F359728

General Info

Members Datasets Scaffolds Average Seq Length
248 161 496 169

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100069815|Ga0068853_1000698153
Length 185
Sequence MAGKSKAGGAIPSAKGLAPLVGDPAARASKGRARKVAIVTAKFNSLVTDQLEAGAVACLIEYGAKAEDIMVAKVPGAVELPLAAKTLAATGRYEAVVALGCVIRGDTSHYDYVCSMAADGLREAALGTGVPIIFGVLTTENLEQALERAETGRGNKGREAALGALEMADLLEKIKGGTMRKETRK

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
118 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
119 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 7.26
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100069815 3300005539 Bacteria 3057
2 Ga0070670_100085400 3300005331 Bacteria 2712
3 Ga0070677_10011737 3300005333 Bacteria 3028
4 Ga0070677_10537139 3300005333 Bacteria 639
5 Ga0068869_100070574 3300005334 Bacteria 2585
6 Ga0068869_100153990 3300005334 Bacteria 1785
7 Ga0068869_100806431 3300005334 Bacteria 807
8 Ga0070666_10004026 3300005335 Bacteria 8923
9 Ga0070682_100029189 3300005337 Bacteria 3319
10 Ga0070682_100030826 3300005337 Bacteria 3241
11 Ga0070682_100135333 3300005337 Bacteria 1673
12 Ga0068868_100009990 3300005338 Bacteria 6857
13 Ga0068868_100349374 3300005338 Bacteria 1266
14 Ga0070689_100012028 3300005340 Bacteria 6221
15 Ga0070689_100111178 3300005340 Bacteria 2179
16 Ga0070689_100137556 3300005340 Bacteria 1962
17 Ga0070689_100406618 3300005340 Bacteria 1152
18 Ga0070691_10550404 3300005341 Bacteria 674
19 Ga0070687_100014699 3300005343 Bacteria 3522
20 Ga0070661_100084492 3300005344 Bacteria 2345
21 Ga0070668_100550608 3300005347 Bacteria 1004
22 Ga0070671_100145967 3300005355 Bacteria 1997
23 Ga0070671_100503840 3300005355 Bacteria 1041
24 Ga0070673_100115914 3300005364 Bacteria 2228
25 Ga0070688_100085284 3300005365 Bacteria 2053
26 Ga0070659_100570737 3300005366 Bacteria 970
27 Ga0070667_100107354 3300005367 Bacteria 2417
28 Ga0070667_101375002 3300005367 Bacteria 662
29 Ga0070709_10847183 3300005434 Bacteria 720
30 Ga0070710_10733448 3300005437 Bacteria 700
31 Ga0070701_10000698 3300005438 Bacteria 11877
32 Ga0070700_100086172 3300005441 Bacteria 2039
33 Ga0068867_100695151 3300005459 Bacteria 897
34 Ga0070685_10185638 3300005466 Bacteria 1342
35 Ga0070672_100010979 3300005543 Bacteria 6302
36 Ga0070672_100011960 3300005543 Bacteria 6068
37 Ga0070686_100238374 3300005544 Bacteria 1323
38 Ga0070686_100533233 3300005544 Bacteria 916
39 Ga0070695_100228293 3300005545 Bacteria 1345
40 Ga0070696_100073067 3300005546 Bacteria 2416
41 Ga0070665_100000769 3300005548 Bacteria 42290
42 Ga0070665_100042807 3300005548 Bacteria 4552
43 Ga0070665_100063907 3300005548 Bacteria 3690
44 Ga0070665_101544093 3300005548 Bacteria 672
45 Ga0070704_100208676 3300005549 Bacteria 1581
46 Ga0068855_100483766 3300005563 Unclassified 1347
47 Ga0068857_100097254 3300005577 Bacteria 2639
48 Ga0070702_100039833 3300005615 Bacteria 2624
49 Ga0068852_100432227 3300005616 Bacteria 1300
50 Ga0068859_100013707 3300005617 Bacteria 8127
51 Ga0068859_100015378 3300005617 Bacteria 7687
52 Ga0068859_100550025 3300005617 Bacteria 1249
53 Ga0068861_100000511 3300005719 Bacteria 22624
54 Ga0068861_100003653 3300005719 Bacteria 10255
55 Ga0068863_100429114 3300005841 Bacteria 1295
56 Ga0068858_100285312 3300005842 Bacteria 1572
57 Ga0068860_100006234 3300005843 Bacteria 11984
