F360120

General Info

Members Datasets Scaffolds Average Seq Length
248 164 238 399

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0015829|Ga0466968_0015829_67_1467
Length 437
Sequence MFCGHFKCHSDLSSPATQSPQSSGKLLQKHASRRFYYIFAYFNSSILTFKEFGLDESLLEGIEASGYEIATPVQEQVIPLILEGKDIIASAQTGTGKTAAFLLPIINKLIASRIDDQVNALVIVPTRELAIQIAQNLEGLSYFTPISSIAVYGGGDGSNFTTEKQALSRGADIVICTPGRMIAHLNMGYVRMKGLQYLVLDEADRMLDMGFYDDIMKIISFMPHKRQNLLFSATMPVKIRELAKKILHDPAEVNISISKPPAKIVQQAFVVYETQKIPLIKWLLKSVEHFKSILIFCSKKHNVKQLTGDLKRARFNAKEIHSDLDQAAREEVLLEFRSRRLQILVATDILSRGIDIDNIDLVINYDVPNDGEDYVHRIGRTARAETDGMAYTFISEKEQNKFNAIEQLIGNEVPKVPVPEQFGAAPEYNPRGHRNAG

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
3 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
9 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
150 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
151 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
152 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
156 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
163 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
164 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 0
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.32
Nodule 0
Rhizoplane 1.21
Rhizosphere 71.77
Stem 0
Stem Tuber 0
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000005 3300002738 Bacteria 345115
2 rootH1_10017582 3300003316 Bacteria 2511
3 rootH1_10059035 3300003316 Bacteria 3484
4 rootH2_10003346 3300003320 Bacteria 29041
5 rootH2_10046058 3300003320 Bacteria 16845
6 rootL2_10015053 3300003322 Bacteria 11010
7 rootL2_10050879 3300003322 Bacteria 4458
8 rootH1_10003347 3300003323 Bacteria 19564
9 rootH1_10005093 3300003323 Bacteria 9804
10 JGI25160J50197_1002217 3300003354 Bacteria 9122
11 JGI25160J50197_1003915 3300003354 Bacteria 6515
12 Ga0055535_1001063 3300003761 Bacteria 16941
13 Ga0055528_1000483 3300003790 Bacteria 31526
14 Ga0055530_10003332 3300003791 Bacteria 9256
15 Ga0055531_10000144 3300003794 Bacteria 82231
16 Ga0065165_1000106 3300005262 Bacteria 140301
17 Ga0065704_10077693 3300005289 Bacteria 4652
18 Ga0070683_100009061 3300005329 Bacteria 8493
19 Ga0070666_10088625 3300005335 Bacteria 2123
20 Ga0070682_100000037 3300005337 Bacteria 147526
21 Ga0070682_100074584 3300005337 Bacteria 2179
22 Ga0068868_100230590 3300005338 Bacteria 1553
23 Ga0070675_100028501 3300005354 Bacteria 4494
24 Ga0070667_100061958 3300005367 Bacteria 3168
25 Ga0070678_100028645 3300005456 Bacteria 3802
26 Ga0070681_10092130 3300005458 Bacteria 2980
27 Ga0070698_100116847 3300005471 Bacteria 2630
28 Ga0068853_100007567 3300005539 Bacteria 8696
29 Ga0070665_100000047 3300005548 Bacteria 269702
30 Ga0070665_100008360 3300005548 Bacteria 10469
31 Ga0068855_100000081 3300005563 Bacteria 115707
32 Ga0068855_100005540 3300005563 Bacteria 15410
33 Ga0068855_100008678 3300005563 Bacteria 12284
34 Ga0068855_100168145 3300005563 Bacteria 2484
35 Ga0068855_100169287 3300005563 Bacteria 2475
36 Ga0068857_100009241 3300005577 Bacteria 8553
37 Ga0068854_100044924 3300005578 Bacteria 3139
38 Ga0068856_100068196 3300005614 Bacteria 3516
39 Ga0068856_100108653 3300005614 Bacteria 2770
40 Ga0068856_100130771 3300005614 Bacteria 2515
41 Ga0068852_100000290 3300005616 Bacteria 33743
42 Ga0068852_100077398 3300005616 Unclassified 2940
43 Ga0068859_100027302 3300005617 Bacteria 5726
44 Ga0068859_100241745 3300005617 Unclassified 1895
45 Ga0068863_100087582 3300005841 Bacteria 2951
46 Ga0068863_100196866 3300005841 Unclassified 1937
47 Ga0068860_100000024 3300005843 Bacteria 271902
48 Ga0068860_100017260 3300005843 Bacteria 7034
49 Ga0081540_1011686 3300005983 Bacteria 5847
50 Ga0070716_100121930 3300006173 Bacteria 1633
51 Ga0075366_10055297 3300006195 Bacteria 2357
52 Ga0097621_100004609 3300006237 Bacteria 9624
53 Ga0097621_100009031 3300006237 Bacteria 7218
54 Ga0068871_100002140 3300006358 Bacteria 13395
55 Ga0068871_100176570 3300006358 Bacteria 1834
56 Ga0075429_100014460 3300006880 Bacteria 6840
57 Ga0097620_100027302 3300006931 Bacteria 5726
58 Ga0097620_100241720 3300006931 Unclassified 1895
59 Ga0105240_10000020 3300009093 Bacteria 399699
60 Ga0105240_10000445 3300009093 Bacteria 76036
61 Ga0105240_10000606 3300009093 Bacteria 66467
