F360109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 248 | 148 | 248 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0047837|Ga0466972_0047837_1576_1956 |
| Length | 126 |
| Sequence | MLSAKYRFHGHGSLRYVYKNGQAVRSRLITIKHTSNPHRKVSRFSVVVSKKVHKSAVGRNRIRRRIYEIVRHEIPKMRGVHDVAIMVFSSEVITMPHEELQQTVLQLLDQAHLYPKEEKDGILKDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 30 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 34 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 48 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 81 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 82 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 83 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 84 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 85 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 86 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 87 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 88 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 89 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 90 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 91 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 92 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 95 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 96 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 97 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 98 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 99 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 100 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 101 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 102 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 103 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 104 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 105 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 106 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 107 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 108 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 109 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 110 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 111 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 118 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 123 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 124 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 125 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 126 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 127 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 128 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 129 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 130 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 131 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 132 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 133 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 134 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 135 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 136 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 137 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 138 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 139 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 140 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 141 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 142 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 143 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 144 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 145 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 146 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 147 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 148 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.42 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 69.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1005805 | 3300001904 | Bacteria | 2086 |
| 2 | JGI24740J21852_10028232 | 3300001979 | Bacteria | 1856 |
| 3 | JGI24739J22299_10000063 | 3300001989 | Bacteria | 29854 |
| 4 | JGI24739J22299_10037068 | 3300001989 | Bacteria | 1644 |
| 5 | JGI24737J22298_10000145 | 3300001990 | Bacteria | 22015 |
| 6 | JGI24743J22301_10003289 | 3300001991 | Unclassified | 2543 |
| 7 | JGI24735J21928_10000067 | 3300002067 | Bacteria | 42751 |
| 8 | JGI24738J21930_10000073 | 3300002075 | Bacteria | 21429 |
| 9 | rootH2_10004711 | 3300003320 | Bacteria | 129035 |
| 10 | rootH2_10231047 | 3300003320 | Unclassified | 2868 |
| 11 | rootL2_10212901 | 3300003322 | Bacteria | 2667 |
| 12 | rootL2_10283333 | 3300003322 | Unclassified | 1693 |
| 13 | rootH1_10021217 | 3300003323 | Bacteria | 85014 |
| 14 | rootH1_10103469 | 3300003323 | Bacteria | 10129 |
| 15 | Ga0070658_10000009 | 3300005327 | Bacteria | 319868 |
| 16 | Ga0070658_10709224 | 3300005327 | Bacteria | 873 |
| 17 | Ga0070680_100231373 | 3300005336 | Unclassified | 1561 |
