F360109

General Info

Members Datasets Scaffolds Average Seq Length
248 148 248 117

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0047837|Ga0466972_0047837_1576_1956
Length 126
Sequence MLSAKYRFHGHGSLRYVYKNGQAVRSRLITIKHTSNPHRKVSRFSVVVSKKVHKSAVGRNRIRRRIYEIVRHEIPKMRGVHDVAIMVFSSEVITMPHEELQQTVLQLLDQAHLYPKEEKDGILKDR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
48 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
81 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
82 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
83 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
84 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
85 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
86 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
100 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
101 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
102 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
103 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
104 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
109 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
146 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
147 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
148 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.42
Nodule 0
Rhizoplane 0.4
Rhizosphere 69.35
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005805 3300001904 Bacteria 2086
2 JGI24740J21852_10028232 3300001979 Bacteria 1856
3 JGI24739J22299_10000063 3300001989 Bacteria 29854
4 JGI24739J22299_10037068 3300001989 Bacteria 1644
5 JGI24737J22298_10000145 3300001990 Bacteria 22015
6 JGI24743J22301_10003289 3300001991 Unclassified 2543
7 JGI24735J21928_10000067 3300002067 Bacteria 42751
8 JGI24738J21930_10000073 3300002075 Bacteria 21429
9 rootH2_10004711 3300003320 Bacteria 129035
10 rootH2_10231047 3300003320 Unclassified 2868
11 rootL2_10212901 3300003322 Bacteria 2667
12 rootL2_10283333 3300003322 Unclassified 1693
13 rootH1_10021217 3300003323 Bacteria 85014
14 rootH1_10103469 3300003323 Bacteria 10129
15 Ga0070658_10000009 3300005327 Bacteria 319868
16 Ga0070658_10709224 3300005327 Bacteria 873
17 Ga0070680_100231373 3300005336 Unclassified 1561
18 Ga0070660_100001123 3300005339 Bacteria 18053
19 Ga0070660_100543711 3300005339 Bacteria 969
20 Ga0070661_100023437 3300005344 Bacteria 4424
21 Ga0070661_100618677 3300005344 Bacteria 877
22 Ga0070675_100145257 3300005354 Bacteria 2030
23 Ga0070659_100001064 3300005366 Bacteria 20072
24 Ga0070662_100039453 3300005457 Unclassified 3358
25 Ga0070662_101408827 3300005457 Unclassified 600
26 Ga0070679_100097683 3300005530 Bacteria 2924
27 Ga0070684_100374788 3300005535 Bacteria 1310
28 Ga0068853_101400223 3300005539 Unclassified 676
29 Ga0068855_100000017 3300005563 Bacteria 212278
30 Ga0068855_100007452 3300005563 Bacteria 13252
31 Ga0068855_100799868 3300005563 Unclassified 1002
32 Ga0070664_100000338 3300005564 Bacteria 34161
33 Ga0068857_100001672 3300005577 Bacteria 17821
34 Ga0068854_100004390 3300005578 Bacteria 8897
35 Ga0068856_100000060 3300005614 Bacteria 101415
36 Ga0068856_100000117 3300005614 Bacteria 79068
37 Ga0068856_100443079 3300005614 Bacteria 1319
38 Ga0068856_101474926 3300005614 Bacteria 694
39 Ga0068852_100045261 3300005616 Unclassified 3742
40 Ga0068852_100084623 3300005616 Bacteria 2823
41 Ga0081455_10000006 3300005937 Bacteria 323066
42 Ga0075365_10000004 3300006038 Bacteria 144817
43 Ga0075365_10000106 3300006038 Bacteria 24747
44 Ga0075365_10004161 3300006038 Bacteria 7614
45 Ga0075365_10044911 3300006038 Bacteria 2897
46 Ga0075365_10156453 3300006038 Bacteria 1586
47 Ga0075368_10005731 3300006042 Bacteria 4294
48 Ga0075363_100015595 3300006048 Bacteria 3738
49 Ga0075364_10011613 3300006051 Bacteria 5355