62 Ga0105240_10000912 3300009093 Bacteria 52776
63 Ga0105240_10028329 3300009093 Bacteria 7318
64 Ga0105240_10096001 3300009093 Bacteria 3614
65 Ga0105240_10245049 3300009093 Bacteria 2076
66 Ga0114129_10004318 3300009147 Bacteria 20100
67 Ga0105241_10000180 3300009174 Bacteria 47089
68 Ga0105248_10220739 3300009177 Unclassified 2134
69 Ga0105237_10000294 3300009545 Bacteria 69126
70 Ga0105237_10007335 3300009545 Bacteria 12084
71 Ga0105237_10013603 3300009545 Bacteria 8526
72 Ga0105237_10019366 3300009545 Bacteria 7029
73 Ga0105238_10000449 3300009551 Bacteria 43175
74 Ga0105238_10001798 3300009551 Bacteria 21477
75 Ga0105249_10016050 3300009553 Bacteria 6638
76 Ga0105239_10001669 3300010375 Bacteria 29266
77 Ga0105239_10010312 3300010375 Bacteria 10465
78 Ga0105239_10025288 3300010375 Bacteria 6538
79 Ga0105239_10121314 3300010375 Bacteria 2903
80 Ga0157370_10005965 3300013104 Bacteria 13558
81 Ga0157370_10017352 3300013104 Bacteria 7265
82 Ga0157374_10000027 3300013296 Bacteria 233444
83 Ga0157378_10003762 3300013297 Bacteria 13447
84 Ga0163162_10002973 3300013306 Bacteria 16182
85 Ga0163162_10003261 3300013306 Bacteria 15526
86 Ga0163162_10003461 3300013306 Bacteria 15076
87 Ga0157372_10003224 3300013307 Bacteria 17614
88 Ga0157372_10005167 3300013307 Bacteria 13880
89 Ga0157372_10009054 3300013307 Bacteria 10577
90 Ga0157372_10039847 3300013307 Bacteria 5187
91 Ga0157372_10076190 3300013307 Bacteria 3787
92 Ga0157375_10001810 3300013308 Bacteria 18318
93 Ga0157375_10043231 3300013308 Bacteria 4368
94 Ga0157375_10372292 3300013308 Unclassified 1595
95 Ga0163163_10000079 3300014325 Bacteria 106874
96 Ga0163163_10109859 3300014325 Bacteria 2785
97 Ga0157376_10001989 3300014969 Bacteria 13679
98 Ga0157376_10010228 3300014969 Bacteria 6851
99 Ga0182005_1000192 3300015265 Bacteria 41558
100 Ga0163161_10004956 3300017792 Bacteria 9266
101 Ga0213876_10002719 3300021384 Bacteria 10300
102 Ga0209258_100081 3300025242 Bacteria 254564
103 Ga0209646_1000017 3300025246 Bacteria 488265
104 Ga0209646_1001545 3300025246 Bacteria 6075
105 Ga0209148_1000276 3300025254 Bacteria 80610
106 Ga0209673_1000107 3300025273 Bacteria 184825
107 Ga0209564_1001806 3300025295 Bacteria 19742
108 Ga0209050_1000397 3300025298 Bacteria 81393
109 Ga0207426_1000371 3300025302 Bacteria 79084
110 Ga0209257_1000064 3300025304 Bacteria 356803
111 Ga0209257_1002877 3300025304 Bacteria 16015
112 Ga0207680_10090967 3300025903 Bacteria 1941
113 Ga0207647_10001442 3300025904 Bacteria 18234
114 Ga0207647_10002088 3300025904 Bacteria 15283
115 Ga0207647_10068700 3300025904 Bacteria 2144
116 Ga0207654_10006950 3300025911 Bacteria 5704
117 Ga0207695_10000020 3300025913 Bacteria 723025
118 Ga0207695_10000087 3300025913 Bacteria 276412
119 Ga0207695_10000299 3300025913 Bacteria 122118
120 Ga0207695_10000685 3300025913 Bacteria 66448
121 Ga0207695_10001116 3300025913 Bacteria 46659
122 Ga0207695_10024324 3300025913 Bacteria 6818
123 Ga0207695_10068473 3300025913 Bacteria 3637
124 Ga0207695_10115851 3300025913 Bacteria 2654
125 Ga0207695_10127538 3300025913 Bacteria 2505
126 Ga0207671_10000382 3300025914 Bacteria 62807
127 Ga0207671_10000533 3300025914 Bacteria 51330
128 Ga0207671_10000961 3300025914 Bacteria 35766
129 Ga0207671_10001227 3300025914 Bacteria 30346
130 Ga0207694_10019093 3300025924 Bacteria 5181
131 Ga0207694_10039510 3300025924 Bacteria 3631
132 Ga0207659_10091701 3300025926 Bacteria 2270
133 Ga0207661_10021321 3300025944 Bacteria 4853
134 Ga0207667_10000172 3300025949 Bacteria 95455
135 Ga0207667_10001182 3300025949 Bacteria 32810
136 Ga0207667_10007183 3300025949 Bacteria 13435
137 Ga0207667_10017821 3300025949 Bacteria 7984
138 Ga0207712_10067044 3300025961 Bacteria 2567
139 Ga0207640_10052124 3300025981 Bacteria 2664
140 Ga0207658_10110161 3300025986 Bacteria 2175
141 Ga0207677_10081277 3300026023 Bacteria 2325
142 Ga0207702_10043496 3300026078 Bacteria 3771
143 Ga0207702_10166840 3300026078 Bacteria 2015
144 Ga0207641_10084045 3300026088 Bacteria 2770
145 Ga0207648_10039543 3300026089 Bacteria 4147
146 Ga0207674_10002512 3300026116 Bacteria 23127
147 Ga0207683_10018817 3300026121 Bacteria 5891
148 Ga0207698_10000398 3300026142 Bacteria 25092
149 Ga0207698_10090524 3300026142 Unclassified 2502