| 18 | Ga0070660_100001123 | 3300005339 | Bacteria | 18053 |
| 19 | Ga0070660_100543711 | 3300005339 | Bacteria | 969 |
| 20 | Ga0070661_100023437 | 3300005344 | Bacteria | 4424 |
| 21 | Ga0070661_100618677 | 3300005344 | Bacteria | 877 |
| 22 | Ga0070675_100145257 | 3300005354 | Bacteria | 2030 |
| 23 | Ga0070659_100001064 | 3300005366 | Bacteria | 20072 |
| 24 | Ga0070662_100039453 | 3300005457 | Unclassified | 3358 |
| 25 | Ga0070662_101408827 | 3300005457 | Unclassified | 600 |
| 26 | Ga0070679_100097683 | 3300005530 | Bacteria | 2924 |
| 27 | Ga0070684_100374788 | 3300005535 | Bacteria | 1310 |
| 28 | Ga0068853_101400223 | 3300005539 | Unclassified | 676 |
| 29 | Ga0068855_100000017 | 3300005563 | Bacteria | 212278 |
| 30 | Ga0068855_100007452 | 3300005563 | Bacteria | 13252 |
| 31 | Ga0068855_100799868 | 3300005563 | Unclassified | 1002 |
| 32 | Ga0070664_100000338 | 3300005564 | Bacteria | 34161 |
| 33 | Ga0068857_100001672 | 3300005577 | Bacteria | 17821 |
| 34 | Ga0068854_100004390 | 3300005578 | Bacteria | 8897 |
| 35 | Ga0068856_100000060 | 3300005614 | Bacteria | 101415 |
| 36 | Ga0068856_100000117 | 3300005614 | Bacteria | 79068 |
| 37 | Ga0068856_100443079 | 3300005614 | Bacteria | 1319 |
| 38 | Ga0068856_101474926 | 3300005614 | Bacteria | 694 |
| 39 | Ga0068852_100045261 | 3300005616 | Unclassified | 3742 |
| 40 | Ga0068852_100084623 | 3300005616 | Bacteria | 2823 |
| 41 | Ga0081455_10000006 | 3300005937 | Bacteria | 323066 |
| 42 | Ga0075365_10000004 | 3300006038 | Bacteria | 144817 |
| 43 | Ga0075365_10000106 | 3300006038 | Bacteria | 24747 |
| 44 | Ga0075365_10004161 | 3300006038 | Bacteria | 7614 |
| 45 | Ga0075365_10044911 | 3300006038 | Bacteria | 2897 |
| 46 | Ga0075365_10156453 | 3300006038 | Bacteria | 1586 |
| 47 | Ga0075368_10005731 | 3300006042 | Bacteria | 4294 |
| 48 | Ga0075363_100015595 | 3300006048 | Bacteria | 3738 |
| 49 | Ga0075364_10011613 | 3300006051 | Bacteria | 5355 |
| 50 | Ga0075362_10012492 | 3300006177 | Bacteria | 3376 |
| 51 | Ga0075367_10003180 | 3300006178 | Bacteria | 7749 |
| 52 | Ga0075367_10257879 | 3300006178 | Unclassified | 1094 |
| 53 | Ga0075369_10000335 | 3300006186 | Bacteria | 14037 |
| 54 | Ga0075366_10001364 | 3300006195 | Bacteria | 12202 |
| 55 | Ga0075366_10004907 | 3300006195 | Bacteria | 7217 |
| 56 | Ga0075366_10080593 | 3300006195 | Bacteria | 1944 |
| 57 | Ga0075366_10518650 | 3300006195 | Bacteria | 737 |
| 58 | Ga0097621_100666898 | 3300006237 | Bacteria | 955 |
| 59 | Ga0075370_10151733 | 3300006353 | Unclassified | 1358 |
| 60 | Ga0075370_10322338 | 3300006353 | Unclassified | 920 |
| 61 | Ga0075370_10335679 | 3300006353 | Unclassified | 902 |
| 62 | Ga0068871_100142625 | 3300006358 | Bacteria | 2038 |
| 63 | Ga0075428_100183960 | 3300006844 | Bacteria | 2261 |
| 64 | Ga0068865_100000969 | 3300006881 | Bacteria | 16387 |
| 65 | Ga0105240_10000030 | 3300009093 | Bacteria | 321312 |
| 66 | Ga0105240_10003612 | 3300009093 | Bacteria | 23956 |
| 67 | Ga0105240_10915364 | 3300009093 | Bacteria | 942 |
| 68 | Ga0105245_10124226 | 3300009098 | Bacteria | 2414 |
| 69 | Ga0105241_10803539 | 3300009174 | Bacteria | 867 |
| 70 | Ga0105241_10989316 | 3300009174 | Bacteria | 786 |
| 71 | Ga0105241_11315789 | 3300009174 | Unclassified | 689 |
| 72 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 73 | Ga0105238_10562192 | 3300009551 | Bacteria | 1146 |
| 74 | Ga0105249_13455568 | 3300009553 | Unclassified | 508 |
| 75 | Ga0105032_100002 | 3300009979 | Bacteria | 303884 |
| 76 | Ga0105032_100010 | 3300009979 | Bacteria | 81059 |
| 77 | Ga0105029_102216 | 3300009984 | Bacteria | 1256 |
| 78 | Ga0105029_119864 | 3300009984 | Unclassified | 558 |
| 79 | Ga0105239_10002161 | 3300010375 | Bacteria | 25290 |
| 80 | Ga0105246_10003793 | 3300011119 | Bacteria | 9154 |
| 81 | Ga0105246_10519101 | 3300011119 | Bacteria | 1015 |
| 82 | Ga0105246_10823925 | 3300011119 | Unclassified | 825 |
| 83 | Ga0157373_10006025 | 3300013100 | Bacteria | 9067 |
| 84 | Ga0157373_10012732 | 3300013100 | Bacteria | 6181 |
| 85 | Ga0157373_10404148 | 3300013100 | Unclassified | 979 |
| 86 | Ga0157373_10974507 | 3300013100 | Unclassified | 632 |
| 87 | Ga0157371_10035325 | 3300013102 | Bacteria | 3582 |
| 88 | Ga0157371_10077373 | 3300013102 | Bacteria | 2355 |
| 89 | Ga0157370_10000812 | 3300013104 | Bacteria | 39488 |
| 90 | Ga0157370_10000984 | 3300013104 | Bacteria | 36041 |
| 91 | Ga0157370_10048283 | 3300013104 | Bacteria | 4078 |
| 92 | Ga0157370_10154312 | 3300013104 | Bacteria | 2136 |
| 93 | Ga0157369_10000003 | 3300013105 | Bacteria | 507337 |
| 94 | Ga0157369_10000026 | 3300013105 | Bacteria | 216023 |
| 95 | Ga0157369_10000199 | 3300013105 | Bacteria | 83451 |
| 96 | Ga0157369_10023455 | 3300013105 | Bacteria | 6872 |
| 97 | Ga0157369_10058495 | 3300013105 | Bacteria | 4158 |
| 98 | Ga0157369_10083971 | 3300013105 | Bacteria | 3405 |
