Ga0450898_008909_267_536 82
23 3300044669 Ga0466981_0132256 Ga0466981_0132256_977_1228 82
24 3300044672 Ga0466982_0027318 Ga0466982_0027318_2685_2936 82
25 3300044712 Ga0453684_0006785 Ga0453684_0006785_12224_12478 82
26 3300044712 Ga0453684_0088075 Ga0453684_0088075_3359_3613 82
27 3300044712 Ga0453684_0961653 Ga0453684_0961653_233_487 82
28 3300044712 Ga0453684_1120721 Ga0453684_1120721_342_596 82
29 3300044712 Ga0453684_1602478 Ga0453684_1602478_44_298 82
30 3300044765 Ga0466970_0180151 Ga0466970_0180151_248_499 82
31 3300045051 Ga0451576_1264182 Ga0451576_1264182_115_369 82
32 3300046453 Ga0495627_000001 Ga0495627_000001_399461_399712 82
33 3300046453 Ga0495627_022769 Ga0495627_022769_81_359 82
34 3300046455 Ga0495603_0030084 Ga0495603_0030084_691_951 82
35 3300046455 Ga0495603_0079142 Ga0495603_0079142_803_1075 82
36 3300046457 Ga0495590_0001613 Ga0495590_0001613_7183_7461 82
37 3300046459 Ga0495629_0095706 Ga0495629_0095706_87_347 82
38 3300046460 Ga0495638_0000072 Ga0495638_0000072_8722_8982 82
39 3300046460 Ga0495638_0035815 Ga0495638_0035815_462_722 82
40 3300046460 Ga0495638_0233075 Ga0495638_0233075_179_439 82
41 3300046460 Ga0495638_0601058 Ga0495638_0601058_75_335 82
42 3300046463 Ga0495653_0024250 Ga0495653_0024250_871_1143 82
43 3300046463 Ga0495653_0027356 Ga0495653_0027356_593_865 82
44 3300046463 Ga0495653_0256046 Ga0495653_0256046_593_865 82
45 3300046471 Ga0495650_0000061 Ga0495650_0000061_228126_228374 82
46 3300046471 Ga0495650_0161395 Ga0495650_0161395_23_283 82
47 3300046472 Ga0495580_0020288 Ga0495580_0020288_689_961 82
48 3300046473 Ga0495582_0011088 Ga0495582_0011088_1052_1312 82
49 3300046473 Ga0495582_0306476 Ga0495582_0306476_140_406 82
50 3300046474 Ga0495605_0249104 Ga0495605_0249104_39_299 82
51 3300046491 Ga0495584_0000002 Ga0495584_0000002_366014_366274 82
52 3300046491 Ga0495584_0000175 Ga0495584_0000175_33799_34059 82
53 3300046491 Ga0495584_0002585 Ga0495584_0002585_8684_8944 82
54 3300046491 Ga0495584_0032273 Ga0495584_0032273_661_921 82
55 3300046491 Ga0495584_0158149 Ga0495584_0158149_688_948 82
56 3300046491 Ga0495584_0190128 Ga0495584_0190128_272_532 82
57 3300046491 Ga0495584_0444272 Ga0495584_0444272_19_297 82
58 3300046491 Ga0495584_0446865 Ga0495584_0446865_59_319 82
59 3300046492 Ga0495585_0000257 Ga0495585_0000257_13708_13968 82
60 3300046492 Ga0495585_0000438 Ga0495585_0000438_6288_6548 82
61 3300046492 Ga0495585_0003267 Ga0495585_0003267_1149_1409 82
62 3300046492 Ga0495585_0005570 Ga0495585_0005570_135_392 82
63 3300046492 Ga0495585_0041999 Ga0495585_0041999_1992_2252 82
64 3300046492 Ga0495585_0049599 Ga0495585_0049599_1719_1979 82
65 3300046492 Ga0495585_0075921 Ga0495585_0075921_319_579 82
66 3300046492 Ga0495585_0080122 Ga0495585_0080122_1441_1701 82
67 3300046492 Ga0495585_0144751 Ga0495585_0144751_776_1036 82
68 3300046492 Ga0495585_0439180 Ga0495585_0439180_243_503 82
69 3300046492 Ga0495585_0539941 Ga0495585_0539941_168_425 82
70 3300046499 Ga0495594_0006329 Ga0495594_0006329_1594_1854 82
71 3300046499 Ga0495594_0006686 Ga0495594_0006686_4583_4843 82
72 3300046499 Ga0495594_0055340 Ga0495594_0055340_330_602 82
73 3300046499 Ga0495594_0197827 Ga0495594_0197827_350_616 82