150 Ga0209974_10083368 3300027876 Bacteria 1103
151 Ga0268266_10000048 3300028379 Bacteria 310336
152 Ga0268264_10000028 3300028381 Bacteria 426662
153 Ga0307515_10000002 3300028794 Bacteria 1231751
154 Ga0265324_10004685 3300029957 Bacteria 6083
155 Ga0307511_10000002 3300030521 Bacteria 199923
156 Ga0265327_10000148 3300031251 Bacteria 151952
157 Ga0265327_10100072 3300031251 Bacteria 1400
158 Ga0307509_10008902 3300031507 Bacteria 12659
159 Ga0307509_10139961 3300031507 Bacteria 2358
160 Ga0265342_10075418 3300031712 Bacteria 1957
161 Ga0307516_10006319 3300031730 Bacteria 13917
162 Ga0307415_100284848 3300032126 Bacteria 1361
163 Ga0307510_10054168 3300033180 Bacteria 4206
164 Ga0395905_0000001 3300037471 Bacteria 2037079
165 Ga0436365_1631164 3300039437 Bacteria 13717
166 Ga0439439_0016075 3300041406 Bacteria 1830
167 Ga0451843_0296757 3300041509 Bacteria 1457
168 Ga0439431_0000282 3300041997 Bacteria 10451
169 Ga0439457_000493 3300042014 Bacteria 11421
170 Ga0439462_0004755 3300042015 Bacteria 3327
171 Ga0451577_0079779 3300042876 Bacteria 2918
172 Ga0451577_0111917 3300042876 Bacteria 2443
173 Ga0466969_0000272 3300044656 Bacteria 28299
174 Ga0466972_0000002 3300044658 Bacteria 408005
175 Ga0466972_0000123 3300044658 Bacteria 65577
176 Ga0453683_0000182 3300044673 Bacteria 86933
177 Ga0453684_0013410 3300044712 Bacteria 13312
178 Ga0453684_0049086 3300044712 Bacteria 5570
179 Ga0453684_0086974 3300044712 Bacteria 3876
180 Ga0453684_0152753 3300044712 Bacteria 2741
181 Ga0453684_0359350 3300044712 Bacteria 1640
182 Ga0466971_0033649 3300044719 Bacteria 2296
183 Ga0466968_0015829 3300044735 Bacteria 2995
184 Ga0466970_0000187 3300044765 Bacteria 29931
185 Ga0466970_0002424 3300044765 Bacteria 9009
186 Ga0466957_0000084 3300044842 Bacteria 37711
187 Ga0466959_0000035 3300045049 Bacteria 108669
188 Ga0466959_0009905 3300045049 Bacteria 6792
189 Ga0451576_0000903 3300045051 Bacteria 56269
190 Ga0466958_0154483 3300045836 Bacteria 1448
191 Ga0495627_013528 3300046453 Bacteria 2869
192 Ga0495638_0055990 3300046460 Bacteria 2447
193 Ga0495606_0006116 3300046507 Bacteria 11238
194 Ga0495648_0000701 3300046524 Bacteria 35793
195 Ga0495633_0000485 3300046558 Bacteria 40274
196 Ga0495611_0000065 3300046648 Bacteria 74332
197 Ga0495661_0088926 3300046665 Bacteria 1762
198 Ga0495636_0000033 3300047318 Bacteria 57835
199 Ga0495687_000129 3300047443 Bacteria 116030
200 Ga0495686_0000005 3300047472 Bacteria 827143
201 Ga0496105_0177796 3300048908 Bacteria 1743
202 Ga0496114_0071257 3300048917 Bacteria 2921
203 Ga0496115_0126783 3300048918 Bacteria 2103
204 Ga0496121_0000011 3300048924 Bacteria 792193
205 Ga0501032_0043979 3300049569 Bacteria 3023
206 Ga0501034_0018581 3300049571 Bacteria 7126
207 Ga0501034_0027449 3300049571 Bacteria 5791
208 Ga0501034_0047160 3300049571 Bacteria 4352
209 Ga0501047_0068952 3300049581 Bacteria 3406
210 Ga0501047_0082362 3300049581 Bacteria 3093
211 Ga0501225_0010333 3300049705 Bacteria 2644
212 Ga0501035_0072222 3300049822 Bacteria 3055
213 Ga0501044_0011426 3300049823 Bacteria 9620
214 Ga0501044_0033778 3300049823 Bacteria 5371
215 Ga0501284_00017 3300050005 Bacteria 96362
216 nmdc:mga05p37_16679_c1 3300050507 Bacteria 7131
217 Ga0500578_0000060 3300053086 Bacteria 118274
218 Ga0500644_0000186 3300053088 Bacteria 39264
219 Ga0500644_0005188 3300053088 Bacteria 3282
220 Ga0500583_0000003 3300053092 Bacteria 229587
221 Ga0500583_0001611 3300053092 Bacteria 6556
222 Ga0500651_0063965 3300053093 Bacteria 2295
223 Ga0500562_000106 3300053108 Bacteria 30534
224 Ga0500607_025552 3300053121 Bacteria 3286
225 Ga0500652_004500 3300053131 Bacteria 4320
226 Ga0500568_0008230 3300053139 Bacteria 5048
227 Ga0500568_0042620 3300053139 Bacteria 1818
228 Ga0500577_0016426 3300053142 Bacteria 2333
229 Ga0500590_030287 3300053148 Bacteria 2807
230 Ga0500616_0087742 3300053153 Bacteria 1548
231 Ga0500622_0000690 3300053156 Bacteria 29762
232 Ga0500622_0000904 3300053156 Bacteria 25254
233 Ga0500622_0004651 3300053156 Bacteria 8500
234 Ga0500633_0001813 3300053160 Bacteria 4188
235 Ga0500634_0002886 3300053161 Bacteria 7453
236 Ga0500636_0007160 3300053177 Bacteria 6446
237 Ga0500645_008990 3300053730 Bacteria 3374
238 Ga0500661_001142 3300055283 Bacteria 4957