50 Ga0075362_10012492 3300006177 Bacteria 3376
51 Ga0075367_10003180 3300006178 Bacteria 7749
52 Ga0075367_10257879 3300006178 Unclassified 1094
53 Ga0075369_10000335 3300006186 Bacteria 14037
54 Ga0075366_10001364 3300006195 Bacteria 12202
55 Ga0075366_10004907 3300006195 Bacteria 7217
56 Ga0075366_10080593 3300006195 Bacteria 1944
57 Ga0075366_10518650 3300006195 Bacteria 737
58 Ga0097621_100666898 3300006237 Bacteria 955
59 Ga0075370_10151733 3300006353 Unclassified 1358
60 Ga0075370_10322338 3300006353 Unclassified 920
61 Ga0075370_10335679 3300006353 Unclassified 902
62 Ga0068871_100142625 3300006358 Bacteria 2038
63 Ga0075428_100183960 3300006844 Bacteria 2261
64 Ga0068865_100000969 3300006881 Bacteria 16387
65 Ga0105240_10000030 3300009093 Bacteria 321312
66 Ga0105240_10003612 3300009093 Bacteria 23956
67 Ga0105240_10915364 3300009093 Bacteria 942
68 Ga0105245_10124226 3300009098 Bacteria 2414
69 Ga0105241_10803539 3300009174 Bacteria 867
70 Ga0105241_10989316 3300009174 Bacteria 786
71 Ga0105241_11315789 3300009174 Unclassified 689
72 Ga0105237_10000001 3300009545 Bacteria 1009213
73 Ga0105238_10562192 3300009551 Bacteria 1146
74 Ga0105249_13455568 3300009553 Unclassified 508
75 Ga0105032_100002 3300009979 Bacteria 303884
76 Ga0105032_100010 3300009979 Bacteria 81059
77 Ga0105029_102216 3300009984 Bacteria 1256
78 Ga0105029_119864 3300009984 Unclassified 558
79 Ga0105239_10002161 3300010375 Bacteria 25290
80 Ga0105246_10003793 3300011119 Bacteria 9154
81 Ga0105246_10519101 3300011119 Bacteria 1015
82 Ga0105246_10823925 3300011119 Unclassified 825
83 Ga0157373_10006025 3300013100 Bacteria 9067
84 Ga0157373_10012732 3300013100 Bacteria 6181
85 Ga0157373_10404148 3300013100 Unclassified 979
86 Ga0157373_10974507 3300013100 Unclassified 632
87 Ga0157371_10035325 3300013102 Bacteria 3582
88 Ga0157371_10077373 3300013102 Bacteria 2355
89 Ga0157370_10000812 3300013104 Bacteria 39488
90 Ga0157370_10000984 3300013104 Bacteria 36041
91 Ga0157370_10048283 3300013104 Bacteria 4078
92 Ga0157370_10154312 3300013104 Bacteria 2136
93 Ga0157369_10000003 3300013105 Bacteria 507337
94 Ga0157369_10000026 3300013105 Bacteria 216023
95 Ga0157369_10000199 3300013105 Bacteria 83451
96 Ga0157369_10023455 3300013105 Bacteria 6872
97 Ga0157369_10058495 3300013105 Bacteria 4158
98 Ga0157369_10083971 3300013105 Bacteria 3405
99 Ga0157374_10116961 3300013296 Bacteria 2569
100 Ga0157374_11064371 3300013296 Bacteria 829
101 Ga0157372_10000007 3300013307 Bacteria 340690
102 Ga0157372_10000027 3300013307 Bacteria 186906
103 Ga0157372_10071168 3300013307 Bacteria 3916
104 Ga0157372_10093755 3300013307 Bacteria 3417
105 Ga0157377_10000264 3300014745 Bacteria 25782
106 Ga0157376_10000054 3300014969 Bacteria 99154
107 Ga0157376_10010602 3300014969 Bacteria 6749
108 Ga0207688_10014552 3300025901 Unclassified 4274
109 Ga0207647_10000177 3300025904 Bacteria 51270
110 Ga0207705_10000010 3300025909 Bacteria 518023
111 Ga0207654_10026476 3300025911 Bacteria 3140
112 Ga0207654_10780925 3300025911 Unclassified 689
113 Ga0207654_11202305 3300025911 Bacteria 552
114 Ga0207695_10000009 3300025913 Bacteria 1034276
115 Ga0207695_10003061 3300025913 Bacteria 23962
116 Ga0207671_10000003 3300025914 Bacteria 1065461
117 Ga0207657_10002733 3300025919 Bacteria 18998
118 Ga0207657_10003013 3300025919 Bacteria 18055
119 Ga0207649_10032594 3300025920 Bacteria 3108
120 Ga0207652_10933743 3300025921 Unclassified 765
121 Ga0207690_10012004 3300025932 Bacteria 5181
122 Ga0207690_10013713 3300025932 Bacteria 4878
123 Ga0207706_10000004 3300025933 Bacteria 280765
124 Ga0207704_10001729 3300025938 Bacteria 9776
125 Ga0207661_10046264 3300025944 Unclassified 3450
126 Ga0207661_10581165 3300025944 Bacteria 1027
127 Ga0207679_10000069 3300025945 Bacteria 93919
128 Ga0207667_10000048 3300025949 Bacteria 238293