74 3300046500 Ga0495596_0000044 Ga0495596_0000044_12126_12386 82
75 3300046500 Ga0495596_0040724 Ga0495596_0040724_752_1012 82
76 3300046500 Ga0495596_0196727 Ga0495596_0196727_472_732 82
77 3300046501 Ga0495607_0004526 Ga0495607_0004526_8333_8593 82
78 3300046501 Ga0495607_0061478 Ga0495607_0061478_1279_1539 82
79 3300046501 Ga0495607_0086333 Ga0495607_0086333_1372_1632 82
80 3300046501 Ga0495607_0298959 Ga0495607_0298959_396_656 82
81 3300046506 Ga0495583_0000243 Ga0495583_0000243_23167_23427 82
82 3300046506 Ga0495583_0024928 Ga0495583_0024928_460_720 82
83 3300046506 Ga0495583_0042032 Ga0495583_0042032_357_617 82
84 3300046506 Ga0495583_0312296 Ga0495583_0312296_72_332 82
85 3300046506 Ga0495583_0415994 Ga0495583_0415994_208_468 82
86 3300046507 Ga0495606_0000460 Ga0495606_0000460_6824_7084 82
87 3300046507 Ga0495606_0000590 Ga0495606_0000590_5541_5789 82
88 3300046507 Ga0495606_0005979 Ga0495606_0005979_10099_10359 82
89 3300046507 Ga0495606_0233522 Ga0495606_0233522_514_774 82
90 3300046507 Ga0495606_0409202 Ga0495606_0409202_134_412 82
91 3300046512 Ga0495610_0006813 Ga0495610_0006813_1680_1940 82
92 3300046512 Ga0495610_0036545 Ga0495610_0036545_1745_2005 82
93 3300046513 Ga0495616_0000448 Ga0495616_0000448_10658_10918 82
94 3300046513 Ga0495616_0009465 Ga0495616_0009465_4198_4458 82
95 3300046513 Ga0495616_0049756 Ga0495616_0049756_891_1151 82
96 3300046513 Ga0495616_0120184 Ga0495616_0120184_501_761 82
97 3300046513 Ga0495616_0227524 Ga0495616_0227524_197_457 82
98 3300046515 Ga0495620_0172011 Ga0495620_0172011_107_367 82
99 3300046517 Ga0495630_0015859 Ga0495630_0015859_1540_1812 82
100 3300046518 Ga0495631_0001307 Ga0495631_0001307_13323_13583 82
101 3300046518 Ga0495631_0025269 Ga0495631_0025269_272_532 82
102 3300046518 Ga0495631_0174980 Ga0495631_0174980_42_302 82
103 3300046518 Ga0495631_0407801 Ga0495631_0407801_137_397 82
104 3300046519 Ga0495632_0015686 Ga0495632_0015686_34_294 82
105 3300046522 Ga0495643_0000135 Ga0495643_0000135_109629_109889 82
106 3300046522 Ga0495643_0000521 Ga0495643_0000521_2363_2623 82
107 3300046522 Ga0495643_0082467 Ga0495643_0082467_484_744 82
108 3300046522 Ga0495643_0159741 Ga0495643_0159741_833_1084 82
109 3300046522 Ga0495643_0181577 Ga0495643_0181577_686_940 82
110 3300046523 Ga0495644_0004287 Ga0495644_0004287_3622_3882 82
111 3300046523 Ga0495644_0009395 Ga0495644_0009395_2402_2680 82
112 3300046523 Ga0495644_0022026 Ga0495644_0022026_345_605 82
113 3300046523 Ga0495644_0053120 Ga0495644_0053120_934_1185 82
114 3300046523 Ga0495644_0139541 Ga0495644_0139541_54_314 82
115 3300046524 Ga0495648_0010344 Ga0495648_0010344_1269_1529 82
116 3300046524 Ga0495648_0066565 Ga0495648_0066565_429_689 82
117 3300046525 Ga0495663_0002118 Ga0495663_0002118_397_675 82
118 3300046526 Ga0495666_0004661 Ga0495666_0004661_6214_6486 82
119 3300046526 Ga0495666_0037614 Ga0495666_0037614_1443_1703 82
120 3300046526 Ga0495666_0073667 Ga0495666_0073667_674_946 82
121 3300046528 Ga0495642_0001775 Ga0495642_0001775_5243_5503 82
122 3300046528 Ga0495642_0003656 Ga0495642_0003656_2651_2911 82
123 3300046528 Ga0495642_0133744 Ga0495642_0133744_155_403 82