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027876 Ga0209974_10083368 Ga0209974_100833681 308
2 3300003320 rootH2_10046058 rootH2_1004605815 343
3 3300005354 Ga0070675_100028501 Ga0070675_1000285013 357
4 3300025926 Ga0207659_10091701 Ga0207659_100917012 357
5 3300049822 Ga0501035_0072222 Ga0501035_0072222_1938_3032 360
6 3300005843 Ga0068860_100000024 Ga0068860_10000002435 374
7 3300006880 Ga0075429_100014460 Ga0075429_1000144606 374
8 3300013306 Ga0163162_10003261 Ga0163162_1000326113 374
9 3300028381 Ga0268264_10000028 Ga0268264_10000028215 374
10 3300046460 Ga0495638_0055990 Ga0495638_0055990_217_1485 374
11 3300046524 Ga0495648_0000701 Ga0495648_0000701_13869_15137 374
12 3300047443 Ga0495687_000129 Ga0495687_000129_51720_53027 374
13 3300053139 Ga0500568_0008230 Ga0500568_0008230_505_1938 374
14 3300053156 Ga0500622_0000904 Ga0500622_0000904_16143_17411 374
15 3300005563 Ga0068855_100168145 Ga0068855_1001681451 376
16 3300025913 Ga0207695_10115851 Ga0207695_101158512 376
17 3300003320 rootH2_10003346 rootH2_100033464 378
18 3300005841 Ga0068863_100196866 Ga0068863_1001968662 378
19 3300013307 Ga0157372_10003224 Ga0157372_1000322417 378
20 3300005563 Ga0068855_100005540 Ga0068855_10000554014 380
21 3300009093 Ga0105240_10000606 Ga0105240_100006062 380
22 3300010375 Ga0105239_10025288 Ga0105239_100252886 380
23 3300014969 Ga0157376_10001989 Ga0157376_100019892 380
24 3300025913 Ga0207695_10000685 Ga0207695_100006852 380
25 3300025949 Ga0207667_10007183 Ga0207667_100071834 380
26 3300047318 Ga0495636_0000033 Ga0495636_0000033_11494_12708 380
27 3300003316 rootH1_10017582 rootH1_100175822 381
28 3300005338 Ga0068868_100230590 Ga0068868_1002305901 381
29 3300010375 Ga0105239_10010312 Ga0105239_100103122 383
30 3300013296 Ga0157374_10000027 Ga0157374_1000002760 383
31 3300005548 Ga0070665_100000047 Ga0070665_10000004738 386
32 3300005841 Ga0068863_100087582 Ga0068863_1000875823 386
33 3300013307 Ga0157372_10039847 Ga0157372_100398473 386
34 3300025904 Ga0207647_10068700 Ga0207647_100687002 386
35 3300025913 Ga0207695_10068473 Ga0207695_100684731 386
36 3300025914 Ga0207671_10000961 Ga0207671_1000096125 386
37 3300026088 Ga0207641_10084045 Ga0207641_100840451 386
38 3300028379 Ga0268266_10000048 Ga0268266_1000004848 386
39 3300044712 Ga0453684_0086974 Ga0453684_0086974_1158_2402 386
40 3300005577 Ga0068857_100009241 Ga0068857_1000092415 387
41 3300005578 Ga0068854_100044924 Ga0068854_1000449242 387
42 3300005614 Ga0068856_100108653 Ga0068856_1001086532 387
43 3300005616 Ga0068852_100000290 Ga0068852_10000029022 387
44 3300005843 Ga0068860_100017260 Ga0068860_1000172606 387
45 3300005983 Ga0081540_1011686 Ga0081540_10116866 387
46 3300009093 Ga0105240_10028329 Ga0105240_100283296 387
47 3300009093 Ga0105240_10096001 Ga0105240_100960013 387
48 3300009545 Ga0105237_10019366 Ga0105237_100193667 387
49 3300009551 Ga0105238_10001798 Ga0105238_1000179811 387
50 3300013104 Ga0157370_10005965 Ga0157370_100059657 387
51 3300013307 Ga0157372_10005167 Ga0157372_100051677 387
52 3300014325 Ga0163163_10109859 Ga0163163_101098592 387
53 3300025904 Ga0207647_10001442 Ga0207647_100014428 387
54 3300025924 Ga0207694_10039510 Ga0207694_100395102 387
55 3300025949 Ga0207667_10001182 Ga0207667_100011828 387
56 3300025981 Ga0207640_10052124 Ga0207640_100521242 387
57 3300026078 Ga0207702_10166840 Ga0207702_101668402 387
58 3300026116 Ga0207674_10002512 Ga0207674_100025123 387
59 3300026142 Ga0207698_10000398 Ga0207698_1000039815 387
60 3300053088 Ga0500644_0005188 Ga0500644_0005188_604_1863 387
61 3300053108 Ga0500562_000106 Ga0500562_000106_29085_30344 387
62 3300053156 Ga0500622_0004651 Ga0500622_0004651_7040_8332 387