| 99 | Ga0157374_10116961 | 3300013296 | Bacteria | 2569 |
| 100 | Ga0157374_11064371 | 3300013296 | Bacteria | 829 |
| 101 | Ga0157372_10000007 | 3300013307 | Bacteria | 340690 |
| 102 | Ga0157372_10000027 | 3300013307 | Bacteria | 186906 |
| 103 | Ga0157372_10071168 | 3300013307 | Bacteria | 3916 |
| 104 | Ga0157372_10093755 | 3300013307 | Bacteria | 3417 |
| 105 | Ga0157377_10000264 | 3300014745 | Bacteria | 25782 |
| 106 | Ga0157376_10000054 | 3300014969 | Bacteria | 99154 |
| 107 | Ga0157376_10010602 | 3300014969 | Bacteria | 6749 |
| 108 | Ga0207688_10014552 | 3300025901 | Unclassified | 4274 |
| 109 | Ga0207647_10000177 | 3300025904 | Bacteria | 51270 |
| 110 | Ga0207705_10000010 | 3300025909 | Bacteria | 518023 |
| 111 | Ga0207654_10026476 | 3300025911 | Bacteria | 3140 |
| 112 | Ga0207654_10780925 | 3300025911 | Unclassified | 689 |
| 113 | Ga0207654_11202305 | 3300025911 | Bacteria | 552 |
| 114 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 115 | Ga0207695_10003061 | 3300025913 | Bacteria | 23962 |
| 116 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 117 | Ga0207657_10002733 | 3300025919 | Bacteria | 18998 |
| 118 | Ga0207657_10003013 | 3300025919 | Bacteria | 18055 |
| 119 | Ga0207649_10032594 | 3300025920 | Bacteria | 3108 |
| 120 | Ga0207652_10933743 | 3300025921 | Unclassified | 765 |
| 121 | Ga0207690_10012004 | 3300025932 | Bacteria | 5181 |
| 122 | Ga0207690_10013713 | 3300025932 | Bacteria | 4878 |
| 123 | Ga0207706_10000004 | 3300025933 | Bacteria | 280765 |
| 124 | Ga0207704_10001729 | 3300025938 | Bacteria | 9776 |
| 125 | Ga0207661_10046264 | 3300025944 | Unclassified | 3450 |
| 126 | Ga0207661_10581165 | 3300025944 | Bacteria | 1027 |
| 127 | Ga0207679_10000069 | 3300025945 | Bacteria | 93919 |
| 128 | Ga0207667_10000048 | 3300025949 | Bacteria | 238293 |
| 129 | Ga0207667_10004604 | 3300025949 | Bacteria | 16915 |
| 130 | Ga0207667_11815170 | 3300025949 | Unclassified | 574 |
| 131 | Ga0207640_10006327 | 3300025981 | Bacteria | 6494 |
| 132 | Ga0207639_11357209 | 3300026041 | Unclassified | 667 |
| 133 | Ga0207702_10000097 | 3300026078 | Bacteria | 101497 |
| 134 | Ga0207702_10000271 | 3300026078 | Bacteria | 59575 |
| 135 | Ga0207702_10191784 | 3300026078 | Bacteria | 1889 |
| 136 | Ga0207702_11643376 | 3300026078 | Bacteria | 635 |
| 137 | Ga0207674_10000667 | 3300026116 | Bacteria | 44679 |
| 138 | Ga0207698_10000107 | 3300026142 | Bacteria | 52384 |
| 139 | Ga0207698_10065194 | 3300026142 | Bacteria | 2859 |
| 140 | Ga0209813_10001109 | 3300027866 | Bacteria | 6014 |
| 141 | Ga0316177_1020215 | 3300030731 | Bacteria | 811 |
| 142 | Ga0314311_1169809 | 3300030733 | Bacteria | 4227 |
| 143 | Ga0316179_1072927 | 3300030734 | Bacteria | 8292 |
| 144 | Ga0316180_1165797 | 3300030736 | Bacteria | 3820 |
| 145 | Ga0316183_1037085 | 3300030742 | Bacteria | 2830 |
| 146 | Ga0316183_1135303 | 3300030742 | Bacteria | 739 |
| 147 | Ga0316183_1185963 | 3300030742 | Bacteria | 1540 |
| 148 | Ga0316183_1187333 | 3300030742 | Bacteria | 18619 |
| 149 | Ga0316181_1072339 | 3300030744 | Unclassified | 755 |
| 150 | Ga0316181_1212132 | 3300030744 | Unclassified | 781 |
| 151 | Ga0316181_1226594 | 3300030744 | Bacteria | 25946 |
| 152 | Ga0316182_1038782 | 3300030745 | Bacteria | 5372 |
| 153 | Ga0316182_1039584 | 3300030745 | Bacteria | 7468 |
| 154 | Ga0316182_1078268 | 3300030745 | Bacteria | 1381 |
| 155 | Ga0316182_1100023 | 3300030745 | Bacteria | 663 |
| 156 | Ga0316182_1185273 | 3300030745 | Bacteria | 13671 |
| 157 | Ga0316182_1376285 | 3300030745 | Bacteria | 16690 |
| 158 | Ga0307516_10007258 | 3300031730 | Bacteria | 12764 |
| 159 | Ga0307405_10064315 | 3300031731 | Bacteria | 2331 |
| 160 | Ga0307412_10011652 | 3300031911 | Bacteria | 5100 |
| 161 | Ga0395899_0009895 | 3300037312 | Bacteria | 7311 |
| 162 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 163 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 164 | Ga0395901_0000006 | 3300038443 | Bacteria | 514112 |
| 165 | Ga0439447_005497 | 3300041407 | Bacteria | 4206 |
| 166 | Ga0439461_0000070 | 3300041410 | Bacteria | 13169 |
| 167 | Ga0439461_0000652 | 3300041410 | Bacteria | 5006 |
| 168 | Ga0439466_0069867 | 3300041411 | Bacteria | 1120 |
| 169 | Ga0439442_031833 | 3300042002 | Bacteria | 1102 |
| 170 | Ga0439442_068827 | 3300042002 | Bacteria | 753 |
| 171 | Ga0439445_0001134 | 3300042004 | Bacteria | 5705 |
| 172 | Ga0439432_005224 | 3300042006 | Bacteria | 4688 |
| 173 | Ga0439432_082656 | 3300042006 | Bacteria | 972 |
| 174 | Ga0439463_002381 | 3300042016 | Bacteria | 4792 |
| 175 | Ga0439463_051001 | 3300042016 | Bacteria | 1055 |
| 176 | Ga0450919_007288 | 3300042121 | Bacteria | 1294 |
| 177 | Ga0450920_001940 | 3300042122 | Bacteria | 3480 |
| 178 | Ga0450903_031224 | 3300042138 | Bacteria | 803 |
| 179 | Ga0450906_005836 | 3300042145 | Bacteria | 2512 |