124 3300046528 Ga0495642_0155308 Ga0495642_0155308_588_845 82
125 3300046529 Ga0495652_0003096 Ga0495652_0003096_8383_8655 82
126 3300046530 Ga0495654_0193612 Ga0495654_0193612_96_356 82
127 3300046531 Ga0495665_0001948 Ga0495665_0001948_4239_4505 82
128 3300046531 Ga0495665_0020742 Ga0495665_0020742_233_505 82
129 3300046531 Ga0495665_0023447 Ga0495665_0023447_2881_3153 82
130 3300046535 Ga0495586_0009108 Ga0495586_0009108_4034_4300 82
131 3300046535 Ga0495586_0027907 Ga0495586_0027907_966_1238 82
132 3300046535 Ga0495586_0050243 Ga0495586_0050243_1826_2092 82
133 3300046536 Ga0495587_0026605 Ga0495587_0026605_448_720 82
134 3300046536 Ga0495587_0042015 Ga0495587_0042015_133_405 82
135 3300046536 Ga0495587_0044958 Ga0495587_0044958_888_1160 82
136 3300046538 Ga0495609_0000667 Ga0495609_0000667_14369_14620 82
137 3300046538 Ga0495609_0014164 Ga0495609_0014164_1244_1504 82
138 3300046538 Ga0495609_0015221 Ga0495609_0015221_3080_3340 82
139 3300046538 Ga0495609_0035636 Ga0495609_0035636_595_855 82
140 3300046538 Ga0495609_0229917 Ga0495609_0229917_457_717 82
141 3300046542 Ga0495597_0000156 Ga0495597_0000156_51427_51687 82
142 3300046542 Ga0495597_0006412 Ga0495597_0006412_428_688 82
143 3300046557 Ga0495622_0000010 Ga0495622_0000010_200917_201165 82
144 3300046557 Ga0495622_0015750 Ga0495622_0015750_1177_1437 82
145 3300046557 Ga0495622_0037888 Ga0495622_0037888_939_1205 82
146 3300046557 Ga0495622_0082670 Ga0495622_0082670_637_891 82
147 3300046558 Ga0495633_0002808 Ga0495633_0002808_839_1096 82
148 3300046558 Ga0495633_0005313 Ga0495633_0005313_646_906 82
149 3300046558 Ga0495633_0034626 Ga0495633_0034626_181_459 82
150 3300046558 Ga0495633_0092024 Ga0495633_0092024_936_1196 82
151 3300046558 Ga0495633_0098051 Ga0495633_0098051_828_1088 82
152 3300046558 Ga0495633_0145510 Ga0495633_0145510_723_983 82
153 3300046558 Ga0495633_0165507 Ga0495633_0165507_290_550 82
154 3300046558 Ga0495633_0532360 Ga0495633_0532360_243_491 82
155 3300046615 Ga0495656_0005059 Ga0495656_0005059_996_1256 82
156 3300046615 Ga0495656_0077850 Ga0495656_0077850_108_368 82
157 3300046615 Ga0495656_0081074 Ga0495656_0081074_38_316 82
158 3300046615 Ga0495656_0169237 Ga0495656_0169237_148_408 82
159 3300046616 Ga0495668_0000404 Ga0495668_0000404_47283_47543 82
160 3300046616 Ga0495668_0047227 Ga0495668_0047227_1562_1822 82
161 3300046616 Ga0495668_0065178 Ga0495668_0065178_894_1154 82
162 3300046616 Ga0495668_0240775 Ga0495668_0240775_350_628 82
163 3300046616 Ga0495668_0867019 Ga0495668_0867019_154_426 82
164 3300046642 Ga0495634_0028836 Ga0495634_0028836_1709_1981 82
165 3300046648 Ga0495611_0002468 Ga0495611_0002468_3552_3812 82
166 3300046648 Ga0495611_0039898 Ga0495611_0039898_206_466 82
167 3300046648 Ga0495611_0042670 Ga0495611_0042670_476_736 82
168 3300046648 Ga0495611_0045690 Ga0495611_0045690_722_982 82
169 3300046660 Ga0495625_0031037 Ga0495625_0031037_2689_2949 82
170 3300046660 Ga0495625_0034511 Ga0495625_0034511_2072_2332 82
171 3300046663 Ga0495635_0220849 Ga0495635_0220849_620_886 82
172 3300046665 Ga0495661_0015625 Ga0495661_0015625_2515_2775 82
173 3300046665 Ga0495661_0047766 Ga0495661_0047766_1964_2242 82