63 3300053730 Ga0500645_008990 Ga0500645_008990_1852_3111 387
64 3300009093 Ga0105240_10000912 Ga0105240_100009122 388
65 3300009093 Ga0105240_10245049 Ga0105240_102450492 388
66 3300025913 Ga0207695_10000299 Ga0207695_1000029940 388
67 3300025913 Ga0207695_10127538 Ga0207695_101275382 388
68 3300026089 Ga0207648_10039543 Ga0207648_100395433 388
69 3300042876 Ga0451577_0079779 Ga0451577_0079779_1679_2878 388
70 3300044658 Ga0466972_0000123 Ga0466972_0000123_21314_22531 388
71 3300044735 Ga0466968_0015829 Ga0466968_0015829_67_1467 388
72 3300053153 Ga0500616_0087742 Ga0500616_0087742_218_1462 388
73 3300003323 rootH1_10003347 rootH1_1000334711 389
74 3300030521 Ga0307511_10000002 Ga0307511_1000000239 389
75 3300042876 Ga0451577_0111917 Ga0451577_0111917_466_1668 389
76 3300044712 Ga0453684_0013410 Ga0453684_0013410_4342_5544 389
77 3300044712 Ga0453684_0359350 Ga0453684_0359350_254_1468 389
78 3300031251 Ga0265327_10000148 Ga0265327_1000014899 390
79 3300031507 Ga0307509_10008902 Ga0307509_100089028 390
80 3300046648 Ga0495611_0000065 Ga0495611_0000065_22616_23923 390
81 3300053092 Ga0500583_0001611 Ga0500583_0001611_884_2098 390
82 3300053131 Ga0500652_004500 Ga0500652_004500_1042_2256 390
83 3300005289 Ga0065704_10077693 Ga0065704_100776932 391
84 3300031712 Ga0265342_10075418 Ga0265342_100754181 391
85 3300044842 Ga0466957_0000084 Ga0466957_0000084_15237_16451 391
86 3300025246 Ga0209646_1001545 Ga0209646_10015456 392
87 3300044712 Ga0453684_0049086 Ga0453684_0049086_17_1297 392
88 3300047472 Ga0495686_0000005 Ga0495686_0000005_703598_704875 392
89 3300048918 Ga0496115_0126783 Ga0496115_0126783_290_1558 392
90 3300055283 Ga0500661_001142 Ga0500661_001142_2083_3342 392
91 iso_pu_bacteria 2821136567 2821142381 392
92 iso_pu_bacteria 2904467357 2904470452 392
93 3300005471 Ga0070698_100116847 Ga0070698_1001168471 393
94 3300005539 Ga0068853_100007567 Ga0068853_1000075676 393
95 3300005616 Ga0068852_100077398 Ga0068852_1000773982 393
96 3300006195 Ga0075366_10055297 Ga0075366_100552973 393
97 3300009093 Ga0105240_10000445 Ga0105240_1000044556 393
98 3300009174 Ga0105241_10000180 Ga0105241_1000018035 393
99 3300009545 Ga0105237_10013603 Ga0105237_100136037 393
100 3300009551 Ga0105238_10000449 Ga0105238_1000044933 393
101 3300013307 Ga0157372_10009054 Ga0157372_1000905410 393
102 3300015265 Ga0182005_1000192 Ga0182005_10001925 393
103 3300025911 Ga0207654_10006950 Ga0207654_100069502 393
104 3300025913 Ga0207695_10001116 Ga0207695_1000111615 393
105 3300025914 Ga0207671_10001227 Ga0207671_1000122726 393
106 3300025924 Ga0207694_10019093 Ga0207694_100190932 393
107 3300026142 Ga0207698_10090524 Ga0207698_100905242 393
108 3300029957 Ga0265324_10004685 Ga0265324_100046852 393
109 3300041406 Ga0439439_0016075 Ga0439439_0016075_43_1239 393
110 3300042014 Ga0439457_000493 Ga0439457_000493_7366_8610 393
111 3300042015 Ga0439462_0004755 Ga0439462_0004755_596_1840 393
112 3300046507 Ga0495606_0006116 Ga0495606_0006116_6185_7471 393
113 3300053148 Ga0500590_030287 Ga0500590_030287_399_1679 393
114 3300053156 Ga0500622_0000690 Ga0500622_0000690_19252_20577 393
115 3300053177 Ga0500636_0007160 Ga0500636_0007160_541_1824 393
116 3300003794 Ga0055531_10000144 Ga0055531_1000014421 394
117 3300009545 Ga0105237_10000294 Ga0105237_1000029445 394
118 3300025304 Ga0209257_1000064 Ga0209257_1000064151 394
119 3300025914 Ga0207671_10000533 Ga0207671_1000053324 394
120 3300031251 Ga0265327_10100072 Ga0265327_101000721 394
121 3300050005 Ga0501284_00017 Ga0501284_00017_46146_47462 394
122 3300053142 Ga0500577_0016426 Ga0500577_0016426_65_1360 394
123 iso_pu_bacteria 2818991442 2819576151 394
124 3300003354 JGI25160J50197_1002217 JGI25160J50197_10022174 395
125 3300003790 Ga0055528_1000483 Ga0055528_100048315 395