| 180 | Ga0439446_0000002 | 3300042156 | Bacteria | 177065 |
| 181 | Ga0439446_0002594 | 3300042156 | Bacteria | 4358 |
| 182 | Ga0450909_003971 | 3300042185 | Bacteria | 2107 |
| 183 | Ga0439434_0001460 | 3300042435 | Bacteria | 6792 |
| 184 | Ga0439434_0005759 | 3300042435 | Bacteria | 3616 |
| 185 | Ga0439434_0099465 | 3300042435 | Bacteria | 936 |
| 186 | Ga0439464_0000042 | 3300042439 | Bacteria | 16260 |
| 187 | Ga0450918_009327 | 3300042531 | Unclassified | 1722 |
| 188 | Ga0466972_0047837 | 3300044658 | Bacteria | 2067 |
| 189 | Ga0466965_0000077 | 3300044683 | Bacteria | 28675 |
| 190 | Ga0466960_0158444 | 3300044901 | Unclassified | 1214 |
| 191 | Ga0495638_0000285 | 3300046460 | Bacteria | 67536 |
| 192 | Ga0495597_0044645 | 3300046542 | Bacteria | 1970 |
| 193 | Ga0495671_0032804 | 3300046692 | Bacteria | 2649 |
| 194 | Ga0495660_0000005 | 3300046810 | Bacteria | 574567 |
| 195 | Ga0496113_1308866 | 3300048916 | Unclassified | 563 |
| 196 | Ga0501034_0000170 | 3300049571 | Bacteria | 120823 |
| 197 | Ga0501034_0023419 | 3300049571 | Bacteria | 6292 |
| 198 | Ga0501037_0000011 | 3300049573 | Bacteria | 196525 |
| 199 | Ga0501038_0027298 | 3300049574 | Bacteria | 5081 |
| 200 | Ga0501044_1325393 | 3300049823 | Bacteria | 586 |
| 201 | nmdc:mga03683_8268_c1 | 3300050489 | Bacteria | 3651 |
| 202 | nmdc:mga03n38_57688_c1 | 3300050490 | Bacteria | 1756 |
| 203 | nmdc:mga00v17_25452_c1 | 3300050491 | Bacteria | 3440 |
| 204 | nmdc:mga00v17_29607_c1 | 3300050491 | Bacteria | 3215 |
| 205 | nmdc:mga0yw44_110663_c1 | 3300050492 | Unclassified | 1759 |
| 206 | nmdc:mga0yw44_11_c1 | 3300050492 | Bacteria | 130624 |
| 207 | nmdc:mga0yw44_127695_c1 | 3300050492 | Bacteria | 1643 |
| 208 | nmdc:mga0yw44_35315_c1 | 3300050492 | Unclassified | 2937 |
| 209 | nmdc:mga0yw44_5_c1 | 3300050492 | Bacteria | 313167 |
| 210 | nmdc:mga0yw44_82_c2 | 3300050492 | Bacteria | 32345 |
| 211 | nmdc:mga0k408_1863_c2 | 3300050493 | Bacteria | 10923 |
| 212 | nmdc:mga0k408_1914_c1 | 3300050493 | Bacteria | 11140 |
| 213 | nmdc:mga0k408_567292_c1 | 3300050493 | Bacteria | 670 |
| 214 | nmdc:mga0k408_772152_c1 | 3300050493 | Unclassified | 561 |
| 215 | nmdc:mga06z11_208344_c1 | 3300050494 | Unclassified | 1138 |
| 216 | nmdc:mga06z11_321_c1 | 3300050494 | Bacteria | 18195 |
| 217 | nmdc:mga04h51_1053_c1 | 3300050495 | Bacteria | 6340 |
| 218 | nmdc:mga07m45_140972_c1 | 3300050496 | Unclassified | 1396 |
| 219 | nmdc:mga07m45_163375_c1 | 3300050496 | Unclassified | 1293 |
| 220 | nmdc:mga07m45_20177_c1 | 3300050496 | Bacteria | 1979 |
| 221 | nmdc:mga07m45_40692_c1 | 3300050496 | Bacteria | 2601 |
| 222 | nmdc:mga07m45_468600_c1 | 3300050496 | Unclassified | 730 |
| 223 | Ga0500643_003279 | 3300053087 | Bacteria | 7872 |
| 224 | Ga0500644_0015554 | 3300053088 | Bacteria | 2173 |
| 225 | Ga0500646_0000002 | 3300053090 | Bacteria | 178770 |
| 226 | Ga0500583_0000167 | 3300053092 | Bacteria | 27217 |
| 227 | Ga0500651_0000021 | 3300053093 | Bacteria | 137927 |
| 228 | Ga0500641_0000001 | 3300053096 | Bacteria | 1115973 |
| 229 | Ga0500650_0034447 | 3300053098 | Bacteria | 2314 |
| 230 | Ga0500555_000023 | 3300053103 | Bacteria | 150521 |
| 231 | Ga0500569_000009 | 3300053109 | Bacteria | 67536 |
| 232 | Ga0500569_149067 | 3300053109 | Unclassified | 789 |
| 233 | Ga0500593_159971 | 3300053117 | Unclassified | 862 |
| 234 | Ga0500594_0000008 | 3300053118 | Bacteria | 102101 |
| 235 | Ga0500652_000001 | 3300053131 | Bacteria | 946868 |
| 236 | Ga0500652_148010 | 3300053131 | Bacteria | 975 |
| 237 | Ga0500577_0003634 | 3300053142 | Bacteria | 4017 |
| 238 | Ga0500577_0121360 | 3300053142 | Bacteria | 1088 |
| 239 | Ga0500588_0000078 | 3300053146 | Bacteria | 13106 |
| 240 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
| 241 | Ga0500616_0015088 | 3300053153 | Unclassified | 4427 |
| 242 | Ga0500616_0069294 | 3300053153 | Unclassified | 1804 |
| 243 | Ga0500620_003540 | 3300053155 | Bacteria | 3353 |
| 244 | Ga0500620_046355 | 3300053155 | Unclassified | 1444 |
| 245 | Ga0500570_117357 | 3300053724 | Unclassified | 1057 |
| 246 | Ga0500570_164228 | 3300053724 | Bacteria | 757 |
| 247 | Ga0500656_016332 | 3300053732 | Bacteria | 878 |
| 248 | Ga0500613_031923 | 3300053738 | Unclassified | 760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001989 | JGI24739J22299_10037068 | JGI24739J22299_100370682 | 115 |
| 2 | 3300003320 | rootH2_10004711 | rootH2_10004711100 | 115 |
| 3 | 3300003323 | rootH1_10021217 | rootH1_1002121730 | 115 |
| 4 | 3300005327 | Ga0070658_10709224 | Ga0070658_107092241 | 115 |
| 5 | 3300005336 | Ga0070680_100231373 | Ga0070680_1002313732 | 115 |
| 6 | 3300005339 | Ga0070660_100001123 | Ga0070660_1000011236 | 115 |
| 7 | 3300005339 | Ga0070660_100543711 | Ga0070660_1005437112 | 115 |
| 8 | 3300005530 | Ga0070679_100097683 | Ga0070679_1000976832 | 115 |
| 9 | 3300005539 | Ga0068853_101400223 | Ga0068853_1014002231 | 115 |