174 3300046665 Ga0495661_0053190 Ga0495661_0053190_1238_1498 82
175 3300046674 Ga0495588_0017492 Ga0495588_0017492_801_1061 82
176 3300046674 Ga0495588_0041824 Ga0495588_0041824_77_343 82
177 3300046674 Ga0495588_0084316 Ga0495588_0084316_830_1102 82
178 3300046674 Ga0495588_0401543 Ga0495588_0401543_170_430 82
179 3300046679 Ga0495623_0006301 Ga0495623_0006301_4273_4548 82
180 3300046679 Ga0495623_0189724 Ga0495623_0189724_793_1065 82
181 3300046680 Ga0495646_0065673 Ga0495646_0065673_20_292 82
182 3300046684 Ga0495669_0000812 Ga0495669_0000812_6290_6550 82
183 3300046684 Ga0495669_0387778 Ga0495669_0387778_17_277 82
184 3300046691 Ga0495670_0000207 Ga0495670_0000207_9839_10099 82
185 3300046691 Ga0495670_0003686 Ga0495670_0003686_5874_6134 82
186 3300046691 Ga0495670_0006460 Ga0495670_0006460_50_307 82
187 3300046691 Ga0495670_0026168 Ga0495670_0026168_1456_1716 82
188 3300046691 Ga0495670_0028070 Ga0495670_0028070_1886_2164 82
189 3300046691 Ga0495670_0051321 Ga0495670_0051321_1063_1323 82
190 3300046691 Ga0495670_0067615 Ga0495670_0067615_1122_1382 82
191 3300046691 Ga0495670_0661503 Ga0495670_0661503_48_296 82
192 3300046692 Ga0495671_0025063 Ga0495671_0025063_290_550 82
193 3300046694 Ga0495649_0230063 Ga0495649_0230063_396_674 82
194 3300046694 Ga0495649_0400741 Ga0495649_0400741_221_481 82
195 3300046794 Ga0495589_0086300 Ga0495589_0086300_182_442 82
196 3300046794 Ga0495589_0129750 Ga0495589_0129750_337_597 82
197 3300046794 Ga0495589_0221227 Ga0495589_0221227_603_863 82
198 3300046809 Ga0495600_0070422 Ga0495600_0070422_951_1223 82
199 3300046810 Ga0495660_0000400 Ga0495660_0000400_14430_14681 82
200 3300046810 Ga0495660_0012826 Ga0495660_0012826_1020_1280 82
201 3300046810 Ga0495660_0014750 Ga0495660_0014750_3772_4029 82
202 3300046810 Ga0495660_0058271 Ga0495660_0058271_108_368 82
203 3300047315 Ga0495581_0019259 Ga0495581_0019259_564_830 82
204 3300047317 Ga0495604_0007035 Ga0495604_0007035_1729_2001 82
205 3300047318 Ga0495636_0078731 Ga0495636_0078731_505_765 82
206 3300047319 Ga0495674_0016774 Ga0495674_0016774_3498_3758 82
207 3300047320 Ga0495672_0000036 Ga0495672_0000036_8479_8736 82
208 3300047320 Ga0495672_0248904 Ga0495672_0248904_561_821 82
209 3300047321 Ga0495676_0020271 Ga0495676_0020271_1747_2007 82
210 3300047321 Ga0495676_0032481 Ga0495676_0032481_1734_1994 82
211 3300047321 Ga0495676_0081771 Ga0495676_0081771_740_1000 82
212 3300047321 Ga0495676_0155167 Ga0495676_0155167_330_590 82
213 3300047321 Ga0495676_0345872 Ga0495676_0345872_647_913 82
214 3300047322 Ga0495680_0012360 Ga0495680_0012360_4626_4898 82
215 3300047322 Ga0495680_0067913 Ga0495680_0067913_1464_1730 82
216 3300047323 Ga0495683_0000007 Ga0495683_0000007_257096_257356 82
217 3300047323 Ga0495683_0056909 Ga0495683_0056909_564_824 82
218 3300047443 Ga0495687_002609 Ga0495687_002609_5118_5378 82
219 3300047443 Ga0495687_005796 Ga0495687_005796_5118_5378 82
220 3300047443 Ga0495687_040291 Ga0495687_040291_40_300 82
221 3300047444 Ga0495675_0020828 Ga0495675_0020828_639_905 82
222 3300047444 Ga0495675_0033238 Ga0495675_0033238_1563_1835 82
223 3300047444 Ga0495675_0069229 Ga0495675_0069229_1741_2013 82