129 Ga0207667_10004604 3300025949 Bacteria 16915
130 Ga0207667_11815170 3300025949 Unclassified 574
131 Ga0207640_10006327 3300025981 Bacteria 6494
132 Ga0207639_11357209 3300026041 Unclassified 667
133 Ga0207702_10000097 3300026078 Bacteria 101497
134 Ga0207702_10000271 3300026078 Bacteria 59575
135 Ga0207702_10191784 3300026078 Bacteria 1889
136 Ga0207702_11643376 3300026078 Bacteria 635
137 Ga0207674_10000667 3300026116 Bacteria 44679
138 Ga0207698_10000107 3300026142 Bacteria 52384
139 Ga0207698_10065194 3300026142 Bacteria 2859
140 Ga0209813_10001109 3300027866 Bacteria 6014
141 Ga0316177_1020215 3300030731 Bacteria 811
142 Ga0314311_1169809 3300030733 Bacteria 4227
143 Ga0316179_1072927 3300030734 Bacteria 8292
144 Ga0316180_1165797 3300030736 Bacteria 3820
145 Ga0316183_1037085 3300030742 Bacteria 2830
146 Ga0316183_1135303 3300030742 Bacteria 739
147 Ga0316183_1185963 3300030742 Bacteria 1540
148 Ga0316183_1187333 3300030742 Bacteria 18619
149 Ga0316181_1072339 3300030744 Unclassified 755
150 Ga0316181_1212132 3300030744 Unclassified 781
151 Ga0316181_1226594 3300030744 Bacteria 25946
152 Ga0316182_1038782 3300030745 Bacteria 5372
153 Ga0316182_1039584 3300030745 Bacteria 7468
154 Ga0316182_1078268 3300030745 Bacteria 1381
155 Ga0316182_1100023 3300030745 Bacteria 663
156 Ga0316182_1185273 3300030745 Bacteria 13671
157 Ga0316182_1376285 3300030745 Bacteria 16690
158 Ga0307516_10007258 3300031730 Bacteria 12764
159 Ga0307405_10064315 3300031731 Bacteria 2331
160 Ga0307412_10011652 3300031911 Bacteria 5100
161 Ga0395899_0009895 3300037312 Bacteria 7311
162 Ga0395900_0000001 3300037418 Bacteria 931146
163 Ga0395898_0000002 3300037466 Bacteria 931013
164 Ga0395901_0000006 3300038443 Bacteria 514112
165 Ga0439447_005497 3300041407 Bacteria 4206
166 Ga0439461_0000070 3300041410 Bacteria 13169
167 Ga0439461_0000652 3300041410 Bacteria 5006
168 Ga0439466_0069867 3300041411 Bacteria 1120
169 Ga0439442_031833 3300042002 Bacteria 1102
170 Ga0439442_068827 3300042002 Bacteria 753
171 Ga0439445_0001134 3300042004 Bacteria 5705
172 Ga0439432_005224 3300042006 Bacteria 4688
173 Ga0439432_082656 3300042006 Bacteria 972
174 Ga0439463_002381 3300042016 Bacteria 4792
175 Ga0439463_051001 3300042016 Bacteria 1055
176 Ga0450919_007288 3300042121 Bacteria 1294
177 Ga0450920_001940 3300042122 Bacteria 3480
178 Ga0450903_031224 3300042138 Bacteria 803
179 Ga0450906_005836 3300042145 Bacteria 2512
180 Ga0439446_0000002 3300042156 Bacteria 177065
181 Ga0439446_0002594 3300042156 Bacteria 4358
182 Ga0450909_003971 3300042185 Bacteria 2107
183 Ga0439434_0001460 3300042435 Bacteria 6792
184 Ga0439434_0005759 3300042435 Bacteria 3616
185 Ga0439434_0099465 3300042435 Bacteria 936
186 Ga0439464_0000042 3300042439 Bacteria 16260
187 Ga0450918_009327 3300042531 Unclassified 1722
188 Ga0466972_0047837 3300044658 Bacteria 2067
189 Ga0466965_0000077 3300044683 Bacteria 28675
190 Ga0466960_0158444 3300044901 Unclassified 1214
191 Ga0495638_0000285 3300046460 Bacteria 67536
192 Ga0495597_0044645 3300046542 Bacteria 1970
193 Ga0495671_0032804 3300046692 Bacteria 2649
194 Ga0495660_0000005 3300046810 Bacteria 574567
195 Ga0496113_1308866 3300048916 Unclassified 563
196 Ga0501034_0000170 3300049571 Bacteria 120823
197 Ga0501034_0023419 3300049571 Bacteria 6292
198 Ga0501037_0000011 3300049573 Bacteria 196525
199 Ga0501038_0027298 3300049574 Bacteria 5081
200 Ga0501044_1325393 3300049823 Bacteria 586
201 nmdc:mga03683_8268_c1 3300050489 Bacteria 3651
202 nmdc:mga03n38_57688_c1 3300050490 Bacteria 1756
203 nmdc:mga00v17_25452_c1 3300050491 Bacteria 3440
204 nmdc:mga00v17_29607_c1 3300050491 Bacteria 3215
205 nmdc:mga0yw44_110663_c1 3300050492 Unclassified 1759
206 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