| 10 | 3300005563 | Ga0068855_100000017 | Ga0068855_10000001785 | 115 |
| 11 | 3300005563 | Ga0068855_100007452 | Ga0068855_10000745210 | 115 |
| 12 | 3300005563 | Ga0068855_100799868 | Ga0068855_1007998682 | 115 |
| 13 | 3300005578 | Ga0068854_100004390 | Ga0068854_1000043908 | 115 |
| 14 | 3300005614 | Ga0068856_100443079 | Ga0068856_1004430792 | 115 |
| 15 | 3300005614 | Ga0068856_101474926 | Ga0068856_1014749262 | 115 |
| 16 | 3300005616 | Ga0068852_100084623 | Ga0068852_1000846233 | 115 |
| 17 | 3300005937 | Ga0081455_10000006 | Ga0081455_10000006372 | 115 |
| 18 | 3300006038 | Ga0075365_10000106 | Ga0075365_1000010616 | 115 |
| 19 | 3300006038 | Ga0075365_10004161 | Ga0075365_1000416110 | 115 |
| 20 | 3300006038 | Ga0075365_10044911 | Ga0075365_100449114 | 115 |
| 21 | 3300006038 | Ga0075365_10156453 | Ga0075365_101564532 | 115 |
| 22 | 3300006042 | Ga0075368_10005731 | Ga0075368_100057312 | 115 |
| 23 | 3300006048 | Ga0075363_100015595 | Ga0075363_1000155954 | 115 |
| 24 | 3300006177 | Ga0075362_10012492 | Ga0075362_100124924 | 115 |
| 25 | 3300006178 | Ga0075367_10003180 | Ga0075367_100031806 | 115 |
| 26 | 3300006186 | Ga0075369_10000335 | Ga0075369_100003356 | 115 |
| 27 | 3300006195 | Ga0075366_10004907 | Ga0075366_100049075 | 115 |
| 28 | 3300006195 | Ga0075366_10080593 | Ga0075366_100805932 | 115 |
| 29 | 3300006195 | Ga0075366_10518650 | Ga0075366_105186501 | 115 |
| 30 | 3300006353 | Ga0075370_10151733 | Ga0075370_101517332 | 115 |
| 31 | 3300006353 | Ga0075370_10322338 | Ga0075370_103223382 | 115 |
| 32 | 3300006844 | Ga0075428_100183960 | Ga0075428_1001839603 | 115 |
| 33 | 3300009093 | Ga0105240_10000030 | Ga0105240_10000030218 | 115 |
| 34 | 3300009093 | Ga0105240_10003612 | Ga0105240_1000361212 | 115 |
| 35 | 3300009093 | Ga0105240_10915364 | Ga0105240_109153641 | 115 |
| 36 | 3300009174 | Ga0105241_10989316 | Ga0105241_109893162 | 115 |
| 37 | 3300009545 | Ga0105237_10000001 | Ga0105237_10000001157 | 115 |
| 38 | 3300009551 | Ga0105238_10562192 | Ga0105238_105621922 | 115 |
| 39 | 3300009979 | Ga0105032_100002 | Ga0105032_100002229 | 115 |
| 40 | 3300009979 | Ga0105032_100010 | Ga0105032_10001089 | 115 |
| 41 | 3300009984 | Ga0105029_102216 | Ga0105029_1022161 | 115 |
| 42 | 3300009984 | Ga0105029_119864 | Ga0105029_1198641 | 115 |
| 43 | 3300013100 | Ga0157373_10974507 | Ga0157373_109745071 | 115 |
| 44 | 3300013102 | Ga0157371_10035325 | Ga0157371_100353253 | 115 |
| 45 | 3300013104 | Ga0157370_10000812 | Ga0157370_1000081227 | 115 |
| 46 | 3300013104 | Ga0157370_10048283 | Ga0157370_100482832 | 115 |
| 47 | 3300013105 | Ga0157369_10000003 | Ga0157369_10000003148 | 115 |
| 48 | 3300013105 | Ga0157369_10000199 | Ga0157369_1000019984 | 115 |
| 49 | 3300013105 | Ga0157369_10058495 | Ga0157369_100584954 | 115 |
| 50 | 3300013105 | Ga0157369_10083971 | Ga0157369_100839713 | 115 |
| 51 | 3300013296 | Ga0157374_11064371 | Ga0157374_110643712 | 115 |
| 52 | 3300013307 | Ga0157372_10000007 | Ga0157372_10000007157 | 115 |
| 53 | 3300013307 | Ga0157372_10071168 | Ga0157372_100711683 | 115 |
| 54 | 3300025911 | Ga0207654_11202305 | Ga0207654_112023051 | 115 |
| 55 | 3300025913 | Ga0207695_10000009 | Ga0207695_10000009158 | 115 |
| 56 | 3300025913 | Ga0207695_10003061 | Ga0207695_1000306112 | 115 |
| 57 | 3300025914 | Ga0207671_10000003 | Ga0207671_10000003158 | 115 |
| 58 | 3300025919 | Ga0207657_10003013 | Ga0207657_1000301312 | 115 |
| 59 | 3300025921 | Ga0207652_10933743 | Ga0207652_109337431 | 115 |
| 60 | 3300025949 | Ga0207667_10000048 | Ga0207667_1000004884 | 115 |
| 61 | 3300025949 | Ga0207667_10004604 | Ga0207667_100046049 | 115 |
| 62 | 3300025949 | Ga0207667_11815170 | Ga0207667_118151701 | 115 |
| 63 | 3300025981 | Ga0207640_10006327 | Ga0207640_100063275 | 115 |
| 64 | 3300026041 | Ga0207639_11357209 | Ga0207639_113572092 | 115 |
| 65 | 3300026078 | Ga0207702_10191784 | Ga0207702_101917842 | 115 |
| 66 | 3300026078 | Ga0207702_11643376 | Ga0207702_116433761 | 115 |
| 67 | 3300026142 | Ga0207698_10065194 | Ga0207698_100651944 | 115 |
| 68 | 3300027866 | Ga0209813_10001109 | Ga0209813_100011097 | 115 |
| 69 | 3300030731 | Ga0316177_1020215 | Ga0316177_10202151 | 115 |
| 70 | 3300030733 | Ga0314311_1169809 | Ga0314311_11698095 | 115 |
| 71 | 3300030734 | Ga0316179_1072927 | Ga0316179_10729279 | 115 |
| 72 | 3300030736 | Ga0316180_1165797 | Ga0316180_11657972 | 115 |
| 73 | 3300030742 | Ga0316183_1037085 | Ga0316183_10370852 | 115 |
| 74 | 3300030742 | Ga0316183_1135303 | Ga0316183_11353031 | 115 |
| 75 | 3300030742 | Ga0316183_1187333 | Ga0316183_11873332 | 115 |
| 76 | 3300030744 | Ga0316181_1072339 | Ga0316181_10723392 | 115 |
| 77 | 3300030744 | Ga0316181_1212132 | Ga0316181_12121321 | 115 |
| 78 | 3300030744 | Ga0316181_1226594 | Ga0316181_122659426 | 115 |
| 79 | 3300030745 | Ga0316182_1038782 | Ga0316182_10387822 | 115 |
| 80 | 3300030745 | Ga0316182_1039584 | Ga0316182_10395846 | 115 |