224 3300047445 Ga0495677_0007751 Ga0495677_0007751_852_1130 82
225 3300047445 Ga0495677_0076730 Ga0495677_0076730_243_503 82
226 3300047469 Ga0495673_0003823 Ga0495673_0003823_1989_2249 82
227 3300047470 Ga0495681_0001349 Ga0495681_0001349_7295_7573 82
228 3300047470 Ga0495681_0009894 Ga0495681_0009894_4884_5144 82
229 3300047470 Ga0495681_0155201 Ga0495681_0155201_196_456 82
230 3300047472 Ga0495686_0157153 Ga0495686_0157153_82_342 82
231 3300047673 Ga0495593_0001842 Ga0495593_0001842_5268_5534 82
232 3300047673 Ga0495593_0234141 Ga0495593_0234141_604_876 82
233 3300048088 Ga0495602_0157737 Ga0495602_0157737_932_1204 82
234 3300048089 Ga0495614_0023250 Ga0495614_0023250_153_419 82
235 3300048091 Ga0495626_0000018 Ga0495626_0000018_48121_48384 82
236 3300048091 Ga0495626_0001918 Ga0495626_0001918_683_943 82
237 3300048091 Ga0495626_0025774 Ga0495626_0025774_683_943 82
238 3300048091 Ga0495626_0031895 Ga0495626_0031895_182_442 82
239 3300048091 Ga0495626_0046426 Ga0495626_0046426_629_889 82
240 3300048918 Ga0496115_0123072 Ga0496115_0123072_977_1237 82
241 3300048918 Ga0496115_0278578 Ga0496115_0278578_189_449 82
242 3300048919 Ga0496116_0016777 Ga0496116_0016777_3445_3696 82
243 3300049459 Ga0495678_000002 Ga0495678_000002_110247_110507 82
244 3300049459 Ga0495678_009496 Ga0495678_009496_2016_2276 82
245 3300049459 Ga0495678_144142 Ga0495678_144142_226_516 82
246 3300049460 Ga0495682_0006025 Ga0495682_0006025_2781_3041 82
247 3300049679 Ga0501249_036572 Ga0501249_036572_672_932 82
248 3300049766 Ga0501269_000230 Ga0501269_000230_4959_5219 82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uzr-assembly1.cif.gz_B crystal structure of pyrococcus horikoshii ph1500 0.7256 9 33
5nb8-assembly2.cif.gz_B structure of vwc domain from ccn3 0.5651 10 39
3bk3-assembly1.cif.gz_C crystal structure of the complex of bmp-2 and the first von willebrand domain type c of crossveinless-2 0.4836 1 40
6sjl-assembly1.cif.gz_C structure of the tle1 effector bound to the vgrg spike from the type 6 secretion system 0.4821 2 38
4djz-assembly1.cif.gz_H catalytic fragment of masp-1 in complex with its specific inhibitor developed by directed evolution on sgci scaffold 0.4755 9 35
ID Description Score Start End Superfamily
af_Q2G041_6_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6461 11 31 3.50.50.60
af_A5WUN5_50_310_1.10.555.10 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein 0.6173 10 43 1.10.555.10
af_Q54DE4_367_529_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.617 2 31 2.40.128.630
af_Q55BZ5_169_338_3.60.60.10 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A 0.5765 19 33 3.60.60.10
af_Q6AU68_18_165_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5227 13 51 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A378R6U4-F1-model_v4 Uncharacterized protein 0.9647 4 64
AF-A0A840MND4-F1-model_v4 Ribosomal protein L19 0.9397 1 70 GO:0005840
AF-A0A259CK72-F1-model_v4 Uncharacterized protein 0.9283 1 70
AF-A0A1E7WP32-F1-model_v4 Uncharacterized protein 0.9279 3 82
AF-A0A0Q4P0M3-F1-model_v4 deleted 0.9276 3 82

Feature Viewer

pLDDT pTM Quality
86.05 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map