58 Ga0068860_100022300 3300005843 Bacteria 6128
59 Ga0068860_101219090 3300005843 Bacteria 773
60 Ga0068862_100022799 3300005844 Bacteria 5239
61 Ga0068862_100165169 3300005844 Bacteria 1978
62 Ga0068862_101328370 3300005844 Bacteria 721
63 Ga0081455_10001787 3300005937 Bacteria 25984
64 Ga0070715_10242368 3300006163 Unclassified 938
65 Ga0097621_100356924 3300006237 Bacteria 1301
66 Ga0068871_100026605 3300006358 Bacteria 4516
67 Ga0068871_100063883 3300006358 Bacteria 3012
68 Ga0068865_100042826 3300006881 Bacteria 3090
69 Ga0097620_100013707 3300006931 Bacteria 8127
70 Ga0097620_100015377 3300006931 Bacteria 7687
71 Ga0097620_100550094 3300006931 Bacteria 1249
72 Ga0111539_10636040 3300009094 Unclassified 1242
73 Ga0105245_10014643 3300009098 Bacteria 6830
74 Ga0105247_10751430 3300009101 Bacteria 739
75 Ga0105242_10053281 3300009176 Bacteria 3303
76 Ga0105248_10011046 3300009177 Bacteria 9960
77 Ga0157374_10189230 3300013296 Bacteria 2013
78 Ga0157378_10010647 3300013297 Bacteria 8036
79 Ga0157378_11209212 3300013297 Bacteria 795
80 Ga0163162_10235625 3300013306 Bacteria 1961
81 Ga0157375_10008496 3300013308 Bacteria 8991
82 Ga0157375_10520382 3300013308 Bacteria 1353
83 Ga0157380_10536438 3300014326 Bacteria 1145
84 Ga0157379_10009639 3300014968 Bacteria 8407
85 Ga0157379_10305336 3300014968 Bacteria 1451
86 Ga0157376_11421219 3300014969 Bacteria 726
87 Ga0163161_10335954 3300017792 Bacteria 1197
88 Ga0207682_10037659 3300025893 Bacteria 1960
89 Ga0207682_10394877 3300025893 Bacteria 653
90 Ga0207692_10572467 3300025898 Bacteria 724
91 Ga0207680_10073228 3300025903 Bacteria 2129
92 Ga0207699_10701741 3300025906 Bacteria 741
93 Ga0207707_10003823 3300025912 Bacteria 13338
94 Ga0207663_10177119 3300025916 Bacteria 1519
95 Ga0207662_10019630 3300025918 Bacteria 3850
96 Ga0207662_10943428 3300025918 Unclassified 612
97 Ga0207649_10109221 3300025920 Bacteria 1845
98 Ga0207650_10044352 3300025925 Bacteria 3268
99 Ga0207659_10622113 3300025926 Unclassified 921
100 Ga0207687_10019236 3300025927 Bacteria 4523
101 Ga0207664_10111688 3300025929 Bacteria 2274
102 Ga0207644_10043764 3300025931 Bacteria 3179
103 Ga0207670_10010653 3300025936 Bacteria 5305
104 Ga0207670_10099074 3300025936 Bacteria 2078
105 Ga0207670_10446147 3300025936 Bacteria 1042
106 Ga0207670_11140922 3300025936 Bacteria 659
107 Ga0207669_10016502 3300025937 Bacteria 3754
108 Ga0207669_11204716 3300025937 Unclassified 641
109 Ga0207704_10139204 3300025938 Bacteria 1695
110 Ga0207691_10003602 3300025940 Bacteria 15049
111 Ga0207691_10054533 3300025940 Bacteria 3646
112 Ga0207691_10188772 3300025940 Bacteria 1798
113 Ga0207711_10013932 3300025941 Bacteria 6677
114 Ga0207689_10135143 3300025942 Bacteria 2030
115 Ga0207689_10295643 3300025942 Bacteria 1342
116 Ga0207651_10038985 3300025960 Bacteria 3128
117 Ga0207651_10518652 3300025960 Bacteria 1032
118 Ga0207651_10666007 3300025960 Bacteria 915
119 Ga0207712_10231348 3300025961 Bacteria 1484
120 Ga0207668_10317298 3300025972 Bacteria 1292
121 Ga0207668_10566710 3300025972 Unclassified 986
122 Ga0207658_10361988 3300025986 Bacteria 1266
123 Ga0207677_11068035 3300026023 Unclassified 735
124 Ga0207703_10025783 3300026035 Bacteria 4626
125 Ga0207703_10508277 3300026035 Bacteria 1132
126 Ga0207639_10053910 3300026041 Bacteria 3071
127 Ga0207708_10030919 3300026075 Bacteria 4063
128 Ga0207708_10100007 3300026075 Bacteria 2243
129 Ga0207708_10110411 3300026075 Bacteria 2134
130 Ga0207708_10831768 3300026075 Unclassified 796
131 Ga0207641_10108939 3300026088 Bacteria 2452
132 Ga0207641_10290660 3300026088 Bacteria 1540
133 Ga0207641_11885863 3300026088 Bacteria 599
134 Ga0207648_10178119 3300026089 Bacteria 1881
135 Ga0207676_10157139 3300026095 Unclassified 1966
136 Ga0207676_10617465 3300026095 Bacteria 1043
137 Ga0207674_10367766 3300026116 Bacteria 1390
138 Ga0207675_100002626 3300026118 Bacteria 17775
139 Ga0207675_100006149 3300026118 Bacteria 11409
140 Ga0207675_101822555 3300026118 Unclassified 627
141 Ga0207683_10020228 3300026121 Bacteria 5690
142 Ga0207683_10387884 3300026121 Bacteria 1284
143 Ga0207698_10546297 3300026142 Bacteria 1135
144 Ga0207698_10719519 3300026142 Bacteria 995
145 Ga0268266_10030777 3300028379 Bacteria 4558
146 Ga0268266_10118148 3300028379 Bacteria 2357
147 Ga0268266_10421412 3300028379 Bacteria 1265
148 Ga0268266_10994443 3300028379 Unclassified 812
149 Ga0268265_10231918 3300028380 Bacteria 1623
150 Ga0268265_10553378 3300028380 Bacteria 1092
151 Ga0268264_10084718 3300028381 Bacteria 2718
152 Ga0265330_10028235 3300031235 Bacteria 2530
153 Ga0265328_10143591 3300031239 Bacteria 896
154 Ga0307513_10006396 3300031456 Bacteria 15393
155 Ga0307513_10033769 3300031456 Bacteria 5747
156 Ga0307513_10492358 3300031456 Bacteria 944
157 Ga0307509_10189835 3300031507 Bacteria 1907
158 Ga0307509_10233416 3300031507 Bacteria 1640
159 Ga0307509_10646419 3300031507 Bacteria 727
160 Ga0307408_100236771 3300031548 Bacteria 1498
161 Ga0307405_10065656 3300031731 Bacteria 2311
162 Ga0307405_10193811 3300031731 Bacteria 1470
163 Ga0307405_10397438 3300031731 Bacteria 1078
164 Ga0307405_11008188 3300031731 Bacteria 711
165 Ga0307413_10015182 3300031824 Bacteria 3939
166 Ga0307410_10032176 3300031852 Bacteria 3373
167 Ga0307410_10061537 3300031852 Bacteria 2569
168 Ga0307406_10079948 3300031901 Bacteria 2169
169 Ga0307407_10026462 3300031903 Bacteria 3072
170 Ga0307407_10027655 3300031903 Bacteria 3021
171 Ga0307412_11034998 3300031911 Bacteria 727
172 Ga0307409_100048181 3300031995 Bacteria 3240
173 Ga0307409_100178401 3300031995 Bacteria 1877
174 Ga0307409_100615712 3300031995 Bacteria 1075
175 Ga0307409_100645849 3300031995 Bacteria 1051
176 Ga0307409_100903577 3300031995 Bacteria 897
177 Ga0307416_100042597 3300032002 Bacteria 3546
178 Ga0307414_11307385 3300032004 Bacteria 673
179 Ga0307411_10009960 3300032005 Bacteria 5035
180 Ga0307411_10062533 3300032005 Bacteria 2483
181 Ga0307411_10403099 3300032005 Bacteria 1131
182 Ga0307415_100998169 3300032126 Bacteria 778
183 Ga0373943_0519339 3300035170 Bacteria 697
184 Ga0436363_0256058 3300039450 Bacteria 1658
185 Ga0451787_524988 3300041441 Bacteria 852
186 Ga0451791_0106137 3300041451 Bacteria 1957
187 Ga0451791_0270621 3300041451 Bacteria 2321
188 Ga0451793_1010195 3300041452 Bacteria 1392
189 Ga0451797_0910996 3300041453 Bacteria 757
190 Ga0451795_0626214 3300041456 Bacteria 670
191 Ga0451798_0109580 3300041458 Bacteria 1026
192 Ga0451800_0984903 3300041459 Bacteria 801
193 Ga0451802_1220946 3300041460 Bacteria 1100
194 Ga0451807_2436375 3300041486 Bacteria 3814
195 Ga0451853_1935205 3300041512 Bacteria 1119
196 Ga0466972_0162210 3300044658 Unclassified 1050
197 Ga0466960_0111370 3300044901 Unclassified 1423
198 Ga0495590_0049007 3300046457 Bacteria 1474
199 Ga0495590_0228634 3300046457 Bacteria 688
200 Ga0495638_0022081 3300046460 Bacteria 4181
201 Ga0495638_0029853 3300046460 Bacteria 3515
202 Ga0495638_0148113 3300046460 Bacteria 1364
203 Ga0495584_0219981 3300046491 Bacteria 965
204 Ga0495632_0061063 3300046519 Bacteria 1830
205 Ga0495625_0027714 3300046660 Bacteria 4258
206 Ga0495625_0061994 3300046660 Bacteria 2644
207 Ga0495625_0066687 3300046660 Bacteria 2535
208 Ga0495649_0006626 3300046694 Bacteria 7198
209 Ga0495649_0275678 3300046694 Bacteria 860
210 Ga0495649_0313918 3300046694 Bacteria 796
211 Ga0495686_0123299 3300047472 Bacteria 1542
212 Ga0495602_0907332 3300048088 Bacteria 586
213 Ga0496100_0131723 3300048903 Bacteria 1762
214 Ga0496101_0064690 3300048904 Bacteria 2665
215 Ga0496105_0005362 3300048908 Bacteria 9720
216 Ga0496107_0640579 3300048910 Bacteria 784
217 Ga0496108_0013657 3300048911 Bacteria 6629
218 Ga0496109_0006150 3300048912 Bacteria 10089
219 Ga0496110_0007250 3300048913 Bacteria 8839
220 Ga0496111_0038031 3300048914 Bacteria 3446
221 Ga0501032_0302858 3300049569 Bacteria 1033
222 Ga0501037_0468593 3300049573 Bacteria 858
223 Ga0501038_0238056 3300049574 Bacteria 1446
224 Ga0501038_0413838 3300049574 Bacteria 1041
225 Ga0501039_0264624 3300049575 Bacteria 1351
226 Ga0501042_0261974 3300049578 Bacteria 1248
227 Ga0501042_0287521 3300049578 Bacteria 1187
228 Ga0501067_0013623 3300049583 Bacteria 4503
229 Ga0501068_0002704 3300049584 Bacteria 9401
230 Ga0501070_0020980 3300049586 Bacteria 5481
231 Ga0501071_0017481 3300049587 Bacteria 4946
232 Ga0501072_0034175 3300049588 Bacteria 3984
233 Ga0501073_0015321 3300049589 Bacteria 5559
234 Ga0501073_0733026 3300049589 Bacteria 682
235 Ga0501074_0008683 3300049590 Bacteria 7361
236 Ga0501076_0022228 3300049592 Bacteria 4873
237 Ga0501076_1022734 3300049592 Unclassified 681
238 Ga0501077_0002211 3300049593 Bacteria 11731
239 Ga0501079_0000163 3300049741 Bacteria 36976
240 Ga0501080_0008751 3300049742 Bacteria 9193
241 Ga0501080_0283816 3300049742 Bacteria 1505
242 Ga0501080_0678570 3300049742 Bacteria 910
243 nmdc:mga08y16_569808_c1 3300050511 Bacteria 1144
244 Ga0500611_014551 3300053727 Bacteria 1375
245 Ga0500611_037481 3300053727 Bacteria 1044
246 Ga0501084_0005157 3300054114 Bacteria 10685
247 Ga0501082_0017185 3300060353 Bacteria 6233
248 Ga0501082_0823861 3300060353 Bacteria 812
249 Ga0068853_100069815
250 Ga0070670_100085400
251 Ga0070677_10011737
252 Ga0070677_10537139
253 Ga0068869_100070574
254 Ga0068869_100153990
255 Ga0068869_100806431
256 Ga0070666_10004026
257 Ga0070682_100029189
258 Ga0070682_100030826
259 Ga0070682_100135333
260 Ga0068868_100009990
261 Ga0068868_100349374
262 Ga0070689_100012028
263 Ga0070689_100111178
264 Ga0070689_100137556
265 Ga0070689_100406618
266 Ga0070691_10550404
267 Ga0070687_100014699
268 Ga0070661_100084492
269 Ga0070668_100550608
270 Ga0070671_100145967
271 Ga0070671_100503840
272 Ga0070673_100115914
273 Ga0070688_100085284
274 Ga0070659_100570737
275 Ga0070667_100107354
276 Ga0070667_101375002
277 Ga0070709_10847183
278 Ga0070710_10733448
279 Ga0070701_10000698
280 Ga0070700_100086172
281 Ga0068867_100695151
282 Ga0070685_10185638
283 Ga0070672_100010979
284 Ga0070672_100011960
285 Ga0070686_100238374
286 Ga0070686_100533233
287 Ga0070695_100228293
288 Ga0070696_100073067
289 Ga0070665_100000769
290 Ga0070665_100042807
291 Ga0070665_100063907
292 Ga0070665_101544093
293 Ga0070704_100208676
294 Ga0068855_100483766
295 Ga0068857_100097254
296 Ga0070702_100039833
297 Ga0068852_100432227
298 Ga0068859_100013707
299 Ga0068859_100015378
300 Ga0068859_100550025
301 Ga0068861_100000511
302 Ga0068861_100003653
303 Ga0068863_100429114
304 Ga0068858_100285312
305 Ga0068860_100006234
306 Ga0068860_100022300
307 Ga0068860_101219090
308 Ga0068862_100022799
309 Ga0068862_100165169
310 Ga0068862_101328370
311 Ga0081455_10001787
312 Ga0070715_10242368
313 Ga0097621_100356924
314 Ga0068871_100026605
315 Ga0068871_100063883
316 Ga0068865_100042826
317 Ga0097620_100013707
318 Ga0097620_100015377
319 Ga0097620_100550094
320 Ga0111539_10636040
321 Ga0105245_10014643
322 Ga0105247_10751430
323 Ga0105242_10053281
324 Ga0105248_10011046
325 Ga0157374_10189230
326 Ga0157378_10010647
327 Ga0157378_11209212
328 Ga0163162_10235625
329 Ga0157375_10008496
330 Ga0157375_10520382
331 Ga0157380_10536438
332 Ga0157379_10009639
333 Ga0157379_10305336
334 Ga0157376_11421219
335 Ga0163161_10335954
336 Ga0207682_10037659
337 Ga0207682_10394877
338 Ga0207692_10572467
339 Ga0207680_10073228
340 Ga0207699_10701741
341 Ga0207707_10003823
342 Ga0207663_10177119
343 Ga0207662_10019630
344 Ga0207662_10943428
345 Ga0207649_10109221
346 Ga0207650_10044352
347 Ga0207659_10622113
348 Ga0207687_10019236
349 Ga0207664_10111688
350 Ga0207644_10043764
351 Ga0207670_10010653
352 Ga0207670_10099074
353 Ga0207670_10446147
354 Ga0207670_11140922
355 Ga0207669_10016502
356 Ga0207669_11204716
357 Ga0207704_10139204
358 Ga0207691_10003602
359 Ga0207691_10054533
360 Ga0207691_10188772
361 Ga0207711_10013932
362 Ga0207689_10135143
363 Ga0207689_10295643
364 Ga0207651_10038985
365 Ga0207651_10518652
366 Ga0207651_10666007
367 Ga0207712_10231348
368 Ga0207668_10317298
369 Ga0207668_10566710
370 Ga0207658_10361988
371 Ga0207677_11068035
372 Ga0207703_10025783
373 Ga0207703_10508277
374 Ga0207639_10053910
375 Ga0207708_10030919
376 Ga0207708_10100007
377 Ga0207708_10110411
378 Ga0207708_10831768
379 Ga0207641_10108939
380 Ga0207641_10290660
381 Ga0207641_11885863
382 Ga0207648_10178119
383 Ga0207676_10157139
384 Ga0207676_10617465
385 Ga0207674_10367766
386 Ga0207675_100002626
387 Ga0207675_100006149
388 Ga0207675_101822555
389 Ga0207683_10020228
390 Ga0207683_10387884
391 Ga0207698_10546297
392 Ga0207698_10719519
393 Ga0268266_10030777
394 Ga0268266_10118148
395 Ga0268266_10421412
396 Ga0268266_10994443
397 Ga0268265_10231918
398 Ga0268265_10553378
399 Ga0268264_10084718
400 Ga0265330_10028235
401 Ga0265328_10143591
402 Ga0307513_10006396
403 Ga0307513_10033769
404 Ga0307513_10492358
405 Ga0307509_10189835
406 Ga0307509_10233416
407 Ga0307509_10646419
408 Ga0307408_100236771
409 Ga0307405_10065656
410 Ga0307405_10193811
411 Ga0307405_10397438
412 Ga0307405_11008188
413 Ga0307413_10015182
414 Ga0307410_10032176
415 Ga0307410_10061537
416 Ga0307406_10079948
417 Ga0307407_10026462
418 Ga0307407_10027655
419 Ga0307412_11034998
420 Ga0307409_100048181
421 Ga0307409_100178401
422 Ga0307409_100615712
423 Ga0307409_100645849
424 Ga0307409_100903577
425 Ga0307416_100042597
426 Ga0307414_11307385
427 Ga0307411_10009960
428 Ga0307411_10062533
429 Ga0307411_10403099
430 Ga0307415_100998169
431 Ga0373943_0519339
432 Ga0436363_0256058
433 Ga0451787_524988
434 Ga0451791_0106137
435 Ga0451791_0270621
436 Ga0451793_1010195
437 Ga0451797_0910996
438 Ga0451795_0626214
439 Ga0451798_0109580
440 Ga0451800_0984903
441 Ga0451802_1220946
442 Ga0451807_2436375
443 Ga0451853_1935205
444 Ga0466972_0162210
445 Ga0466960_0111370
446 Ga0495590_0049007
447 Ga0495590_0228634
448 Ga0495638_0022081
449 Ga0495638_0029853
450 Ga0495638_0148113
451 Ga0495584_0219981
452 Ga0495632_0061063
453 Ga0495625_0027714
454 Ga0495625_0061994
455 Ga0495625_0066687
456 Ga0495649_0006626
457 Ga0495649_0275678
458 Ga0495649_0313918
459 Ga0495686_0123299
460 Ga0495602_0907332
461 Ga0496100_0131723
462 Ga0496101_0064690
463 Ga0496105_0005362
464 Ga0496107_0640579
465 Ga0496108_0013657
466 Ga0496109_0006150
467 Ga0496110_0007250
468 Ga0496111_0038031
469 Ga0501032_0302858
470 Ga0501037_0468593
471 Ga0501038_0238056
472 Ga0501038_0413838
473 Ga0501039_0264624
474 Ga0501042_0261974
475 Ga0501042_0287521
476 Ga0501067_0013623
477 Ga0501068_0002704
478 Ga0501070_0020980
479 Ga0501071_0017481
480 Ga0501072_0034175
481 Ga0501073_0015321
482 Ga0501073_0733026
483 Ga0501074_0008683
484 Ga0501076_0022228
485 Ga0501076_1022734
486 Ga0501077_0002211
487 Ga0501079_0000163
488 Ga0501080_0008751
489 Ga0501080_0283816
490 Ga0501080_0678570
491 nmdc:mga08y16_569808_c1
492 Ga0500611_014551
493 Ga0500611_037481
494 Ga0501084_0005157
495 Ga0501082_0017185
496 Ga0501082_0823861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

33

172

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a4f-assembly1.cif.gz_AC aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.99 12 82
7a4f-assembly1.cif.gz_AI aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.9899 12 82
7a4h-assembly1.cif.gz_BL aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9857 16 82
7a4h-assembly1.cif.gz_BB aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9857 16 82
7a4h-assembly1.cif.gz_BK aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9846 16 82
ID Description Score Start End Superfamily
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9702 16 153 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9648 16 150 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9603 10 156 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.94 10 150 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9344 10 156 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A381R5U4-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9824 12 130 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A357BMM8-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9818 16 155 GO:0000906
GO:0009231
GO:0009349
AF-A0A1W9MTN7-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9818 16 129 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A7Y4WV74-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.981 16 153 GO:0000906
GO:0009231
GO:0009349
AF-A0A2S6FZP6-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9797 16 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Map