| 81 | 3300030745 | Ga0316182_1078268 | Ga0316182_10782682 | 115 |
| 82 | 3300030745 | Ga0316182_1185273 | Ga0316182_118527312 | 115 |
| 83 | 3300030745 | Ga0316182_1376285 | Ga0316182_137628517 | 115 |
| 84 | 3300031730 | Ga0307516_10007258 | Ga0307516_100072587 | 115 |
| 85 | 3300041410 | Ga0439461_0000070 | Ga0439461_0000070_5825_6172 | 115 |
| 86 | 3300042002 | Ga0439442_068827 | Ga0439442_068827_115_462 | 115 |
| 87 | 3300042004 | Ga0439445_0001134 | Ga0439445_0001134_2991_3338 | 115 |
| 88 | 3300042006 | Ga0439432_005224 | Ga0439432_005224_2665_3012 | 115 |
| 89 | 3300042016 | Ga0439463_051001 | Ga0439463_051001_580_927 | 115 |
| 90 | 3300042121 | Ga0450919_007288 | Ga0450919_007288_408_755 | 115 |
| 91 | 3300042122 | Ga0450920_001940 | Ga0450920_001940_1962_2309 | 115 |
| 92 | 3300042138 | Ga0450903_031224 | Ga0450903_031224_445_792 | 115 |
| 93 | 3300042145 | Ga0450906_005836 | Ga0450906_005836_904_1251 | 115 |
| 94 | 3300042156 | Ga0439446_0000002 | Ga0439446_0000002_154562_154909 | 115 |
| 95 | 3300042185 | Ga0450909_003971 | Ga0450909_003971_412_759 | 115 |
| 96 | 3300042435 | Ga0439434_0005759 | Ga0439434_0005759_2899_3246 | 115 |
| 97 | 3300042435 | Ga0439434_0099465 | Ga0439434_0099465_60_407 | 115 |
| 98 | 3300042531 | Ga0450918_009327 | Ga0450918_009327_266_613 | 115 |
| 99 | 3300049571 | Ga0501034_0023419 | Ga0501034_0023419_2150_2497 | 115 |
| 100 | 3300049823 | Ga0501044_1325393 | Ga0501044_1325393_50_397 | 115 |
| 101 | 3300050489 | nmdc:mga03683_8268_c1 | nmdc:mga03683_8268_c1_445_792 | 115 |
| 102 | 3300050490 | nmdc:mga03n38_57688_c1 | nmdc:mga03n38_57688_c1_1246_1593 | 115 |
| 103 | 3300050491 | nmdc:mga00v17_29607_c1 | nmdc:mga00v17_29607_c1_959_1306 | 115 |
| 104 | 3300050492 | nmdc:mga0yw44_110663_c1 | nmdc:mga0yw44_110663_c1_423_770 | 115 |
| 105 | 3300050492 | nmdc:mga0yw44_11_c1 | nmdc:mga0yw44_11_c1_6939_7286 | 115 |
| 106 | 3300050492 | nmdc:mga0yw44_127695_c1 | nmdc:mga0yw44_127695_c1_467_814 | 115 |
| 107 | 3300050492 | nmdc:mga0yw44_35315_c1 | nmdc:mga0yw44_35315_c1_843_1190 | 115 |
| 108 | 3300050492 | nmdc:mga0yw44_82_c2 | nmdc:mga0yw44_82_c2_7592_7939 | 115 |
| 109 | 3300050493 | nmdc:mga0k408_1914_c1 | nmdc:mga0k408_1914_c1_5601_5948 | 115 |
| 110 | 3300050493 | nmdc:mga0k408_567292_c1 | nmdc:mga0k408_567292_c1_61_408 | 115 |
| 111 | 3300050493 | nmdc:mga0k408_772152_c1 | nmdc:mga0k408_772152_c1_156_503 | 115 |
| 112 | 3300050494 | nmdc:mga06z11_321_c1 | nmdc:mga06z11_321_c1_6778_7125 | 115 |
| 113 | 3300050495 | nmdc:mga04h51_1053_c1 | nmdc:mga04h51_1053_c1_3569_3916 | 115 |
| 114 | 3300050496 | nmdc:mga07m45_20177_c1 | nmdc:mga07m45_20177_c1_1488_1835 | 115 |
| 115 | 3300050496 | nmdc:mga07m45_40692_c1 | nmdc:mga07m45_40692_c1_1724_2071 | 115 |
| 116 | 3300050496 | nmdc:mga07m45_468600_c1 | nmdc:mga07m45_468600_c1_126_473 | 115 |
| 117 | 3300053088 | Ga0500644_0015554 | Ga0500644_0015554_184_531 | 115 |
| 118 | 3300053093 | Ga0500651_0000021 | Ga0500651_0000021_82049_82396 | 115 |
| 119 | 3300053109 | Ga0500569_149067 | Ga0500569_149067_240_587 | 115 |
| 120 | 3300053117 | Ga0500593_159971 | Ga0500593_159971_55_402 | 115 |
| 121 | 3300053118 | Ga0500594_0000008 | Ga0500594_0000008_55532_55879 | 115 |
| 122 | 3300053131 | Ga0500652_148010 | Ga0500652_148010_147_494 | 115 |
| 123 | 3300053142 | Ga0500577_0121360 | Ga0500577_0121360_655_1002 | 115 |
| 124 | 3300053153 | Ga0500616_0000012 | Ga0500616_0000012_77505_77852 | 115 |
| 125 | 3300053153 | Ga0500616_0015088 | Ga0500616_0015088_3497_3844 | 115 |
| 126 | 3300053153 | Ga0500616_0069294 | Ga0500616_0069294_1411_1758 | 115 |
| 127 | 3300053724 | Ga0500570_117357 | Ga0500570_117357_79_426 | 115 |
| 128 | 3300053724 | Ga0500570_164228 | Ga0500570_164228_19_366 | 115 |
| 129 | 3300053732 | Ga0500656_016332 | Ga0500656_016332_339_686 | 115 |
| 130 | 3300053738 | Ga0500613_031923 | Ga0500613_031923_22_369 | 115 |
| 131 | 3300003322 | rootL2_10283333 | rootL2_102833333 | 116 |
| 132 | 3300005564 | Ga0070664_100000338 | Ga0070664_10000033813 | 116 |
| 133 | 3300006881 | Ga0068865_100000969 | Ga0068865_10000096911 | 116 |
| 134 | 3300009553 | Ga0105249_13455568 | Ga0105249_134555681 | 116 |
| 135 | 3300011119 | Ga0105246_10519101 | Ga0105246_105191011 | 116 |
| 136 | 3300013100 | Ga0157373_10404148 | Ga0157373_104041482 | 116 |
| 137 | 3300025920 | Ga0207649_10032594 | Ga0207649_100325943 | 116 |
| 138 | 3300025932 | Ga0207690_10013713 | Ga0207690_100137135 | 116 |
| 139 | 3300025938 | Ga0207704_10001729 | Ga0207704_100017297 | 116 |
| 140 | 3300025945 | Ga0207679_10000069 | Ga0207679_1000006921 | 116 |
| 141 | 3300030742 | Ga0316183_1185963 | Ga0316183_11859632 | 116 |
| 142 | 3300030745 | Ga0316182_1100023 | Ga0316182_11000232 | 116 |
| 143 | 3300041407 | Ga0439447_005497 | Ga0439447_005497_2338_2688 | 116 |
| 144 | 3300041410 | Ga0439461_0000652 | Ga0439461_0000652_1625_1975 | 116 |