126 3300003791 Ga0055530_10003332 Ga0055530_100033324 395
127 3300005262 Ga0065165_1000106 Ga0065165_100010689 395
128 3300025273 Ga0209673_1000107 Ga0209673_1000107129 395
129 3300025295 Ga0209564_1001806 Ga0209564_10018068 395
130 3300025298 Ga0209050_1000397 Ga0209050_100039745 395
131 3300025304 Ga0209257_1002877 Ga0209257_10028777 395
132 3300031730 Ga0307516_10006319 Ga0307516_100063199 395
133 3300032126 Ga0307415_100284848 Ga0307415_1002848481 395
134 3300049569 Ga0501032_0043979 Ga0501032_0043979_1122_2321 395
135 3300049705 Ga0501225_0010333 Ga0501225_0010333_112_1350 395
136 3300053088 Ga0500644_0000186 Ga0500644_0000186_22601_23905 395
137 3300053121 Ga0500607_025552 Ga0500607_025552_1140_2444 395
138 3300053160 Ga0500633_0001813 Ga0500633_0001813_1863_3167 395
139 3300053161 Ga0500634_0002886 Ga0500634_0002886_3115_4419 395
140 3300005335 Ga0070666_10088625 Ga0070666_100886251 396
141 3300005367 Ga0070667_100061958 Ga0070667_1000619582 396
142 3300005456 Ga0070678_100028645 Ga0070678_1000286452 396
143 3300005458 Ga0070681_10092130 Ga0070681_100921302 396
144 3300005548 Ga0070665_100008360 Ga0070665_10000836011 396
145 3300006237 Ga0097621_100004609 Ga0097621_1000046092 396
146 3300006358 Ga0068871_100002140 Ga0068871_1000021408 396
147 3300009177 Ga0105248_10220739 Ga0105248_102207392 396
148 3300009545 Ga0105237_10007335 Ga0105237_1000733514 396
149 3300010375 Ga0105239_10121314 Ga0105239_101213141 396
150 3300013297 Ga0157378_10003762 Ga0157378_100037628 396
151 3300013306 Ga0163162_10003461 Ga0163162_100034613 396
152 3300013308 Ga0157375_10001810 Ga0157375_1000181014 396
153 3300014969 Ga0157376_10010228 Ga0157376_100102282 396
154 3300017792 Ga0163161_10004956 Ga0163161_100049564 396
155 3300025903 Ga0207680_10090967 Ga0207680_100909672 396
156 3300025904 Ga0207647_10002088 Ga0207647_100020888 396
157 3300025913 Ga0207695_10024324 Ga0207695_100243245 396
158 3300025914 Ga0207671_10000382 Ga0207671_1000038247 396
159 3300026121 Ga0207683_10018817 Ga0207683_100188172 396
160 3300048908 Ga0496105_0177796 Ga0496105_0177796_233_1426 396
161 3300048917 Ga0496114_0071257 Ga0496114_0071257_950_2143 396
162 3300053092 Ga0500583_0000003 Ga0500583_0000003_146142_147353 396
163 3300003316 rootH1_10059035 rootH1_100590351 397
164 3300005329 Ga0070683_100009061 Ga0070683_1000090615 397
165 3300005563 Ga0068855_100000081 Ga0068855_10000008135 397
166 3300005563 Ga0068855_100008678 Ga0068855_1000086785 397
167 3300009147 Ga0114129_10004318 Ga0114129_1000431820 397
168 3300013104 Ga0157370_10017352 Ga0157370_100173522 397
169 3300013307 Ga0157372_10076190 Ga0157372_100761903 397
170 3300025949 Ga0207667_10017821 Ga0207667_100178213 397
171 3300044656 Ga0466969_0000272 Ga0466969_0000272_20559_21833 397
172 3300044673 Ga0453683_0000182 Ga0453683_0000182_34726_35982 397
173 3300045049 Ga0466959_0000035 Ga0466959_0000035_78311_79585 397
174 3300045051 Ga0451576_0000903 Ga0451576_0000903_50443_51699 397
175 3300049581 Ga0501047_0068952 Ga0501047_0068952_424_1638 397
176 3300049823 Ga0501044_0011426 Ga0501044_0011426_233_1447 397
177 3300050507 nmdc:mga05p37_16679_c1 nmdc:mga05p37_16679_c1_3112_4332 397
178 3300053086 Ga0500578_0000060 Ga0500578_0000060_66338_67558 397
179 3300005617 Ga0068859_100027302 Ga0068859_1000273027 398
180 3300005617 Ga0068859_100241745 Ga0068859_1002417452 398
181 3300006931 Ga0097620_100027302 Ga0097620_1000273023 398
182 3300006931 Ga0097620_100241720 Ga0097620_1002417202 398
183 3300009093 Ga0105240_10000020 Ga0105240_1000002051 398
184 3300009553 Ga0105249_10016050 Ga0105249_100160502 398
185 3300010375 Ga0105239_10001669 Ga0105239_1000166926 398
186 3300013306 Ga0163162_10002973 Ga0163162_100029732 398