207 nmdc:mga0yw44_127695_c1 3300050492 Bacteria 1643
208 nmdc:mga0yw44_35315_c1 3300050492 Unclassified 2937
209 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
210 nmdc:mga0yw44_82_c2 3300050492 Bacteria 32345
211 nmdc:mga0k408_1863_c2 3300050493 Bacteria 10923
212 nmdc:mga0k408_1914_c1 3300050493 Bacteria 11140
213 nmdc:mga0k408_567292_c1 3300050493 Bacteria 670
214 nmdc:mga0k408_772152_c1 3300050493 Unclassified 561
215 nmdc:mga06z11_208344_c1 3300050494 Unclassified 1138
216 nmdc:mga06z11_321_c1 3300050494 Bacteria 18195
217 nmdc:mga04h51_1053_c1 3300050495 Bacteria 6340
218 nmdc:mga07m45_140972_c1 3300050496 Unclassified 1396
219 nmdc:mga07m45_163375_c1 3300050496 Unclassified 1293
220 nmdc:mga07m45_20177_c1 3300050496 Bacteria 1979
221 nmdc:mga07m45_40692_c1 3300050496 Bacteria 2601
222 nmdc:mga07m45_468600_c1 3300050496 Unclassified 730
223 Ga0500643_003279 3300053087 Bacteria 7872
224 Ga0500644_0015554 3300053088 Bacteria 2173
225 Ga0500646_0000002 3300053090 Bacteria 178770
226 Ga0500583_0000167 3300053092 Bacteria 27217
227 Ga0500651_0000021 3300053093 Bacteria 137927
228 Ga0500641_0000001 3300053096 Bacteria 1115973
229 Ga0500650_0034447 3300053098 Bacteria 2314
230 Ga0500555_000023 3300053103 Bacteria 150521
231 Ga0500569_000009 3300053109 Bacteria 67536
232 Ga0500569_149067 3300053109 Unclassified 789
233 Ga0500593_159971 3300053117 Unclassified 862
234 Ga0500594_0000008 3300053118 Bacteria 102101
235 Ga0500652_000001 3300053131 Bacteria 946868
236 Ga0500652_148010 3300053131 Bacteria 975
237 Ga0500577_0003634 3300053142 Bacteria 4017
238 Ga0500577_0121360 3300053142 Bacteria 1088
239 Ga0500588_0000078 3300053146 Bacteria 13106
240 Ga0500616_0000012 3300053153 Bacteria 681798
241 Ga0500616_0015088 3300053153 Unclassified 4427
242 Ga0500616_0069294 3300053153 Unclassified 1804
243 Ga0500620_003540 3300053155 Bacteria 3353
244 Ga0500620_046355 3300053155 Unclassified 1444
245 Ga0500570_117357 3300053724 Unclassified 1057
246 Ga0500570_164228 3300053724 Bacteria 757
247 Ga0500656_016332 3300053732 Bacteria 878
248 Ga0500613_031923 3300053738 Unclassified 760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10037068 JGI24739J22299_100370682 115
2 3300003320 rootH2_10004711 rootH2_10004711100 115
3 3300003323 rootH1_10021217 rootH1_1002121730 115
4 3300005327 Ga0070658_10709224 Ga0070658_107092241 115
5 3300005336 Ga0070680_100231373 Ga0070680_1002313732 115
6 3300005339 Ga0070660_100001123 Ga0070660_1000011236 115
7 3300005339 Ga0070660_100543711 Ga0070660_1005437112 115
8 3300005530 Ga0070679_100097683 Ga0070679_1000976832 115
9 3300005539 Ga0068853_101400223 Ga0068853_1014002231 115
10 3300005563 Ga0068855_100000017 Ga0068855_10000001785 115
11 3300005563 Ga0068855_100007452 Ga0068855_10000745210 115
12 3300005563 Ga0068855_100799868 Ga0068855_1007998682 115
13 3300005578 Ga0068854_100004390 Ga0068854_1000043908 115
14 3300005614 Ga0068856_100443079 Ga0068856_1004430792 115
15 3300005614 Ga0068856_101474926 Ga0068856_1014749262 115
16 3300005616 Ga0068852_100084623 Ga0068852_1000846233 115
17 3300005937 Ga0081455_10000006 Ga0081455_10000006372 115
18 3300006038 Ga0075365_10000106 Ga0075365_1000010616 115
19 3300006038 Ga0075365_10004161 Ga0075365_1000416110 115
20 3300006038 Ga0075365_10044911 Ga0075365_100449114 115
21 3300006038 Ga0075365_10156453 Ga0075365_101564532 115
22 3300006042 Ga0075368_10005731 Ga0075368_100057312 115
23 3300006048 Ga0075363_100015595 Ga0075363_1000155954 115
24 3300006177 Ga0075362_10012492 Ga0075362_100124924 115
25 3300006178 Ga0075367_10003180 Ga0075367_100031806 115
26 3300006186 Ga0075369_10000335 Ga0075369_100003356 115
27 3300006195 Ga0075366_10004907 Ga0075366_100049075 115
28 3300006195 Ga0075366_10080593 Ga0075366_100805932 115
29 3300006195 Ga0075366_10518650 Ga0075366_105186501 115