| 145 | 3300041411 | Ga0439466_0069867 | Ga0439466_0069867_68_418 | 116 |
| 146 | 3300042002 | Ga0439442_031833 | Ga0439442_031833_73_423 | 116 |
| 147 | 3300042006 | Ga0439432_082656 | Ga0439432_082656_35_385 | 116 |
| 148 | 3300042156 | Ga0439446_0002594 | Ga0439446_0002594_570_920 | 116 |
| 149 | 3300042435 | Ga0439434_0001460 | Ga0439434_0001460_1977_2327 | 116 |
| 150 | 3300044901 | Ga0466960_0158444 | Ga0466960_0158444_634_1011 | 116 |
| 151 | 3300046692 | Ga0495671_0032804 | Ga0495671_0032804_1483_1833 | 116 |
| 152 | 3300046810 | Ga0495660_0000005 | Ga0495660_0000005_512520_512870 | 116 |
| 153 | 3300049571 | Ga0501034_0000170 | Ga0501034_0000170_74284_74634 | 116 |
| 154 | 3300049573 | Ga0501037_0000011 | Ga0501037_0000011_66902_67252 | 116 |
| 155 | 3300049574 | Ga0501038_0027298 | Ga0501038_0027298_2941_3291 | 116 |
| 156 | 3300050496 | nmdc:mga07m45_163375_c1 | nmdc:mga07m45_163375_c1_431_781 | 116 |
| 157 | 3300053090 | Ga0500646_0000002 | Ga0500646_0000002_54188_54538 | 116 |
| 158 | 3300053092 | Ga0500583_0000167 | Ga0500583_0000167_10997_11347 | 116 |
| 159 | 3300053096 | Ga0500641_0000001 | Ga0500641_0000001_810856_811206 | 116 |
| 160 | 3300053098 | Ga0500650_0034447 | Ga0500650_0034447_288_638 | 116 |
| 161 | 3300053131 | Ga0500652_000001 | Ga0500652_000001_670392_670742 | 116 |
| 162 | 3300053155 | Ga0500620_003540 | Ga0500620_003540_994_1344 | 116 |
| 163 | 3300005577 | Ga0068857_100001672 | Ga0068857_10000167219 | 117 |
| 164 | 3300005614 | Ga0068856_100000060 | Ga0068856_10000006025 | 117 |
| 165 | 3300005614 | Ga0068856_100000117 | Ga0068856_10000011761 | 117 |
| 166 | 3300006038 | Ga0075365_10000004 | Ga0075365_1000000462 | 117 |
| 167 | 3300006195 | Ga0075366_10001364 | Ga0075366_1000136413 | 117 |
| 168 | 3300006353 | Ga0075370_10335679 | Ga0075370_103356792 | 117 |
| 169 | 3300009098 | Ga0105245_10124226 | Ga0105245_101242261 | 117 |
| 170 | 3300009174 | Ga0105241_10803539 | Ga0105241_108035391 | 117 |
| 171 | 3300009174 | Ga0105241_11315789 | Ga0105241_113157891 | 117 |
| 172 | 3300010375 | Ga0105239_10002161 | Ga0105239_1000216118 | 117 |
| 173 | 3300011119 | Ga0105246_10003793 | Ga0105246_100037931 | 117 |
| 174 | 3300011119 | Ga0105246_10823925 | Ga0105246_108239252 | 117 |
| 175 | 3300013100 | Ga0157373_10006025 | Ga0157373_100060251 | 117 |
| 176 | 3300013100 | Ga0157373_10012732 | Ga0157373_100127322 | 117 |
| 177 | 3300013102 | Ga0157371_10077373 | Ga0157371_100773733 | 117 |
| 178 | 3300013104 | Ga0157370_10000984 | Ga0157370_100009842 | 117 |
| 179 | 3300013104 | Ga0157370_10154312 | Ga0157370_101543121 | 117 |
| 180 | 3300013105 | Ga0157369_10000026 | Ga0157369_10000026251 | 117 |
| 181 | 3300013105 | Ga0157369_10023455 | Ga0157369_100234551 | 117 |
| 182 | 3300013296 | Ga0157374_10116961 | Ga0157374_101169613 | 117 |
| 183 | 3300013307 | Ga0157372_10000027 | Ga0157372_10000027147 | 117 |
| 184 | 3300013307 | Ga0157372_10093755 | Ga0157372_100937554 | 117 |
| 185 | 3300014745 | Ga0157377_10000264 | Ga0157377_1000026424 | 117 |
| 186 | 3300014969 | Ga0157376_10000054 | Ga0157376_1000005483 | 117 |
| 187 | 3300014969 | Ga0157376_10010602 | Ga0157376_100106023 | 117 |
| 188 | 3300025901 | Ga0207688_10014552 | Ga0207688_100145523 | 117 |
| 189 | 3300025904 | Ga0207647_10000177 | Ga0207647_1000017715 | 117 |
| 190 | 3300025909 | Ga0207705_10000010 | Ga0207705_10000010331 | 117 |
| 191 | 3300025911 | Ga0207654_10780925 | Ga0207654_107809251 | 117 |
| 192 | 3300025919 | Ga0207657_10002733 | Ga0207657_100027336 | 117 |
| 193 | 3300025933 | Ga0207706_10000004 | Ga0207706_10000004212 | 117 |
| 194 | 3300025944 | Ga0207661_10046264 | Ga0207661_100462643 | 117 |
| 195 | 3300026078 | Ga0207702_10000097 | Ga0207702_1000009783 | 117 |
| 196 | 3300026078 | Ga0207702_10000271 | Ga0207702_1000027131 | 117 |
| 197 | 3300026116 | Ga0207674_10000667 | Ga0207674_1000066725 | 117 |
| 198 | 3300026142 | Ga0207698_10000107 | Ga0207698_1000010754 | 117 |
| 199 | 3300031731 | Ga0307405_10064315 | Ga0307405_100643152 | 117 |
| 200 | 3300031911 | Ga0307412_10011652 | Ga0307412_100116524 | 117 |
| 201 | 3300037312 | Ga0395899_0009895 | Ga0395899_0009895_5886_6239 | 117 |
| 202 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_568454_568807 | 117 |
| 203 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_537199_537552 | 117 |
| 204 | 3300038443 | Ga0395901_0000006 | Ga0395901_0000006_182875_183228 | 117 |
| 205 | 3300042016 | Ga0439463_002381 | Ga0439463_002381_2790_3143 | 117 |
| 206 | 3300042439 | Ga0439464_0000042 | Ga0439464_0000042_6405_6758 | 117 |
| 207 | 3300044658 | Ga0466972_0047837 | Ga0466972_0047837_1576_1956 | 117 |
| 208 | 3300044683 | Ga0466965_0000077 | Ga0466965_0000077_622_1002 | 117 |
| 209 | 3300046460 | Ga0495638_0000285 | Ga0495638_0000285_66176_66544 | 117 |
| 210 | 3300046542 | Ga0495597_0044645 | Ga0495597_0044645_501_869 | 117 |