187 3300013308 Ga0157375_10043231 Ga0157375_100432312 398
188 3300014325 Ga0163163_10000079 Ga0163163_100000797 398
189 3300025913 Ga0207695_10000020 Ga0207695_10000020475 398
190 3300025913 Ga0207695_10000087 Ga0207695_10000087217 398
191 3300025944 Ga0207661_10021321 Ga0207661_100213212 398
192 3300025949 Ga0207667_10000172 Ga0207667_1000017245 398
193 3300025961 Ga0207712_10067044 Ga0207712_100670442 398
194 3300031507 Ga0307509_10139961 Ga0307509_101399612 398
195 3300041997 Ga0439431_0000282 Ga0439431_0000282_7370_8665 398
196 3300046665 Ga0495661_0088926 Ga0495661_0088926_38_1249 398
197 3300049571 Ga0501034_0027449 Ga0501034_0027449_1038_2333 398
198 iso_pu_bacteria 2896109856 2896111231 398
199 3300005563 Ga0068855_100169287 Ga0068855_1001692872 399
200 3300005614 Ga0068856_100068196 Ga0068856_1000681962 399
201 3300005614 Ga0068856_100130771 Ga0068856_1001307712 399
202 3300021384 Ga0213876_10002719 Ga0213876_1000271910 399
203 3300026023 Ga0207677_10081277 Ga0207677_100812771 399
204 3300026078 Ga0207702_10043496 Ga0207702_100434962 399
205 3300039437 Ga0436365_1631164 Ga0436365_1631164_5327_6634 399
206 iso_pu_bacteria 2929239360 2929243553 399
207 3300041509 Ga0451843_0296757 Ga0451843_0296757_60_1292 400
208 3300044719 Ga0466971_0033649 Ga0466971_0033649_640_1971 400
209 3300044765 Ga0466970_0002424 Ga0466970_0002424_3701_5032 400
210 3300045049 Ga0466959_0009905 Ga0466959_0009905_1229_2560 400
211 3300045836 Ga0466958_0154483 Ga0466958_0154483_58_1389 400
212 3300053139 Ga0500568_0042620 Ga0500568_0042620_322_1686 400
213 3300048924 Ga0496121_0000011 Ga0496121_0000011_259059_260294 401
214 3300049571 Ga0501034_0018581 Ga0501034_0018581_3748_5076 401
215 3300049571 Ga0501034_0047160 Ga0501034_0047160_2934_4262 401
216 3300049823 Ga0501044_0033778 Ga0501044_0033778_3956_5284 401
217 3300005337 Ga0070682_100000037 Ga0070682_10000003737 402
218 3300006173 Ga0070716_100121930 Ga0070716_1001219301 402
219 3300033180 Ga0307510_10054168 Ga0307510_100541682 402
220 3300037471 Ga0395905_0000001 Ga0395905_0000001_1656362_1657759 402
221 3300044658 Ga0466972_0000002 Ga0466972_0000002_226447_227760 402
222 3300044712 Ga0453684_0152753 Ga0453684_0152753_1056_2288 402
223 3300044765 Ga0466970_0000187 Ga0466970_0000187_1866_3179 402
224 3300003322 rootL2_10015053 rootL2_1001505313 403
225 3300003323 rootH1_10005093 rootH1_100050936 403
226 3300003761 Ga0055535_1001063 Ga0055535_10010636 403
227 3300025242 Ga0209258_100081 Ga0209258_10008128 403
228 3300025254 Ga0209148_1000276 Ga0209148_100027628 403
229 3300046453 Ga0495627_013528 Ga0495627_013528_18_1265 403
230 3300046558 Ga0495633_0000485 Ga0495633_0000485_12480_13727 403
231 3300053093 Ga0500651_0063965 Ga0500651_0063965_720_1967 403
232 iso_pu_bacteria 2839989709 2839992342 403
233 3300003322 rootL2_10050879 rootL2_100508792 404
234 iso_pu_bacteria 2883068021 2883072123 404
235 3300006237 Ga0097621_100009031 Ga0097621_1000090316 405
236 3300006358 Ga0068871_100176570 Ga0068871_1001765701 405
237 3300013308 Ga0157375_10372292 Ga0157375_103722921 405
238 3300025986 Ga0207658_10110161 Ga0207658_101101612 405
239 3300049581 Ga0501047_0082362 Ga0501047_0082362_21_1406 405
240 iso_pu_bacteria 2896085136 2896089243 405
241 iso_pu_bacteria 2929921140 2929925712 405
242 iso_pu_bacteria 8003151029 8003153323 405
243 3300005337 Ga0070682_100074584 Ga0070682_1000745841 406
244 3300028794 Ga0307515_10000002 Ga0307515_10000002346 406
245 3300002738 JGI25154J39366_1000005 JGI25154J39366_100000512 410
246 3300003354 JGI25160J50197_1003915 JGI25160J50197_10039154 410
247 3300025246 Ga0209646_1000017 Ga0209646_1000017385 410
248 3300025302 Ga0207426_1000371 Ga0207426_100037130 410

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00270

DEAD

DEAD/DEAH box helicase

71

242

0.93

PF00271

Helicase_C

Helicase conserved C-terminal domain

275

385

0.89

PF04851

ResIII

Type III restriction enzyme, res subunit

68

237

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qde-assembly1.cif.gz_A crystal structure of the atpase domain of translation initiation factor 4a from saccharomyces cerevisiae-the prototype of the dead box protein family 0.9574 2 208
1fuu-assembly1.cif.gz_A yeast initiation factor 4a 0.9562 2 207
1qva-assembly1.cif.gz_A yeast initiation factor 4a n-terminal domain 0.9548 2 207
2hjv-assembly2.cif.gz_B structure of the second domain (residues 207-368) of the bacillus subtilis yxin protein 0.9536 219 370
3ber-assembly1.cif.gz_A human dead-box rna-helicase ddx47, conserved domain i in complex with amp 0.9497 1 211
ID Description Score Start End Superfamily
af_P0A8J8_218_381_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 218 368 3.40.50.300
af_P21693_212_383_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9627 218 374 3.40.50.300
af_Q5ACU6_326_519_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.958 217 375 3.40.50.300
af_Q0INC5_134_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9579 2 210 3.40.50.300
af_Q09719_34_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9573 3 210 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6G1E3H7-F1-model_v4 Helicase C-terminal domain-containing protein 0.9551 226 328 GO:0003723
GO:0004386
GO:0005634
GO:0016787
AF-A0A3M2UYA8-F1-model_v4 deleted 0.9478 182 351
AF-A0A1D1VTK7-F1-model_v4 RNA helicase (EC 3.6.4.13) 0.9426 2 366 GO:0003689
GO:0003723
GO:0003724
GO:0005524
GO:0005730
GO:0005829
GO:0016887
GO:0061775
GO:0140584
GO:0140665
GO:0140849
AF-A0A561JSR7-F1-model_v4 deleted 0.942 2 370
AF-U6K9J8-F1-model_v4 ATP-dependent RNA helicase, putative 0.9412 1 210 GO:0003723
GO:0003724
GO:0005524
GO:0005829
GO:0016787

Feature Viewer

pLDDT pTM Quality
84.45 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map