30 3300006353 Ga0075370_10151733 Ga0075370_101517332 115
31 3300006353 Ga0075370_10322338 Ga0075370_103223382 115
32 3300006844 Ga0075428_100183960 Ga0075428_1001839603 115
33 3300009093 Ga0105240_10000030 Ga0105240_10000030218 115
34 3300009093 Ga0105240_10003612 Ga0105240_1000361212 115
35 3300009093 Ga0105240_10915364 Ga0105240_109153641 115
36 3300009174 Ga0105241_10989316 Ga0105241_109893162 115
37 3300009545 Ga0105237_10000001 Ga0105237_10000001157 115
38 3300009551 Ga0105238_10562192 Ga0105238_105621922 115
39 3300009979 Ga0105032_100002 Ga0105032_100002229 115
40 3300009979 Ga0105032_100010 Ga0105032_10001089 115
41 3300009984 Ga0105029_102216 Ga0105029_1022161 115
42 3300009984 Ga0105029_119864 Ga0105029_1198641 115
43 3300013100 Ga0157373_10974507 Ga0157373_109745071 115
44 3300013102 Ga0157371_10035325 Ga0157371_100353253 115
45 3300013104 Ga0157370_10000812 Ga0157370_1000081227 115
46 3300013104 Ga0157370_10048283 Ga0157370_100482832 115
47 3300013105 Ga0157369_10000003 Ga0157369_10000003148 115
48 3300013105 Ga0157369_10000199 Ga0157369_1000019984 115
49 3300013105 Ga0157369_10058495 Ga0157369_100584954 115
50 3300013105 Ga0157369_10083971 Ga0157369_100839713 115
51 3300013296 Ga0157374_11064371 Ga0157374_110643712 115
52 3300013307 Ga0157372_10000007 Ga0157372_10000007157 115
53 3300013307 Ga0157372_10071168 Ga0157372_100711683 115
54 3300025911 Ga0207654_11202305 Ga0207654_112023051 115
55 3300025913 Ga0207695_10000009 Ga0207695_10000009158 115
56 3300025913 Ga0207695_10003061 Ga0207695_1000306112 115
57 3300025914 Ga0207671_10000003 Ga0207671_10000003158 115
58 3300025919 Ga0207657_10003013 Ga0207657_1000301312 115
59 3300025921 Ga0207652_10933743 Ga0207652_109337431 115
60 3300025949 Ga0207667_10000048 Ga0207667_1000004884 115
61 3300025949 Ga0207667_10004604 Ga0207667_100046049 115
62 3300025949 Ga0207667_11815170 Ga0207667_118151701 115
63 3300025981 Ga0207640_10006327 Ga0207640_100063275 115
64 3300026041 Ga0207639_11357209 Ga0207639_113572092 115
65 3300026078 Ga0207702_10191784 Ga0207702_101917842 115
66 3300026078 Ga0207702_11643376 Ga0207702_116433761 115
67 3300026142 Ga0207698_10065194 Ga0207698_100651944 115
68 3300027866 Ga0209813_10001109 Ga0209813_100011097 115
69 3300030731 Ga0316177_1020215 Ga0316177_10202151 115
70 3300030733 Ga0314311_1169809 Ga0314311_11698095 115
71 3300030734 Ga0316179_1072927 Ga0316179_10729279 115
72 3300030736 Ga0316180_1165797 Ga0316180_11657972 115
73 3300030742 Ga0316183_1037085 Ga0316183_10370852 115
74 3300030742 Ga0316183_1135303 Ga0316183_11353031 115
75 3300030742 Ga0316183_1187333 Ga0316183_11873332 115
76 3300030744 Ga0316181_1072339 Ga0316181_10723392 115
77 3300030744 Ga0316181_1212132 Ga0316181_12121321 115
78 3300030744 Ga0316181_1226594 Ga0316181_122659426 115
79 3300030745 Ga0316182_1038782 Ga0316182_10387822 115
80 3300030745 Ga0316182_1039584 Ga0316182_10395846 115
81 3300030745 Ga0316182_1078268 Ga0316182_10782682 115
82 3300030745 Ga0316182_1185273 Ga0316182_118527312 115
83 3300030745 Ga0316182_1376285 Ga0316182_137628517 115
84 3300031730 Ga0307516_10007258 Ga0307516_100072587 115
85 3300041410 Ga0439461_0000070 Ga0439461_0000070_5825_6172 115
86 3300042002 Ga0439442_068827 Ga0439442_068827_115_462 115
87 3300042004 Ga0439445_0001134 Ga0439445_0001134_2991_3338 115
88 3300042006 Ga0439432_005224 Ga0439432_005224_2665_3012 115
89 3300042016 Ga0439463_051001 Ga0439463_051001_580_927 115
90 3300042121 Ga0450919_007288 Ga0450919_007288_408_755 115
91 3300042122 Ga0450920_001940 Ga0450920_001940_1962_2309 115
92 3300042138 Ga0450903_031224 Ga0450903_031224_445_792 115
93 3300042145 Ga0450906_005836 Ga0450906_005836_904_1251 115
94 3300042156 Ga0439446_0000002 Ga0439446_0000002_154562_154909 115
95 3300042185 Ga0450909_003971 Ga0450909_003971_412_759 115