| 211 | 3300048916 | Ga0496113_1308866 | Ga0496113_1308866_117_470 | 117 |
| 212 | 3300050491 | nmdc:mga00v17_25452_c1 | nmdc:mga00v17_25452_c1_2233_2586 | 117 |
| 213 | 3300050492 | nmdc:mga0yw44_5_c1 | nmdc:mga0yw44_5_c1_101589_101942 | 117 |
| 214 | 3300050493 | nmdc:mga0k408_1863_c2 | nmdc:mga0k408_1863_c2_9522_9875 | 117 |
| 215 | 3300050494 | nmdc:mga06z11_208344_c1 | nmdc:mga06z11_208344_c1_506_859 | 117 |
| 216 | 3300050496 | nmdc:mga07m45_140972_c1 | nmdc:mga07m45_140972_c1_969_1322 | 117 |
| 217 | 3300053087 | Ga0500643_003279 | Ga0500643_003279_6444_6803 | 117 |
| 218 | 3300053103 | Ga0500555_000023 | Ga0500555_000023_92777_93130 | 117 |
| 219 | 3300053109 | Ga0500569_000009 | Ga0500569_000009_66176_66544 | 117 |
| 220 | 3300053142 | Ga0500577_0003634 | Ga0500577_0003634_2851_3222 | 117 |
| 221 | 3300053146 | Ga0500588_0000078 | Ga0500588_0000078_11760_12128 | 117 |
| 222 | 3300053155 | Ga0500620_046355 | Ga0500620_046355_544_903 | 117 |
| 223 | 3300003320 | rootH2_10231047 | rootH2_102310472 | 121 |
| 224 | 3300003322 | rootL2_10212901 | rootL2_102129014 | 121 |
| 225 | 3300003323 | rootH1_10103469 | rootH1_101034692 | 121 |
| 226 | 3300005344 | Ga0070661_100618677 | Ga0070661_1006186772 | 121 |
| 227 | 3300005457 | Ga0070662_101408827 | Ga0070662_1014088271 | 121 |
| 228 | 3300001904 | JGI24736J21556_1005805 | JGI24736J21556_10058052 | 122 |
| 229 | 3300001979 | JGI24740J21852_10028232 | JGI24740J21852_100282322 | 122 |
| 230 | 3300001989 | JGI24739J22299_10000063 | JGI24739J22299_1000006317 | 122 |
| 231 | 3300001990 | JGI24737J22298_10000145 | JGI24737J22298_1000014516 | 122 |
| 232 | 3300001991 | JGI24743J22301_10003289 | JGI24743J22301_100032893 | 122 |
| 233 | 3300002067 | JGI24735J21928_10000067 | JGI24735J21928_1000006711 | 122 |
| 234 | 3300002075 | JGI24738J21930_10000073 | JGI24738J21930_1000007316 | 122 |
| 235 | 3300005327 | Ga0070658_10000009 | Ga0070658_10000009195 | 122 |
| 236 | 3300005344 | Ga0070661_100023437 | Ga0070661_1000234371 | 122 |
| 237 | 3300005354 | Ga0070675_100145257 | Ga0070675_1001452573 | 122 |
| 238 | 3300005366 | Ga0070659_100001064 | Ga0070659_10000106413 | 122 |
| 239 | 3300005457 | Ga0070662_100039453 | Ga0070662_1000394533 | 122 |
| 240 | 3300005535 | Ga0070684_100374788 | Ga0070684_1003747882 | 122 |
| 241 | 3300005616 | Ga0068852_100045261 | Ga0068852_1000452612 | 122 |
| 242 | 3300006051 | Ga0075364_10011613 | Ga0075364_100116133 | 122 |
| 243 | 3300006178 | Ga0075367_10257879 | Ga0075367_102578792 | 122 |
| 244 | 3300006237 | Ga0097621_100666898 | Ga0097621_1006668981 | 122 |
| 245 | 3300006358 | Ga0068871_100142625 | Ga0068871_1001426252 | 122 |
| 246 | 3300025911 | Ga0207654_10026476 | Ga0207654_100264764 | 122 |
| 247 | 3300025932 | Ga0207690_10012004 | Ga0207690_100120043 | 122 |
| 248 | 3300025944 | Ga0207661_10581165 | Ga0207661_105811651 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1a6f-assembly1.cif.gz_A | rnase p protein from bacillus subtilis | 0.9152 | 5 | 120 |
| 4jg4-assembly1.cif.gz_A | ligand concentration regulates the pathways of coupled protein folding and binding | 0.9128 | 5 | 121 |
| 1a6f-assembly1.cif.gz_A | rnase p protein from bacillus subtilis | 0.9077 | 5 | 120 |
| 4jg4-assembly1.cif.gz_A | ligand concentration regulates the pathways of coupled protein folding and binding | 0.9054 | 5 | 121 |
| 6ov1-assembly1.cif.gz_A | structure of staphylococcus aureus rnase p protein mutant with defective mrna degradation activity | 0.8949 | 10 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1a6fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9152 | 5 | 120 | 3.30.230.10 |
| af_P9WGZ3_1_112_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9131 | 6 | 117 | 3.30.230.10 |
| 1a6fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9077 | 5 | 120 | 3.30.230.10 |
| 6d1rA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8831 | 11 | 120 | 3.30.230.10 |
| af_P9WGZ3_1_112_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.883 | 6 | 117 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A563DEE3-F1-model_v4 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | 0.9831 | 6 | 120 |
GO:0000049
GO:0001682 GO:0004526 GO:0030677 GO:0042781 |
| AF-A0A431HKQ5-F1-model_v4 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | 0.9787 | 6 | 120 |
GO:0000049
GO:0001682 GO:0004526 GO:0030677 GO:0042781 |
| AF-A0A5C7J840-F1-model_v4 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | 0.9774 | 6 | 119 |
GO:0000049
GO:0001682 GO:0004526 GO:0030677 GO:0042781 |
| AF-A0A521GZR5-F1-model_v4 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | 0.9766 | 6 | 119 |
GO:0000049
GO:0001682 GO:0004526 GO:0030677 GO:0042781 |
| AF-A0A7W4HPX7-F1-model_v4 | Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) | 0.9764 | 6 | 119 |
GO:0000049
GO:0001682 GO:0004526 GO:0005976 GO:0016779 GO:0030677 GO:0042781 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar