F359698

General Info

Members Datasets Scaffolds Average Seq Length
248 162 247 425

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100000351|Ga0070663_10000035116
Length 465
Sequence MAGSERDGKGGTRSYDAVIVGGSLAGCATAMFLGRAGARVAVVEKSPDPAAFKRICSHFIQASAVPTLARLDLLEPMEAAGAVRPRFHARVPWGWIEAPPERAGRGVNLRRSKLDPMLREHAAATPGVELLLGQTVREVRRAGAAVTGIVARDRDGVETVIEAPLTIGADGRDSSVVGLAGVKEKTYPHGRFAYGGYFEGVALRHAPDASVWMMDPDWAAAFPTDDGLIFCAVMPTKDRLPEFKADPVAAMIDYFDQAPEAPSLRSATLSDEGVLGKIDMTNRMRTPTAPGLALIGDAALATDPLFGIGCGWAFQTAEWLADSVAPALRGEEALEAGLRRYRRKHGRRLRGHAWMIHDYATGRKLQPPERLIFSAAARDPRVATIFDAFGTRRIGAARMIATATPLALAVNARYALARRRGRVGAAPPSVDPGRGTEPLDLGNPVGDKGLRVESERAGAGAGKAA

Samples

Sample ID Description Type Environment
1 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 12.1
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10180663 3300005327 Bacteria 1775
2 Ga0070677_10000003 3300005333 Bacteria 81204
3 Ga0070666_10046278 3300005335 Bacteria 2917
4 Ga0070682_100000080 3300005337 Bacteria 85683
5 Ga0070660_100012354 3300005339 Bacteria 6096
6 Ga0070660_100060707 3300005339 Bacteria 2935
7 Ga0070689_100039557 3300005340 Bacteria 3611
8 Ga0070661_100000005 3300005344 Bacteria 220455
9 Ga0070669_100049623 3300005353 Bacteria 3064
10 Ga0070688_100002150 3300005365 Bacteria 9926
11 Ga0070688_100080637 3300005365 Bacteria 2105
12 Ga0070659_100000176 3300005366 Bacteria 49062
13 Ga0070667_100096572 3300005367 Bacteria 2548
14 Ga0070710_10000013 3300005437 Bacteria 117825
15 Ga0070663_100000351 3300005455 Bacteria 24141
16 Ga0070678_100031711 3300005456 Bacteria 3650
17 Ga0070685_10000293 3300005466 Bacteria 31562
18 Ga0070679_100000621 3300005530 Bacteria 30165
19 Ga0070679_100156979 3300005530 Bacteria 2250
20 Ga0070684_100010988 3300005535 Bacteria 7200
21 Ga0070684_100272442 3300005535 Bacteria 1550
22 Ga0068853_100017989 3300005539 Bacteria 5842
23 Ga0070665_100000159 3300005548 Bacteria 122613
24 Ga0070665_100038015 3300005548 Bacteria 4838
25 Ga0070665_100270192 3300005548 Bacteria 1702
26 Ga0070665_100283038 3300005548 Bacteria 1660
27 Ga0070664_100017602 3300005564 Bacteria 5868
28 Ga0068854_100001309 3300005578 Bacteria 15008
29 Ga0068854_100012477 3300005578 Bacteria 5567
30 Ga0068856_100001818 3300005614 Bacteria 22286
31 Ga0068856_100061013 3300005614 Unclassified 3725
32 Ga0068852_100000012 3300005616 Bacteria 140734
33 Ga0068852_100012338 3300005616 Bacteria 6482
34 Ga0068864_100135206 3300005618 Bacteria 2219
35 Ga0068851_10000988 3300005834 Bacteria 12307
36 Ga0068851_10003390 3300005834 Bacteria 7091
37 Ga0068858_100000049 3300005842 Bacteria 122693
38 Ga0068860_100134907 3300005843 Unclassified 2370
39 Ga0081455_10008871 3300005937 Bacteria 10397
40 Ga0081455_10046454 3300005937 Bacteria 3766
41 Ga0070717_10000061 3300006028 Bacteria 92257
42 Ga0075363_100007796 3300006048 Bacteria 4947
43 Ga0070712_100000013 3300006175 Bacteria 109912
44 Ga0075430_100063550 3300006846 Bacteria 3100
45 Ga0075430_100181239 3300006846 Bacteria 1752
46 Ga0075431_100026114 3300006847 Bacteria 5990
47 Ga0075434_100335577 3300006871 Unclassified 1532
48 Ga0105240_10117472 3300009093 Bacteria 3206
49 Ga0105240_10273722 3300009093 Bacteria 1943
50 Ga0105245_10000056 3300009098 Bacteria 124109
51 Ga0105245_10001521 3300009098 Bacteria 20984
52 Ga0105248_10000032 3300009177 Bacteria 201114
53 Ga0105238_10058611 3300009551 Bacteria 3859
54 Ga0105238_10196868 3300009551 Bacteria 1991
55 Ga0105249_10000073 3300009553 Bacteria 145660
56 Ga0105239_10051668 3300010375 Bacteria 4505
57 Ga0105239_10057805 3300010375 Bacteria 4255
58 Ga0105239_10106580 3300010375 Bacteria 3105
59 Ga0105246_10036406 3300011119 Bacteria 3296
60 Ga0157371_10041322 3300013102 Bacteria 3291
61 Ga0157370_10007487 3300013104 Bacteria 11859
62 Ga0157369_10000099 3300013105 Bacteria 120032
63 Ga0157374_10397026 3300013296 Unclassified 1375
64 Ga0157378_10060368 3300013297 Bacteria 3384
65 Ga0157372_10000473 3300013307 Bacteria 44380
66 Ga0157372_10154719 3300013307 Bacteria 2648
67 Ga0157380_10000219 3300014326 Bacteria 34156
68 Ga0157376_10023389 3300014969 Bacteria 4835
69 Ga0207656_10000559 3300025321 Bacteria 12340
70 Ga0207682_10000052 3300025893 Bacteria 49191
71 Ga0207692_10000003 3300025898 Bacteria 431531
72 Ga0207680_10002095 3300025903 Bacteria 9346
73 Ga0207680_10008327 3300025903 Bacteria 5082
74 Ga0207680_10019278 3300025903 Bacteria 3645
75 Ga0207705_10050776 3300025909 Bacteria 2986
76 Ga0207695_10057217 3300025913 Bacteria 4052
77 Ga0207695_10181305 3300025913 Bacteria 2026
78 Ga0207693_10000046 3300025915 Bacteria 100888
79 Ga0207663_10003689 3300025916 Bacteria 7528
80 Ga0207657_10074329 3300025919 Bacteria 2870
81 Ga0207657_10106871 3300025919 Bacteria 2315
82 Ga0207649_10000005 3300025920 Bacteria 356179
83 Ga0207652_10000523 3300025921 Bacteria 38967
84 Ga0207652_10126483 3300025921 Bacteria 2277
85 Ga0207687_10000007 3300025927 Bacteria 604185
86 Ga0207687_10000970 3300025927 Bacteria 19492
87 Ga0207690_10000069 3300025932 Bacteria 90520
88 Ga0207670_10028350 3300025936 Bacteria 3554
89 Ga0207711_10000020 3300025941 Bacteria 363325
90 Ga0207711_10271315 3300025941 Bacteria 1561
91 Ga0207679_10010348 3300025945 Bacteria 6002
92 Ga0207712_10000003 3300025961 Bacteria 615314
93 Ga0207640_10000137 3300025981 Bacteria 54133
94 Ga0207640_10008904 3300025981 Bacteria 5593
95 Ga0207703_10000067 3300026035 Bacteria 125623
96 Ga0207639_10001160 3300026041 Bacteria 17875
97 Ga0207678_10000445 3300026067 Bacteria 37602
98 Ga0207678_10042224 3300026067 Bacteria 3952
99 Ga0207702_10000016 3300026078 Bacteria 226633
100 Ga0207683_10005133 3300026121 Bacteria 11241
101 Ga0207698_10000012 3300026142 Bacteria 260061
102 Ga0207698_10008710 3300026142 Bacteria 6432
103 Ga0268266_10000023 3300028379 Bacteria 501899
104 Ga0268266_10000553 3300028379 Bacteria 52199
105 Ga0268266_10003282 3300028379 Bacteria 16272
106 Ga0268266_10164897 3300028379 Bacteria 2006
107 Ga0268266_10243079 3300028379 Bacteria 1662
108 Ga0268264_10162362 3300028381 Unclassified 2014
109 Ga0265326_10000005 3300028558 Bacteria 257124
110 Ga0265334_10000024 3300028573 Bacteria 118525
111 Ga0265338_10002617 3300028800 Bacteria 26582
112 Ga0265324_10000801 3300029957 Bacteria 20607
113 Ga0265327_10043234 3300031251 Bacteria 2413
114 Ga0307409_100145196 3300031995 Bacteria 2051
115 Ga0373937_0300984 3300036401 Bacteria 1516
116 Ga0466957_0003292 3300044842 Bacteria 8849
117 Ga0466967_0000344 3300045976 Bacteria 21424
118 Ga0466967_0016029 3300045976 Bacteria 5895
119 Ga0466967_0252878 3300045976 Unclassified 1684
120 Ga0495629_0017940 3300046459 Bacteria 5073
121 Ga0495641_0001080 3300046461 Bacteria 23509
122 Ga0495641_0022727 3300046461 Bacteria 3132
123 Ga0495641_0034960 3300046461 Bacteria 2372
124 Ga0495582_0030119 3300046473 Bacteria 2978
125 Ga0495662_0005879 3300046476 Bacteria 6135
126 Ga0495606_0000211 3300046507 Bacteria 103386
127 Ga0495608_0042926 3300046511 Bacteria 3023
128 Ga0495610_0058825 3300046512 Bacteria 1837
129 Ga0495620_0000315 3300046515 Bacteria 34463
130 Ga0495628_0000170 3300046516 Bacteria 56830
131 Ga0495630_0000025 3300046517 Bacteria 152364
132 Ga0495630_0000548 3300046517 Bacteria 27475
133 Ga0495630_0014637 3300046517 Bacteria 5717
134 Ga0495666_0024018 3300046526 Bacteria 3015
135 Ga0495652_0000018 3300046529 Bacteria 201634
136 Ga0495652_0008276 3300046529 Bacteria 9507
137 Ga0495587_0001931 3300046536 Bacteria 13803
138 Ga0495645_0017534 3300046543 Bacteria 5129
139 Ga0495645_0025204 3300046543 Bacteria 4315
140 Ga0495667_0000015 3300046559 Bacteria 200377
141 Ga0495667_0166305 3300046559 Unclassified 1418
142 Ga0495634_0000592 3300046642 Bacteria 35197
143 Ga0495634_0016468 3300046642 Bacteria 5288
144 Ga0495635_0009609 3300046663 Bacteria 6762
145 Ga0495588_0000311 3300046674 Bacteria 33416
146 Ga0495657_0000006 3300046675 Bacteria 250610
147 Ga0495657_0019635 3300046675 Bacteria 4874
148 Ga0495647_0000037 3300046681 Bacteria 42482
149 Ga0495647_0000289 3300046681 Bacteria 14023
150 Ga0495658_0010179 3300046683 Bacteria 4701
151 Ga0495624_0000028 3300046690 Bacteria 93474
152 Ga0495624_0000686 3300046690 Bacteria 26537
153 Ga0495676_0059751 3300047321 Unclassified 2992
154 Ga0495676_0077855 3300047321 Bacteria 2527
155 Ga0495680_0000421 3300047322 Bacteria 47432
156 Ga0495680_0001079 3300047322 Bacteria 30239
157 Ga0495686_0000020 3300047472 Bacteria 429191
158 Ga0495593_0072908 3300047673 Unclassified 1782
159 Ga0495602_0000364 3300048088 Bacteria 42346
160 Ga0495602_0178416 3300048088 Unclassified 1641
161 Ga0496100_0000392 3300048903 Bacteria 21271
162 Ga0496101_0003096 3300048904 Bacteria 10287
163 Ga0496102_0009403 3300048905 Bacteria 8400
164 Ga0496102_0117842 3300048905 Bacteria 2478
165 Ga0496102_0231527 3300048905 Unclassified 1742
166 Ga0496104_0012516 3300048907 Bacteria 7629
167 Ga0496104_0018901 3300048907 Bacteria 6294
168 Ga0496105_0000848 3300048908 Bacteria 20845
169 Ga0496108_0000599 3300048911 Bacteria 28272
170 Ga0496108_0021107 3300048911 Bacteria 5351
171 Ga0496108_0041149 3300048911 Bacteria 3856
172 Ga0496108_0062983 3300048911 Bacteria 3123
173 Ga0496109_0000252 3300048912 Bacteria 51599
174 Ga0496109_0001762 3300048912 Bacteria 17990
175 Ga0496109_0006800 3300048912 Bacteria 9636
176 Ga0496110_0000386 3300048913 Bacteria 29667
177 Ga0496110_0001522 3300048913 Bacteria 16827
178 Ga0496110_0040710 3300048913 Bacteria 4051
179 Ga0496111_0000225 3300048914 Bacteria 26948
180 Ga0496111_0002432 3300048914 Bacteria 11239
181 Ga0496112_0000013 3300048915 Bacteria 237194
182 Ga0496112_0000095 3300048915 Bacteria 57431
183 Ga0496112_0000362 3300048915 Bacteria 29649
184 Ga0496112_0003640 3300048915 Bacteria 12838
185 Ga0496112_0076733 3300048915 Bacteria 3305
186 Ga0496113_0000127 3300048916 Bacteria 33059
187 Ga0496113_0035195 3300048916 Bacteria 3661
188 Ga0496113_0071532 3300048916 Bacteria 2638
189 Ga0496114_0032906 3300048917 Bacteria 4270
190 Ga0496114_0228846 3300048917 Unclassified 1633
191 Ga0496116_0000447 3300048919 Bacteria 57650
192 Ga0496117_0001787 3300048920 Bacteria 29372
193 Ga0496117_0048935 3300048920 Bacteria 3013
194 Ga0496118_0000971 3300048921 Bacteria 44781
195 Ga0496119_0000432 3300048922 Bacteria 57656
196 Ga0496119_0002987 3300048922 Bacteria 17953
197 Ga0496119_0021819 3300048922 Bacteria 4610
198 Ga0496119_0022620 3300048922 Bacteria 4492
199 Ga0496120_0004598 3300048923 Bacteria 11476
200 Ga0496121_0009948 3300048924 Bacteria 10825
201 Ga0496121_0010860 3300048924 Bacteria 10183
202 Ga0496125_0023368 3300048928 Bacteria 5707
203 Ga0496125_0032004 3300048928 Bacteria 4678
204 Ga0501031_0011404 3300049568 Bacteria 5786
205 Ga0501032_0013973 3300049569 Bacteria 5696
206 Ga0501032_0154713 3300049569 Bacteria 1507
207 Ga0501033_0002182 3300049570 Bacteria 16893
208 Ga0501034_0026016 3300049571 Bacteria 5960
209 Ga0501034_0103344 3300049571 Bacteria 2843
210 Ga0501036_0019236 3300049572 Bacteria 5729
211 Ga0501037_0015089 3300049573 Bacteria 5681
212 Ga0501038_0047373 3300049574 Bacteria 3723
213 Ga0501039_0016002 3300049575 Bacteria 5744
214 Ga0501043_0017752 3300049579 Bacteria 5578
215 Ga0501043_0064733 3300049579 Bacteria 2871
216 Ga0501046_0018485 3300049580 Bacteria 5798
217 Ga0501047_0002662 3300049581 Bacteria 16994
218 Ga0501047_0022089 3300049581 Bacteria 6112
219 Ga0501047_0026105 3300049581 Bacteria 5618
220 Ga0501048_0015101 3300049582 Bacteria 5706
221 Ga0501068_0022145 3300049584 Bacteria 3713
222 Ga0501068_0096694 3300049584 Unclassified 1827
223 Ga0501069_0012803 3300049585 Bacteria 4465
224 Ga0501070_0002268 3300049586 Bacteria 16901
225 Ga0501071_0080215 3300049587 Bacteria 2386
226 Ga0501072_0017794 3300049588 Bacteria 5465
227 Ga0501073_0003176 3300049589 Bacteria 12327
228 Ga0501074_0016275 3300049590 Bacteria 5400
229 Ga0501074_0032533 3300049590 Bacteria 3778
230 Ga0501074_0050817 3300049590 Unclassified 2992
231 Ga0501079_0017114 3300049741 Bacteria 5536
232 Ga0501080_0094264 3300049742 Unclassified 2780
233 Ga0501083_0035624 3300049744 Bacteria 3398
234 Ga0501083_0062463 3300049744 Bacteria 2485
235 Ga0501035_0002777 3300049822 Bacteria 16952
236 Ga0501044_0009059 3300049823 Bacteria 10877
237 Ga0501044_0016674 3300049823 Bacteria 7888
238 Ga0501045_0014626 3300049824 Bacteria 5564
239 nmdc:mga03n38_7213_c1 3300050490 Bacteria 3919
240 nmdc:mga0qj67_20605_c1 3300050509 Bacteria 5051
241 Ga0495601_0000086 3300053077 Bacteria 50421
242 Ga0495612_0010338 3300053078 Bacteria 3777
243 Ga0495612_0048408 3300053078 Bacteria 1743
244 Ga0495619_0000022 3300053085 Bacteria 184144
245 Ga0495619_0001988 3300053085 Bacteria 13616
246 Ga0495619_0087761 3300053085 Bacteria 2103
247 Ga0500614_000389 3300053123 Bacteria 11425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0154713 Ga0501032_0154713_16_1173 341
2 3300036401 Ga0373937_0300984 Ga0373937_0300984_11_1120 350
3 3300009551 Ga0105238_10058611 Ga0105238_100586113 376
4 3300010375 Ga0105239_10106580 Ga0105239_101065801 376
5 3300013307 Ga0157372_10154719 Ga0157372_101547193 376
6 3300031995 Ga0307409_100145196 Ga0307409_1001451962 376
7 3300048911 Ga0496108_0041149 Ga0496108_0041149_217_1386 376
8 3300048912 Ga0496109_0006800 Ga0496109_0006800_6160_7329 376
9 3300048913 Ga0496110_0040710 Ga0496110_0040710_2521_3690 376
10 3300048915 Ga0496112_0003640 Ga0496112_0003640_10542_11711 376
11 3300048916 Ga0496113_0071532 Ga0496113_0071532_30_1223 376
12 3300050490 nmdc:mga03n38_7213_c1 nmdc:mga03n38_7213_c1_189_1358 376
13 3300013296 Ga0157374_10397026 Ga0157374_103970262 377
14 3300048924 Ga0496121_0009948 Ga0496121_0009948_4719_6029 379
15 3300047322 Ga0495680_0000421 Ga0495680_0000421_30694_31965 381
16 3300005578 Ga0068854_100012477 Ga0068854_1000124773 382
17 3300025981 Ga0207640_10008904 Ga0207640_100089044 382
18 3300028381 Ga0268264_10162362 Ga0268264_101623622 382
19 3300005333 Ga0070677_10000003 Ga0070677_1000000354 384
20 3300005614 Ga0068856_100061013 Ga0068856_1000610132 384
21 3300025893 Ga0207682_10000052 Ga0207682_1000005231 384
22 3300046476 Ga0495662_0005879 Ga0495662_0005879_3735_5006 384
23 3300046507 Ga0495606_0000211 Ga0495606_0000211_74600_75832 384
24 3300011119 Ga0105246_10036406 Ga0105246_100364063 386
25 3300013102 Ga0157371_10041322 Ga0157371_100413222 387
26 3300048907 Ga0496104_0018901 Ga0496104_0018901_4965_6179 387
27 3300048908 Ga0496105_0000848 Ga0496105_0000848_2872_4086 387
28 3300048922 Ga0496119_0002987 Ga0496119_0002987_6702_7916 387
29 3300048924 Ga0496121_0010860 Ga0496121_0010860_6918_8132 387
30 3300048928 Ga0496125_0032004 Ga0496125_0032004_1362_2576 387
31 3300025913 Ga0207695_10181305 Ga0207695_101813052 389
32 3300005843 Ga0068860_100134907 Ga0068860_1001349072 390
33 3300046515 Ga0495620_0000315 Ga0495620_0000315_23354_24658 390
34 3300047472 Ga0495686_0000020 Ga0495686_0000020_288842_290056 390
35 3300045976 Ga0466967_0016029 Ga0466967_0016029_155_1411 392
36 3300026067 Ga0207678_10042224 Ga0207678_100422243 394
37 3300045976 Ga0466967_0252878 Ga0466967_0252878_189_1388 395
38 3300046461 Ga0495641_0034960 Ga0495641_0034960_325_1563 396
39 3300046473 Ga0495582_0030119 Ga0495582_0030119_1710_2948 396
40 3300046526 Ga0495666_0024018 Ga0495666_0024018_209_1447 396
41 3300046559 Ga0495667_0166305 Ga0495667_0166305_129_1367 396
42 3300047321 Ga0495676_0077855 Ga0495676_0077855_687_1925 396
43 3300005548 Ga0070665_100283038 Ga0070665_1002830382 397
44 3300005618 Ga0068864_100135206 Ga0068864_1001352063 397
45 3300006048 Ga0075363_100007796 Ga0075363_1000077965 397
46 3300048905 Ga0496102_0231527 Ga0496102_0231527_37_1290 401
47 3300048907 Ga0496104_0012516 Ga0496104_0012516_547_1800 401
48 3300048911 Ga0496108_0000599 Ga0496108_0000599_4957_6210 401
49 3300048912 Ga0496109_0001762 Ga0496109_0001762_6525_7778 401
50 3300048913 Ga0496110_0001522 Ga0496110_0001522_10888_12141 401
51 3300048914 Ga0496111_0002432 Ga0496111_0002432_9330_10583 401
52 3300048917 Ga0496114_0228846 Ga0496114_0228846_32_1285 401
53 3300006846 Ga0075430_100063550 Ga0075430_1000635504 402
54 3300006847 Ga0075431_100026114 Ga0075431_1000261146 402
55 3300044842 Ga0466957_0003292 Ga0466957_0003292_3308_4567 402
56 3300050509 nmdc:mga0qj67_20605_c1 nmdc:mga0qj67_20605_c1_2833_4053 402
57 3300006871 Ga0075434_100335577 Ga0075434_1003355772 403
58 3300013297 Ga0157378_10060368 Ga0157378_100603683 403
59 3300005535 Ga0070684_100010988 Ga0070684_1000109883 404
60 iso_pu_bacteria 2829745981 2829747269 404
61 3300005339 Ga0070660_100060707 Ga0070660_1000607073 405
62 3300005530 Ga0070679_100156979 Ga0070679_1001569791 405
63 3300025919 Ga0207657_10074329 Ga0207657_100743292 405
64 3300025921 Ga0207652_10126483 Ga0207652_101264833 405
65 3300005616 Ga0068852_100012338 Ga0068852_1000123384 407
66 3300009551 Ga0105238_10196868 Ga0105238_101968682 407
67 3300026142 Ga0207698_10008710 Ga0207698_100087104 407
68 3300005937 Ga0081455_10008871 Ga0081455_100088718 408
69 3300005937 Ga0081455_10046454 Ga0081455_100464543 408
70 3300049581 Ga0501047_0022089 Ga0501047_0022089_3327_4631 408
71 3300045976 Ga0466967_0000344 Ga0466967_0000344_18810_20072 409
72 3300005344 Ga0070661_100000005 Ga0070661_100000005190 410
73 3300005548 Ga0070665_100038015 Ga0070665_1000380154 410
74 3300025903 Ga0207680_10002095 Ga0207680_100020956 410
75 3300025920 Ga0207649_10000005 Ga0207649_10000005333 410
76 3300028379 Ga0268266_10000553 Ga0268266_1000055315 410
77 3300046459 Ga0495629_0017940 Ga0495629_0017940_1449_2681 410
78 3300046512 Ga0495610_0058825 Ga0495610_0058825_454_1686 410
79 3300046674 Ga0495588_0000311 Ga0495588_0000311_12110_13342 410
80 3300048905 Ga0496102_0009403 Ga0496102_0009403_6998_8278 410
81 3300048905 Ga0496102_0117842 Ga0496102_0117842_562_1914 410
82 3300048917 Ga0496114_0032906 Ga0496114_0032906_1207_2439 410
83 3300048919 Ga0496116_0000447 Ga0496116_0000447_41418_42752 410
84 3300048920 Ga0496117_0001787 Ga0496117_0001787_15607_16959 410
85 3300048920 Ga0496117_0048935 Ga0496117_0048935_52_1386 410
86 3300048921 Ga0496118_0000971 Ga0496118_0000971_25974_27326 410
87 3300048922 Ga0496119_0000432 Ga0496119_0000432_41418_42752 410
88 3300048922 Ga0496119_0021819 Ga0496119_0021819_716_2080 410
89 3300048922 Ga0496119_0022620 Ga0496119_0022620_1525_2850 410
90 3300048923 Ga0496120_0004598 Ga0496120_0004598_6181_7506 410
91 3300048928 Ga0496125_0023368 Ga0496125_0023368_1764_3056 410
92 3300049590 Ga0501074_0016275 Ga0501074_0016275_1498_2829 410
93 3300005539 Ga0068853_100017989 Ga0068853_1000179894 412
94 3300026041 Ga0207639_10001160 Ga0207639_1000116019 412
95 3300005548 Ga0070665_100000159 Ga0070665_100000159116 413
96 3300005842 Ga0068858_100000049 Ga0068858_10000004927 413
97 3300009553 Ga0105249_10000073 Ga0105249_10000073104 413
98 3300025961 Ga0207712_10000003 Ga0207712_10000003461 413
99 3300026035 Ga0207703_10000067 Ga0207703_100000677 413
100 3300028379 Ga0268266_10000023 Ga0268266_10000023336 413
101 3300046461 Ga0495641_0001080 Ga0495641_0001080_3173_4477 413
102 3300046511 Ga0495608_0042926 Ga0495608_0042926_1158_2462 413
103 3300049571 Ga0501034_0103344 Ga0501034_0103344_556_1944 413
104 3300053077 Ga0495601_0000086 Ga0495601_0000086_26390_27694 413
105 3300053123 Ga0500614_000389 Ga0500614_000389_8407_9711 413
106 3300006846 Ga0075430_100181239 Ga0075430_1001812392 414
107 3300046529 Ga0495652_0000018 Ga0495652_0000018_184730_185992 414
108 3300005335 Ga0070666_10046278 Ga0070666_100462782 415
109 3300005367 Ga0070667_100096572 Ga0070667_1000965721 415
110 3300005455 Ga0070663_100000351 Ga0070663_10000035116 415
111 3300005530 Ga0070679_100000621 Ga0070679_10000062114 415
112 3300005564 Ga0070664_100017602 Ga0070664_1000176026 415
113 3300009093 Ga0105240_10273722 Ga0105240_102737222 415
114 3300010375 Ga0105239_10057805 Ga0105239_100578052 415
115 3300014326 Ga0157380_10000219 Ga0157380_100002197 415
116 3300025903 Ga0207680_10008327 Ga0207680_100083274 415
117 3300025903 Ga0207680_10019278 Ga0207680_100192783 415
118 3300025921 Ga0207652_10000523 Ga0207652_1000052321 415
119 3300025945 Ga0207679_10010348 Ga0207679_100103482 415
120 3300026067 Ga0207678_10000445 Ga0207678_1000044529 415
121 3300028379 Ga0268266_10003282 Ga0268266_1000328212 415
122 3300028379 Ga0268266_10164897 Ga0268266_101648972 415
123 3300046642 Ga0495634_0016468 Ga0495634_0016468_3852_5156 415
124 3300048911 Ga0496108_0062983 Ga0496108_0062983_52_1350 415
125 3300048915 Ga0496112_0076733 Ga0496112_0076733_1226_2530 415
126 3300048916 Ga0496113_0035195 Ga0496113_0035195_2246_3550 415
127 3300049568 Ga0501031_0011404 Ga0501031_0011404_1274_2632 415
128 3300049569 Ga0501032_0013973 Ga0501032_0013973_1284_2642 415
129 3300049570 Ga0501033_0002182 Ga0501033_0002182_1344_2702 415
130 3300049571 Ga0501034_0026016 Ga0501034_0026016_3299_4657 415
131 3300049572 Ga0501036_0019236 Ga0501036_0019236_3084_4442 415
132 3300049573 Ga0501037_0015089 Ga0501037_0015089_3050_4408 415
133 3300049574 Ga0501038_0047373 Ga0501038_0047373_1071_2429 415
134 3300049575 Ga0501039_0016002 Ga0501039_0016002_1262_2620 415
135 3300049579 Ga0501043_0017752 Ga0501043_0017752_1201_2559 415
136 3300049579 Ga0501043_0064733 Ga0501043_0064733_648_1955 415
137 3300049580 Ga0501046_0018485 Ga0501046_0018485_1416_2774 415
138 3300049581 Ga0501047_0002662 Ga0501047_0002662_14251_15609 415
139 3300049582 Ga0501048_0015101 Ga0501048_0015101_3088_4446 415
140 3300049584 Ga0501068_0022145 Ga0501068_0022145_1281_2639 415
141 3300049584 Ga0501068_0096694 Ga0501068_0096694_474_1781 415
142 3300049585 Ga0501069_0012803 Ga0501069_0012803_1681_2988 415
143 3300049586 Ga0501070_0002268 Ga0501070_0002268_14183_15541 415
144 3300049587 Ga0501071_0080215 Ga0501071_0080215_458_1816 415
145 3300049588 Ga0501072_0017794 Ga0501072_0017794_1114_2472 415
146 3300049589 Ga0501073_0003176 Ga0501073_0003176_3160_4518 415
147 3300049590 Ga0501074_0032533 Ga0501074_0032533_991_2349 415
148 3300049590 Ga0501074_0050817 Ga0501074_0050817_479_1786 415
149 3300049741 Ga0501079_0017114 Ga0501079_0017114_2921_4279 415
150 3300049742 Ga0501080_0094264 Ga0501080_0094264_100_1500 415
151 3300049744 Ga0501083_0035624 Ga0501083_0035624_1196_2554 415
152 3300049744 Ga0501083_0062463 Ga0501083_0062463_898_2205 415
153 3300049822 Ga0501035_0002777 Ga0501035_0002777_14200_15558 415
154 3300049823 Ga0501044_0009059 Ga0501044_0009059_3393_4751 415
155 3300049823 Ga0501044_0016674 Ga0501044_0016674_880_2187 415
156 3300049824 Ga0501045_0014626 Ga0501045_0014626_1326_2684 415
157 3300014969 Ga0157376_10023389 Ga0157376_100233893 416
158 3300046559 Ga0495667_0000015 Ga0495667_0000015_29809_31098 416
159 3300046642 Ga0495634_0000592 Ga0495634_0000592_8657_9961 416
160 3300047322 Ga0495680_0001079 Ga0495680_0001079_25587_26876 416
161 3300005437 Ga0070710_10000013 Ga0070710_100000134 417
162 3300006028 Ga0070717_10000061 Ga0070717_1000006147 417
163 3300009093 Ga0105240_10117472 Ga0105240_101174723 417
164 3300025898 Ga0207692_10000003 Ga0207692_10000003174 417
165 3300025913 Ga0207695_10057217 Ga0207695_100572172 417
166 3300025916 Ga0207663_10003689 Ga0207663_100036893 417
167 3300028558 Ga0265326_10000005 Ga0265326_1000000593 417
168 3300028573 Ga0265334_10000024 Ga0265334_1000002459 417
169 3300028800 Ga0265338_10002617 Ga0265338_1000261723 417
170 3300029957 Ga0265324_10000801 Ga0265324_1000080113 417
171 3300031251 Ga0265327_10043234 Ga0265327_100432342 417
172 3300046516 Ga0495628_0000170 Ga0495628_0000170_2350_3654 417
173 3300046517 Ga0495630_0000025 Ga0495630_0000025_15255_16514 417
174 3300046517 Ga0495630_0014637 Ga0495630_0014637_3879_5186 417
175 3300046529 Ga0495652_0008276 Ga0495652_0008276_5994_7301 417
176 3300046543 Ga0495645_0017534 Ga0495645_0017534_2861_4168 417
177 3300046543 Ga0495645_0025204 Ga0495645_0025204_405_1712 417
178 3300046663 Ga0495635_0009609 Ga0495635_0009609_4594_5904 417
179 3300046675 Ga0495657_0019635 Ga0495657_0019635_100_1407 417
180 3300046681 Ga0495647_0000037 Ga0495647_0000037_6031_7344 417
181 3300046690 Ga0495624_0000028 Ga0495624_0000028_31267_32580 417
182 3300048088 Ga0495602_0000364 Ga0495602_0000364_3867_5171 417
183 3300048088 Ga0495602_0178416 Ga0495602_0178416_12_1319 417
184 3300048903 Ga0496100_0000392 Ga0496100_0000392_5340_6644 417
185 3300048904 Ga0496101_0003096 Ga0496101_0003096_3627_4931 417
186 3300048915 Ga0496112_0000013 Ga0496112_0000013_151876_153192 417
187 3300049581 Ga0501047_0026105 Ga0501047_0026105_1243_2646 417
188 3300053078 Ga0495612_0048408 Ga0495612_0048408_290_1669 417
189 3300053085 Ga0495619_0001988 Ga0495619_0001988_7902_9212 417
190 3300053085 Ga0495619_0087761 Ga0495619_0087761_268_1572 417
191 3300005535 Ga0070684_100272442 Ga0070684_1002724422 418
192 3300006175 Ga0070712_100000013 Ga0070712_10000001387 418
193 3300025915 Ga0207693_10000046 Ga0207693_1000004618 418
194 3300046517 Ga0495630_0000548 Ga0495630_0000548_8662_10011 418
195 3300046675 Ga0495657_0000006 Ga0495657_0000006_216096_217445 418
196 3300048915 Ga0496112_0000095 Ga0496112_0000095_39738_41063 418
197 3300005327 Ga0070658_10180663 Ga0070658_101806632 419
198 3300005337 Ga0070682_100000080 Ga0070682_10000008041 419
199 3300005339 Ga0070660_100012354 Ga0070660_1000123546 419
200 3300005340 Ga0070689_100039557 Ga0070689_1000395573 419
201 3300005353 Ga0070669_100049623 Ga0070669_1000496232 419
202 3300005365 Ga0070688_100002150 Ga0070688_1000021505 419
203 3300005365 Ga0070688_100080637 Ga0070688_1000806371 419
204 3300005366 Ga0070659_100000176 Ga0070659_10000017615 419
205 3300005456 Ga0070678_100031711 Ga0070678_1000317112 419
206 3300005466 Ga0070685_10000293 Ga0070685_100002936 419
207 3300005548 Ga0070665_100270192 Ga0070665_1002701922 419
208 3300005578 Ga0068854_100001309 Ga0068854_10000130915 419
209 3300005614 Ga0068856_100001818 Ga0068856_1000018184 419
210 3300005616 Ga0068852_100000012 Ga0068852_100000012133 419
211 3300005834 Ga0068851_10000988 Ga0068851_100009886 419
212 3300005834 Ga0068851_10003390 Ga0068851_100033907 419
213 3300009098 Ga0105245_10000056 Ga0105245_1000005628 419
214 3300009098 Ga0105245_10001521 Ga0105245_1000152112 419
215 3300009177 Ga0105248_10000032 Ga0105248_1000003293 419
216 3300010375 Ga0105239_10051668 Ga0105239_100516684 419
217 3300013104 Ga0157370_10007487 Ga0157370_100074874 419
218 3300013105 Ga0157369_10000099 Ga0157369_1000009949 419
219 3300013307 Ga0157372_10000473 Ga0157372_1000047310 419
220 3300025321 Ga0207656_10000559 Ga0207656_100005598 419
221 3300025909 Ga0207705_10050776 Ga0207705_100507763 419
222 3300025919 Ga0207657_10106871 Ga0207657_101068713 419
223 3300025927 Ga0207687_10000007 Ga0207687_1000000794 419
224 3300025927 Ga0207687_10000970 Ga0207687_100009702 419
225 3300025932 Ga0207690_10000069 Ga0207690_1000006915 419
226 3300025936 Ga0207670_10028350 Ga0207670_100283503 419
227 3300025941 Ga0207711_10000020 Ga0207711_10000020281 419
228 3300025941 Ga0207711_10271315 Ga0207711_102713152 419
229 3300025981 Ga0207640_10000137 Ga0207640_1000013745 419
230 3300026078 Ga0207702_10000016 Ga0207702_1000001683 419
231 3300026121 Ga0207683_10005133 Ga0207683_1000513310 419
232 3300026142 Ga0207698_10000012 Ga0207698_10000012252 419
233 3300028379 Ga0268266_10243079 Ga0268266_102430792 419
234 3300046461 Ga0495641_0022727 Ga0495641_0022727_1694_2953 419
235 3300046536 Ga0495587_0001931 Ga0495587_0001931_3967_5226 419
236 3300046681 Ga0495647_0000289 Ga0495647_0000289_5561_6820 419
237 3300046683 Ga0495658_0010179 Ga0495658_0010179_3224_4483 419
238 3300046690 Ga0495624_0000686 Ga0495624_0000686_3667_4926 419
239 3300047321 Ga0495676_0059751 Ga0495676_0059751_66_1325 419
240 3300047673 Ga0495593_0072908 Ga0495593_0072908_444_1703 419
241 3300048911 Ga0496108_0021107 Ga0496108_0021107_3204_4502 419
242 3300048912 Ga0496109_0000252 Ga0496109_0000252_3461_4759 419
243 3300048913 Ga0496110_0000386 Ga0496110_0000386_4653_5912 419
244 3300048914 Ga0496111_0000225 Ga0496111_0000225_20783_22042 419
245 3300048915 Ga0496112_0000362 Ga0496112_0000362_1927_3186 419
246 3300048916 Ga0496113_0000127 Ga0496113_0000127_26488_27747 419
247 3300053078 Ga0495612_0010338 Ga0495612_0010338_2405_3664 419
248 3300053085 Ga0495619_0000022 Ga0495619_0000022_110923_112182 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

19

52

0.96

PF00890

FAD_binding_2

FAD binding domain

16

63

0.94

PF12831

FAD_oxidored

FAD dependent oxidoreductase

16

193

0.79

PF01494

FAD_binding_3

FAD binding domain

14

355

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bk1-assembly1.cif.gz_A mutant imine reductase ir007-143 from amycolatopsis azurea, e120a, m197w, m206s, a213p, d238g, i240l 0.9438 19 47
6eod-assembly1.cif.gz_H structure of reductive aminase from aspergillus terreus in complex with nadph 0.9437 17 47
6eoh-assembly1.cif.gz_B reductive aminase from aspergillus terreus in complex with nadph and ethyl levulinate 0.934 17 47
6eod-assembly3.cif.gz_D structure of reductive aminase from aspergillus terreus in complex with nadph 0.9323 17 47
6eod-assembly4.cif.gz_E structure of reductive aminase from aspergillus terreus in complex with nadph 0.932 17 47
ID Description Score Start End Superfamily
1djnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9587 17 48 3.40.50.720
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9509 19 50 3.50.50.60
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 18 47 3.40.50.720
af_Q46811_547_618_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 20 50 3.40.50.720
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 19 50 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A254TER4-F1-model_v4 FAD-binding domain-containing protein 0.9672 17 419 GO:0071949
AF-A0A6G2VC59-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9638 15 416 GO:0071949
AF-A0A7W7LYT0-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase-like FAD-dependent oxidoreductase 0.9585 17 418 GO:0071949
AF-A0A5M3XLF7-F1-model_v4 FAD-dependent oxidoreductase 0.9574 23 411 GO:0071949
AF-A0A0T1Q8E2-F1-model_v4 Monooxygenase 0.9562 22 418 GO:0004497
GO:0071949

Feature Viewer

pLDDT pTM Quality
92.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map