96 3300042435 Ga0439434_0005759 Ga0439434_0005759_2899_3246 115
97 3300042435 Ga0439434_0099465 Ga0439434_0099465_60_407 115
98 3300042531 Ga0450918_009327 Ga0450918_009327_266_613 115
99 3300049571 Ga0501034_0023419 Ga0501034_0023419_2150_2497 115
100 3300049823 Ga0501044_1325393 Ga0501044_1325393_50_397 115
101 3300050489 nmdc:mga03683_8268_c1 nmdc:mga03683_8268_c1_445_792 115
102 3300050490 nmdc:mga03n38_57688_c1 nmdc:mga03n38_57688_c1_1246_1593 115
103 3300050491 nmdc:mga00v17_29607_c1 nmdc:mga00v17_29607_c1_959_1306 115
104 3300050492 nmdc:mga0yw44_110663_c1 nmdc:mga0yw44_110663_c1_423_770 115
105 3300050492 nmdc:mga0yw44_11_c1 nmdc:mga0yw44_11_c1_6939_7286 115
106 3300050492 nmdc:mga0yw44_127695_c1 nmdc:mga0yw44_127695_c1_467_814 115
107 3300050492 nmdc:mga0yw44_35315_c1 nmdc:mga0yw44_35315_c1_843_1190 115
108 3300050492 nmdc:mga0yw44_82_c2 nmdc:mga0yw44_82_c2_7592_7939 115
109 3300050493 nmdc:mga0k408_1914_c1 nmdc:mga0k408_1914_c1_5601_5948 115
110 3300050493 nmdc:mga0k408_567292_c1 nmdc:mga0k408_567292_c1_61_408 115
111 3300050493 nmdc:mga0k408_772152_c1 nmdc:mga0k408_772152_c1_156_503 115
112 3300050494 nmdc:mga06z11_321_c1 nmdc:mga06z11_321_c1_6778_7125 115
113 3300050495 nmdc:mga04h51_1053_c1 nmdc:mga04h51_1053_c1_3569_3916 115
114 3300050496 nmdc:mga07m45_20177_c1 nmdc:mga07m45_20177_c1_1488_1835 115
115 3300050496 nmdc:mga07m45_40692_c1 nmdc:mga07m45_40692_c1_1724_2071 115
116 3300050496 nmdc:mga07m45_468600_c1 nmdc:mga07m45_468600_c1_126_473 115
117 3300053088 Ga0500644_0015554 Ga0500644_0015554_184_531 115
118 3300053093 Ga0500651_0000021 Ga0500651_0000021_82049_82396 115
119 3300053109 Ga0500569_149067 Ga0500569_149067_240_587 115
120 3300053117 Ga0500593_159971 Ga0500593_159971_55_402 115
121 3300053118 Ga0500594_0000008 Ga0500594_0000008_55532_55879 115
122 3300053131 Ga0500652_148010 Ga0500652_148010_147_494 115
123 3300053142 Ga0500577_0121360 Ga0500577_0121360_655_1002 115
124 3300053153 Ga0500616_0000012 Ga0500616_0000012_77505_77852 115
125 3300053153 Ga0500616_0015088 Ga0500616_0015088_3497_3844 115
126 3300053153 Ga0500616_0069294 Ga0500616_0069294_1411_1758 115
127 3300053724 Ga0500570_117357 Ga0500570_117357_79_426 115
128 3300053724 Ga0500570_164228 Ga0500570_164228_19_366 115
129 3300053732 Ga0500656_016332 Ga0500656_016332_339_686 115
130 3300053738 Ga0500613_031923 Ga0500613_031923_22_369 115
131 3300003322 rootL2_10283333 rootL2_102833333 116
132 3300005564 Ga0070664_100000338 Ga0070664_10000033813 116
133 3300006881 Ga0068865_100000969 Ga0068865_10000096911 116
134 3300009553 Ga0105249_13455568 Ga0105249_134555681 116
135 3300011119 Ga0105246_10519101 Ga0105246_105191011 116
136 3300013100 Ga0157373_10404148 Ga0157373_104041482 116
137 3300025920 Ga0207649_10032594 Ga0207649_100325943 116
138 3300025932 Ga0207690_10013713 Ga0207690_100137135 116
139 3300025938 Ga0207704_10001729 Ga0207704_100017297 116
140 3300025945 Ga0207679_10000069 Ga0207679_1000006921 116
141 3300030742 Ga0316183_1185963 Ga0316183_11859632 116
142 3300030745 Ga0316182_1100023 Ga0316182_11000232 116
143 3300041407 Ga0439447_005497 Ga0439447_005497_2338_2688 116
144 3300041410 Ga0439461_0000652 Ga0439461_0000652_1625_1975 116
145 3300041411 Ga0439466_0069867 Ga0439466_0069867_68_418 116
146 3300042002 Ga0439442_031833 Ga0439442_031833_73_423 116
147 3300042006 Ga0439432_082656 Ga0439432_082656_35_385 116
148 3300042156 Ga0439446_0002594 Ga0439446_0002594_570_920 116
149 3300042435 Ga0439434_0001460 Ga0439434_0001460_1977_2327 116
150 3300044901 Ga0466960_0158444 Ga0466960_0158444_634_1011 116
151 3300046692 Ga0495671_0032804 Ga0495671_0032804_1483_1833 116
152 3300046810 Ga0495660_0000005 Ga0495660_0000005_512520_512870 116
153 3300049571 Ga0501034_0000170 Ga0501034_0000170_74284_74634 116
154 3300049573 Ga0501037_0000011 Ga0501037_0000011_66902_67252 116
155 3300049574 Ga0501038_0027298 Ga0501038_0027298_2941_3291 116
156 3300050496 nmdc:mga07m45_163375_c1 nmdc:mga07m45_163375_c1_431_781 116
157 3300053090 Ga0500646_0000002 Ga0500646_0000002_54188_54538 116
158 3300053092 Ga0500583_0000167 Ga0500583_0000167_10997_11347 116
159 3300053096 Ga0500641_0000001 Ga0500641_0000001_810856_811206 116
160 3300053098 Ga0500650_0034447 Ga0500650_0034447_288_638 116
161 3300053131 Ga0500652_000001 Ga0500652_000001_670392_670742 116
162 3300053155 Ga0500620_003540 Ga0500620_003540_994_1344 116
163 3300005577 Ga0068857_100001672 Ga0068857_10000167219 117
164 3300005614 Ga0068856_100000060 Ga0068856_10000006025 117
165 3300005614 Ga0068856_100000117 Ga0068856_10000011761 117
166 3300006038 Ga0075365_10000004 Ga0075365_1000000462 117
167 3300006195 Ga0075366_10001364 Ga0075366_1000136413 117
168 3300006353 Ga0075370_10335679 Ga0075370_103356792 117
169 3300009098 Ga0105245_10124226 Ga0105245_101242261 117
170 3300009174 Ga0105241_10803539 Ga0105241_108035391 117
171 3300009174 Ga0105241_11315789 Ga0105241_113157891 117
172 3300010375 Ga0105239_10002161 Ga0105239_1000216118 117
173 3300011119 Ga0105246_10003793 Ga0105246_100037931 117
174 3300011119 Ga0105246_10823925 Ga0105246_108239252 117
175 3300013100 Ga0157373_10006025 Ga0157373_100060251 117
176 3300013100 Ga0157373_10012732 Ga0157373_100127322 117
177 3300013102 Ga0157371_10077373 Ga0157371_100773733 117
178 3300013104 Ga0157370_10000984 Ga0157370_100009842 117
179 3300013104 Ga0157370_10154312 Ga0157370_101543121 117
180 3300013105 Ga0157369_10000026 Ga0157369_10000026251 117
181 3300013105 Ga0157369_10023455 Ga0157369_100234551 117
182 3300013296 Ga0157374_10116961 Ga0157374_101169613 117
183 3300013307 Ga0157372_10000027 Ga0157372_10000027147 117
184 3300013307 Ga0157372_10093755 Ga0157372_100937554 117
185 3300014745 Ga0157377_10000264 Ga0157377_1000026424 117
186 3300014969 Ga0157376_10000054 Ga0157376_1000005483 117
187 3300014969 Ga0157376_10010602 Ga0157376_100106023 117
188 3300025901 Ga0207688_10014552 Ga0207688_100145523 117
189 3300025904 Ga0207647_10000177 Ga0207647_1000017715 117
190 3300025909 Ga0207705_10000010 Ga0207705_10000010331 117
191 3300025911 Ga0207654_10780925 Ga0207654_107809251 117
192 3300025919 Ga0207657_10002733 Ga0207657_100027336 117
193 3300025933 Ga0207706_10000004 Ga0207706_10000004212 117
194 3300025944 Ga0207661_10046264 Ga0207661_100462643 117
195 3300026078 Ga0207702_10000097 Ga0207702_1000009783 117
196 3300026078 Ga0207702_10000271 Ga0207702_1000027131 117
197 3300026116 Ga0207674_10000667 Ga0207674_1000066725 117
198 3300026142 Ga0207698_10000107 Ga0207698_1000010754 117
199 3300031731 Ga0307405_10064315 Ga0307405_100643152 117
200 3300031911 Ga0307412_10011652 Ga0307412_100116524 117
201 3300037312 Ga0395899_0009895 Ga0395899_0009895_5886_6239 117
202 3300037418 Ga0395900_0000001 Ga0395900_0000001_568454_568807 117
203 3300037466 Ga0395898_0000002 Ga0395898_0000002_537199_537552 117
204 3300038443 Ga0395901_0000006 Ga0395901_0000006_182875_183228 117
205 3300042016 Ga0439463_002381 Ga0439463_002381_2790_3143 117
206 3300042439 Ga0439464_0000042 Ga0439464_0000042_6405_6758 117
207 3300044658 Ga0466972_0047837 Ga0466972_0047837_1576_1956 117
208 3300044683 Ga0466965_0000077 Ga0466965_0000077_622_1002 117
209 3300046460 Ga0495638_0000285 Ga0495638_0000285_66176_66544 117
210 3300046542 Ga0495597_0044645 Ga0495597_0044645_501_869 117
211 3300048916 Ga0496113_1308866 Ga0496113_1308866_117_470 117
212 3300050491 nmdc:mga00v17_25452_c1 nmdc:mga00v17_25452_c1_2233_2586 117
213 3300050492 nmdc:mga0yw44_5_c1 nmdc:mga0yw44_5_c1_101589_101942 117
214 3300050493 nmdc:mga0k408_1863_c2 nmdc:mga0k408_1863_c2_9522_9875 117
215 3300050494 nmdc:mga06z11_208344_c1 nmdc:mga06z11_208344_c1_506_859 117
216 3300050496 nmdc:mga07m45_140972_c1 nmdc:mga07m45_140972_c1_969_1322 117
217 3300053087 Ga0500643_003279 Ga0500643_003279_6444_6803 117
218 3300053103 Ga0500555_000023 Ga0500555_000023_92777_93130 117
219 3300053109 Ga0500569_000009 Ga0500569_000009_66176_66544 117
220 3300053142 Ga0500577_0003634 Ga0500577_0003634_2851_3222 117
221 3300053146 Ga0500588_0000078 Ga0500588_0000078_11760_12128 117
222 3300053155 Ga0500620_046355 Ga0500620_046355_544_903 117
223 3300003320 rootH2_10231047 rootH2_102310472 121
224 3300003322 rootL2_10212901 rootL2_102129014 121
225 3300003323 rootH1_10103469 rootH1_101034692 121
226 3300005344 Ga0070661_100618677 Ga0070661_1006186772 121
227 3300005457 Ga0070662_101408827 Ga0070662_1014088271 121
228 3300001904 JGI24736J21556_1005805 JGI24736J21556_10058052 122
229 3300001979 JGI24740J21852_10028232 JGI24740J21852_100282322 122
230 3300001989 JGI24739J22299_10000063 JGI24739J22299_1000006317 122
231 3300001990 JGI24737J22298_10000145 JGI24737J22298_1000014516 122
232 3300001991 JGI24743J22301_10003289 JGI24743J22301_100032893 122
233 3300002067 JGI24735J21928_10000067 JGI24735J21928_1000006711 122
234 3300002075 JGI24738J21930_10000073 JGI24738J21930_1000007316 122
235 3300005327 Ga0070658_10000009 Ga0070658_10000009195 122
236 3300005344 Ga0070661_100023437 Ga0070661_1000234371 122
237 3300005354 Ga0070675_100145257 Ga0070675_1001452573 122
238 3300005366 Ga0070659_100001064 Ga0070659_10000106413 122
239 3300005457 Ga0070662_100039453 Ga0070662_1000394533 122
240 3300005535 Ga0070684_100374788 Ga0070684_1003747882 122
241 3300005616 Ga0068852_100045261 Ga0068852_1000452612 122
242 3300006051 Ga0075364_10011613 Ga0075364_100116133 122
243 3300006178 Ga0075367_10257879 Ga0075367_102578792 122
244 3300006237 Ga0097621_100666898 Ga0097621_1006668981 122
245 3300006358 Ga0068871_100142625 Ga0068871_1001426252 122
246 3300025911 Ga0207654_10026476 Ga0207654_100264764 122
247 3300025932 Ga0207690_10012004 Ga0207690_100120043 122
248 3300025944 Ga0207661_10581165 Ga0207661_105811651 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00825

Ribonuclease_P

Ribonuclease P

2

112

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.9152 5 120
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.9128 5 121
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.9077 5 120
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.9054 5 121
6ov1-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein mutant with defective mrna degradation activity 0.8949 10 117
ID Description Score Start End Superfamily
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9152 5 120 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9131 6 117 3.30.230.10
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9077 5 120 3.30.230.10
6d1rA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8831 11 120 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.883 6 117 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A563DEE3-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9831 6 120 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A431HKQ5-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9787 6 120 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A5C7J840-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9774 6 119 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A521GZR5-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9766 6 119 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A7W4HPX7-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9764 6 119 GO:0000049
GO:0001682
GO:0004526
GO:0005976
GO:0016779
GO:0030677
GO:0042781

Feature Viewer

pLDDT pTM Quality
90.86 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map