F359646

General Info

Members Datasets Scaffolds Average Seq Length
248 157 496 133

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100228619|Ga0070674_1002286192
Length 155
Sequence VTDSAPQTRGQMAGPASRSPVRVRYAETDQMGVVYYANYFVWFEIGRTDLLRTLGSTYRQLEAEGLSLPVIEASCQYAAPCLYDEELVVVTRGRLLSPIRVSFSYAVERADGTVAARGRTEHAALGPDGRPRRLPAFLRDALTVAARSAPPGSSR

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
113 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
114 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
115 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 2.42
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100228619 3300005356 Bacteria 1450
2 Ga0065707_10759843 3300005295 Bacteria 615
3 Ga0070676_10017401 3300005328 Bacteria 3979
4 Ga0070676_11142895 3300005328 Unclassified 590
5 Ga0070670_100071634 3300005331 Bacteria 2976
6 Ga0070670_100410913 3300005331 Bacteria 1196
7 Ga0070677_10490438 3300005333 Bacteria 664
8 Ga0070666_10066402 3300005335 Bacteria 2448
9 Ga0070666_10260504 3300005335 Bacteria 1229
10 Ga0070680_100856158 3300005336 Bacteria 784
11 Ga0068868_100693815 3300005338 Bacteria 910
12 Ga0070691_10001774 3300005341 Bacteria 9379
13 Ga0070668_100024853 3300005347 Bacteria 4541
14 Ga0070669_100015502 3300005353 Bacteria 5432
15 Ga0070675_100223123 3300005354 Bacteria 1642
16 Ga0070671_100618154 3300005355 Bacteria 937
17 Ga0070674_100238124 3300005356 Bacteria 1423
18 Ga0070674_100560152 3300005356 Bacteria 960
19 Ga0070673_100250432 3300005364 Bacteria 1544
20 Ga0070673_100500896 3300005364 Bacteria 1098
21 Ga0070673_101793336 3300005364 Bacteria 581
22 Ga0070714_100057997 3300005435 Bacteria 3316
23 Ga0070713_100061623 3300005436 Bacteria 3139
24 Ga0070701_10109277 3300005438 Bacteria 1543
25 Ga0070701_10170104 3300005438 Bacteria 1268
26 Ga0070705_100012816 3300005440 Bacteria 4274
27 Ga0070705_100094454 3300005440 Bacteria 1872
28 Ga0070700_100034309 3300005441 Bacteria 3064
29 Ga0070700_100220665 3300005441 Bacteria 1343
30 Ga0070700_100431589 3300005441 Bacteria 998
31 Ga0070694_100061996 3300005444 Bacteria 2554
32 Ga0070708_100639286 3300005445 Bacteria 1003
33 Ga0070662_100122339 3300005457 Bacteria 1996
34 Ga0070662_100348446 3300005457 Bacteria 1213
35 Ga0068867_100027261 3300005459 Bacteria 4104
36 Ga0068867_100392365 3300005459 Bacteria 1169
37 Ga0070685_10642685 3300005466 Bacteria 768
38 Ga0070685_11240826 3300005466 Bacteria 568
39 Ga0070706_100952892 3300005467 Bacteria 792
40 Ga0070707_100842537 3300005468 Bacteria 881
41 Ga0070698_100325262 3300005471 Bacteria 1468
42 Ga0070698_100469227 3300005471 Bacteria 1195
43 Ga0070672_100746398 3300005543 Bacteria 859
44 Ga0070672_101076243 3300005543 Unclassified 714
45 Ga0070695_100118822 3300005545 Bacteria 1805
46 Ga0070695_100286766 3300005545 Bacteria 1212
47 Ga0070696_100044643 3300005546 Bacteria 3069
48 Ga0070665_100013642 3300005548 Bacteria 8174
49 Ga0070704_100024158 3300005549 Bacteria 3984
50 Ga0070704_100127305 3300005549 Bacteria 1967
51 Ga0070704_100874070 3300005549 Bacteria 807
52 Ga0068857_100208450 3300005577 Bacteria 1783
53 Ga0068854_100281819 3300005578 Bacteria 1338
54 Ga0068854_100626992 3300005578 Bacteria 921
55 Ga0068856_100785439 3300005614 Bacteria 972
56 Ga0070702_100988448 3300005615 Bacteria 665
57 Ga0068859_101254486 3300005617 Unclassified 816
58 Ga0068864_100031124 3300005618 Bacteria 4526
59 Ga0068866_10056705 3300005718 Bacteria 2015
60 Ga0068866_10096320 3300005718 Bacteria 1623
61 Ga0068861_100237560 3300005719 Bacteria 1548
62 Ga0068861_100516280 3300005719 Bacteria 1083
63 Ga0068861_101736461 3300005719 Bacteria 618
64 Ga0068858_100129613 3300005842 Bacteria 2364
65 Ga0068858_100754895 3300005842 Bacteria 948
66 Ga0068860_100238905 3300005843 Bacteria 1767
67 Ga0068860_101471733 3300005843 Bacteria 703
68 Ga0068862_100066537 3300005844 Bacteria 3105
69 Ga0068862_100730127 3300005844 Bacteria 962
70 Ga0075365_10001998 3300006038 Bacteria 9667
71 Ga0075364_10929248 3300006051 Bacteria 592
72 Ga0075367_10879786 3300006178 Bacteria 571
73 Ga0075433_10432716 3300006852 Bacteria 1160
74 Ga0075433_10981581 3300006852 Bacteria 736
75 Ga0075434_100267612 3300006871 Bacteria 1728
76 Ga0075434_100621669 3300006871 Bacteria 1099
77 Ga0068865_100033009 3300006881 Bacteria 3463
78 Ga0068865_100179878 3300006881 Bacteria 1628
79 Ga0075436_100028414 3300006914 Bacteria 3847
80 Ga0075436_100074375 3300006914 Bacteria 2352
81 Ga0097620_101254517 3300006931 Unclassified 816
82 Ga0075435_100045790 3300007076 Bacteria 3508
83 Ga0075435_100119361 3300007076 Bacteria 2199
84 Ga0105240_10274018 3300009093 Bacteria 1942
85 Ga0105240_10503846 3300009093 Bacteria 1346
86 Ga0105240_11324823 3300009093 Bacteria 759
87 Ga0111539_10004974 3300009094 Bacteria 17299
88 Ga0111539_10144545 3300009094 Bacteria 2784
89 Ga0111539_10193656 3300009094 Bacteria 2372
90 Ga0111539_10354701 3300009094 Bacteria 1707
91 Ga0111539_10380983 3300009094 Bacteria 1642
92 Ga0111539_10467792 3300009094 Bacteria 1468
93 Ga0105245_10030481 3300009098 Bacteria 4769
94 Ga0105245_10870188 3300009098 Bacteria 942
95 Ga0105247_10816932 3300009101 Bacteria 713
96 Ga0114129_10016354 3300009147 Bacteria 10560
97 Ga0114129_10533214 3300009147 Unclassified 1529
98 Ga0114129_10678629 3300009147 Bacteria 1327
99 Ga0105243_10025372 3300009148 Bacteria 4529
100 Ga0105243_10216536 3300009148 Bacteria 1690
101 Ga0105242_10245421 3300009176 Bacteria 1611
102 Ga0105242_10302379 3300009176 Bacteria 1461
103 Ga0105242_10494175 3300009176 Bacteria 1162
104 Ga0105242_11133994 3300009176 Bacteria 798
105 Ga0105242_11993394 3300009176 Bacteria 623
106 Ga0105248_10375900 3300009177 Bacteria 1600
107 Ga0105248_10843447 3300009177 Bacteria 1034
108 Ga0105248_11121413 3300009177 Bacteria 889
109 Ga0105248_11830300 3300009177 Bacteria 689
110 Ga0105238_10154211 3300009551 Bacteria 2272
111 Ga0105249_10697353 3300009553 Bacteria 1075
112 Ga0157378_10840883 3300013297 Bacteria 946
113 Ga0163162_10346303 3300013306 Bacteria 1619
114 Ga0157375_10793265 3300013308 Bacteria 1096
115 Ga0163163_10037345 3300014325 Bacteria 4725
116 Ga0157380_10089553 3300014326 Bacteria 2535
117 Ga0157380_10532921 3300014326 Bacteria 1148
118 Ga0157377_10559521 3300014745 Bacteria 809
119 Ga0157379_10115724 3300014968 Bacteria 2411
120 Ga0157379_11099346 3300014968 Bacteria 761
121 Ga0157379_12082066 3300014968 Unclassified 562
122 Ga0157376_11600354 3300014969 Bacteria 686
123 Ga0207682_10452609 3300025893 Bacteria 608
124 Ga0207692_10461114 3300025898 Bacteria 801
125 Ga0207642_10084261 3300025899 Bacteria 1552
126 Ga0207710_10393973 3300025900 Bacteria 710
127 Ga0207699_10152079 3300025906 Bacteria 1532
128 Ga0207645_10023984 3300025907 Bacteria 3959
129 Ga0207645_10479073 3300025907 Bacteria 841
130 Ga0207660_10666236 3300025917 Bacteria 849
131 Ga0207662_10618024 3300025918 Bacteria 755
132 Ga0207681_10101372 3300025923 Bacteria 2077
133 Ga0207687_11209642 3300025927 Unclassified 649
134 Ga0207700_10054752 3300025928 Bacteria 2996
135 Ga0207664_10025522 3300025929 Bacteria 4455
136 Ga0207644_10441157 3300025931 Bacteria 1069
137 Ga0207706_10044668 3300025933 Bacteria 3927
138 Ga0207706_10331860 3300025933 Bacteria 1323
139 Ga0207686_11432978 3300025934 Bacteria 569
140 Ga0207709_10023026 3300025935 Bacteria 3541
141 Ga0207709_10242341 3300025935 Bacteria 1312
142 Ga0207669_10038142 3300025937 Bacteria 2764
143 Ga0207669_10058891 3300025937 Bacteria 2346
144 Ga0207704_10640769 3300025938 Bacteria 874
145 Ga0207711_10323637 3300025941 Bacteria 1425
146 Ga0207711_10469268 3300025941 Bacteria 1172
147 Ga0207689_10443791 3300025942 Bacteria 1084
148 Ga0207651_10292154 3300025960 Bacteria 1352
149 Ga0207712_10251925 3300025961 Bacteria 1428
150 Ga0207668_10023855 3300025972 Bacteria 3940
151 Ga0207668_10057438 3300025972 Bacteria 2715
152 Ga0207640_10275246 3300025981 Bacteria 1319
153 Ga0207640_10396512 3300025981 Bacteria 1123
154 Ga0207703_10127719 3300026035 Bacteria 2191
155 Ga0207703_10614544 3300026035 Bacteria 1029
156 Ga0207703_10869182 3300026035 Bacteria 863
157 Ga0207708_10095294 3300026075 Bacteria 2298
158 Ga0207708_10162291 3300026075 Bacteria 1765
159 Ga0207708_10476982 3300026075 Bacteria 1042
160 Ga0207648_10008617 3300026089 Bacteria 9859
161 Ga0207648_10075748 3300026089 Bacteria 2933
162 Ga0207648_10111132 3300026089 Bacteria 2406
163 Ga0207648_10405322 3300026089 Bacteria 1236
164 Ga0207648_10833103 3300026089 Bacteria 860
165 Ga0207674_11140740 3300026116 Bacteria 749
166 Ga0207675_100002329 3300026118 Bacteria 18829
167 Ga0207428_10019602 3300027907 Bacteria 5764
168 Ga0207428_10158216 3300027907 Bacteria 1721
169 Ga0268265_10025651 3300028380 Bacteria 4187
170 Ga0307513_10631025 3300031456 Bacteria 779
171 Ga0316576_10563151 3300031727 Bacteria 834
172 Ga0373958_0065818 3300034819 Bacteria 795
173 Ga0373926_0344733 3300035083 Unclassified 584
174 Ga0373960_0004534 3300035121 Bacteria 3189
175 Ga0373943_0072883 3300035170 Bacteria 1743
176 Ga0373943_0713914 3300035170 Bacteria 594
177 Ga0373962_0087419 3300035242 Bacteria 955
178 Ga0373931_0461926 3300035691 Bacteria 813
179 Ga0373947_0145276 3300035725 Bacteria 1524
180 Ga0373925_0205364 3300037068 Bacteria 1568
181 Ga0450920_014899 3300042122 Bacteria 1475
182 Ga0450923_005340 3300042125 Bacteria 2068
183 Ga0450894_009272 3300042131 Bacteria 1276
184 Ga0450908_004737 3300042184 Bacteria 2619
185 Ga0439435_0006384 3300042436 Bacteria 2647
186 Ga0466967_0595561 3300045976 Bacteria 1091
187 Ga0495638_0007626 3300046460 Bacteria 7734
188 Ga0495674_1091369 3300047319 Bacteria 608
189 Ga0496100_0391720 3300048903 Bacteria 1057
190 Ga0496104_0196663 3300048907 Bacteria 1928
191 Ga0496106_1067000 3300048909 Bacteria 634
192 Ga0496107_0235296 3300048910 Bacteria 1363
193 Ga0496112_0070709 3300048915 Bacteria 3449
194 Ga0496112_0767107 3300048915 Bacteria 890
195 Ga0501031_0091216 3300049568 Bacteria 1987
196 Ga0501033_0181612 3300049570 Bacteria 1508
197 Ga0501034_0030152 3300049571 Bacteria 5512
198 Ga0501036_0270941 3300049572 Bacteria 1421
199 Ga0501036_0514805 3300049572 Bacteria 995
200 Ga0501038_0236397 3300049574 Bacteria 1452
201 Ga0501039_0160685 3300049575 Bacteria 1766
202 Ga0501040_0035844 3300049576 Bacteria 3366
203 Ga0501040_0432528 3300049576 Bacteria 946
204 Ga0501041_0041438 3300049577 Bacteria 2797
205 Ga0501041_0054308 3300049577 Bacteria 2444
206 Ga0501042_0023694 3300049578 Bacteria 4298
207 Ga0501042_0371916 3300049578 Bacteria 1034
208 Ga0501042_1256385 3300049578 Unclassified 540
209 Ga0501046_0565479 3300049580 Bacteria 809
210 Ga0501048_0036313 3300049582 Bacteria 3542
211 Ga0501048_0166614 3300049582 Bacteria 1560
212 Ga0501071_0062243 3300049587 Bacteria 2703
213 Ga0501071_0097243 3300049587 Bacteria 2167
214 Ga0501072_0118918 3300049588 Bacteria 2105
215 Ga0501074_0687599 3300049590 Unclassified 722
216 Ga0501075_0033309 3300049591 Bacteria 3833
217 Ga0501075_0136530 3300049591 Bacteria 1868
218 Ga0501076_0070841 3300049592 Bacteria 2788
219 Ga0501076_0436338 3300049592 Bacteria 1078
220 Ga0501077_0333740 3300049593 Bacteria 967
221 Ga0501079_0316370 3300049741 Bacteria 1222
222 Ga0501080_0111404 3300049742 Bacteria 2537
223 Ga0501080_1344332 3300049742 Unclassified 611
224 Ga0501081_0271290 3300049743 Bacteria 1241
225 Ga0501045_0012697 3300049824 Bacteria 5931
226 Ga0501045_0270239 3300049824 Bacteria 1266
227 nmdc:mga00v17_256289_c1 3300050491 Bacteria 1134
228 nmdc:mga00v17_957483_c1 3300050491 Bacteria 540
229 nmdc:mga0yw44_2307_c1 3300050492 Bacteria 8073
230 nmdc:mga0yw44_270534_c1 3300050492 Bacteria 1134
231 nmdc:mga06z11_531714_c1 3300050494 Bacteria 713
232 nmdc:mga05p37_191562_c2 3300050507 Bacteria 591
233 nmdc:mga05p37_216724_c1 3300050507 Bacteria 2312
234 nmdc:mga05p37_95715_c1 3300050507 Bacteria 3658
235 nmdc:mga08y16_266319_c1 3300050511 Bacteria 1769
236 nmdc:mga08y16_532452_c1 3300050511 Bacteria 1190
237 nmdc:mga08y16_8741_c1 3300050511 Bacteria 10623
238 nmdc:mga0n895_15813_c1 3300050512 Bacteria 6900
239 nmdc:mga0n895_167731_c1 3300050512 Bacteria 2227
240 nmdc:mga0rr50_28496_c1 3300050513 Bacteria 3927
241 nmdc:mga08x19_352516_c1 3300050514 Bacteria 1028
242 nmdc:mga08x19_45250_c1 3300050514 Bacteria 2813
243 nmdc:mga0a205_221568_c1 3300050515 Bacteria 1777
244 Ga0501084_0097488 3300054114 Bacteria 2468
245 Ga0501084_0552218 3300054114 Bacteria 973
246 Ga0501082_0090722 3300060353 Bacteria 2639
247 Ga0501082_0229477 3300060353 Bacteria 1616
248 Ga0530510_0446987 3300061734 Bacteria 977
249 Ga0070674_100228619
250 Ga0065707_10759843
251 Ga0070676_10017401
252 Ga0070676_11142895
253 Ga0070670_100071634
254 Ga0070670_100410913
255 Ga0070677_10490438
256 Ga0070666_10066402
257 Ga0070666_10260504
258 Ga0070680_100856158
259 Ga0068868_100693815
260 Ga0070691_10001774
261 Ga0070668_100024853
262 Ga0070669_100015502
263 Ga0070675_100223123
264 Ga0070671_100618154
265 Ga0070674_100238124
266 Ga0070674_100560152
267 Ga0070673_100250432
268 Ga0070673_100500896
269 Ga0070673_101793336
270 Ga0070714_100057997
271 Ga0070713_100061623
272 Ga0070701_10109277
273 Ga0070701_10170104
274 Ga0070705_100012816
275 Ga0070705_100094454
276 Ga0070700_100034309
277 Ga0070700_100220665
278 Ga0070700_100431589
279 Ga0070694_100061996
280 Ga0070708_100639286
281 Ga0070662_100122339
282 Ga0070662_100348446
283 Ga0068867_100027261
284 Ga0068867_100392365
285 Ga0070685_10642685
286 Ga0070685_11240826
287 Ga0070706_100952892
288 Ga0070707_100842537
289 Ga0070698_100325262
290 Ga0070698_100469227
291 Ga0070672_100746398
292 Ga0070672_101076243
293 Ga0070695_100118822
294 Ga0070695_100286766
295 Ga0070696_100044643
296 Ga0070665_100013642
297 Ga0070704_100024158
298 Ga0070704_100127305
299 Ga0070704_100874070
300 Ga0068857_100208450
301 Ga0068854_100281819
302 Ga0068854_100626992
303 Ga0068856_100785439
304 Ga0070702_100988448
305 Ga0068859_101254486
306 Ga0068864_100031124
307 Ga0068866_10056705
308 Ga0068866_10096320
309 Ga0068861_100237560
310 Ga0068861_100516280
311 Ga0068861_101736461
312 Ga0068858_100129613
313 Ga0068858_100754895
314 Ga0068860_100238905
315 Ga0068860_101471733
316 Ga0068862_100066537
317 Ga0068862_100730127
318 Ga0075365_10001998
319 Ga0075364_10929248
320 Ga0075367_10879786
321 Ga0075433_10432716
322 Ga0075433_10981581
323 Ga0075434_100267612
324 Ga0075434_100621669
325 Ga0068865_100033009
326 Ga0068865_100179878
327 Ga0075436_100028414
328 Ga0075436_100074375
329 Ga0097620_101254517
330 Ga0075435_100045790
331 Ga0075435_100119361
332 Ga0105240_10274018
333 Ga0105240_10503846
334 Ga0105240_11324823
335 Ga0111539_10004974
336 Ga0111539_10144545
337 Ga0111539_10193656
338 Ga0111539_10354701
339 Ga0111539_10380983
340 Ga0111539_10467792
341 Ga0105245_10030481
342 Ga0105245_10870188
343 Ga0105247_10816932
344 Ga0114129_10016354
345 Ga0114129_10533214
346 Ga0114129_10678629
347 Ga0105243_10025372
348 Ga0105243_10216536
349 Ga0105242_10245421
350 Ga0105242_10302379
351 Ga0105242_10494175
352 Ga0105242_11133994
353 Ga0105242_11993394
354 Ga0105248_10375900
355 Ga0105248_10843447
356 Ga0105248_11121413
357 Ga0105248_11830300
358 Ga0105238_10154211
359 Ga0105249_10697353
360 Ga0157378_10840883
361 Ga0163162_10346303
362 Ga0157375_10793265
363 Ga0163163_10037345
364 Ga0157380_10089553
365 Ga0157380_10532921
366 Ga0157377_10559521
367 Ga0157379_10115724
368 Ga0157379_11099346
369 Ga0157379_12082066
370 Ga0157376_11600354
371 Ga0207682_10452609
372 Ga0207692_10461114
373 Ga0207642_10084261
374 Ga0207710_10393973
375 Ga0207699_10152079
376 Ga0207645_10023984
377 Ga0207645_10479073
378 Ga0207660_10666236
379 Ga0207662_10618024
380 Ga0207681_10101372
381 Ga0207687_11209642
382 Ga0207700_10054752
383 Ga0207664_10025522
384 Ga0207644_10441157
385 Ga0207706_10044668
386 Ga0207706_10331860
387 Ga0207686_11432978
388 Ga0207709_10023026
389 Ga0207709_10242341
390 Ga0207669_10038142
391 Ga0207669_10058891
392 Ga0207704_10640769
393 Ga0207711_10323637
394 Ga0207711_10469268
395 Ga0207689_10443791
396 Ga0207651_10292154
397 Ga0207712_10251925
398 Ga0207668_10023855
399 Ga0207668_10057438
400 Ga0207640_10275246
401 Ga0207640_10396512
402 Ga0207703_10127719
403 Ga0207703_10614544
404 Ga0207703_10869182
405 Ga0207708_10095294
406 Ga0207708_10162291
407 Ga0207708_10476982
408 Ga0207648_10008617
409 Ga0207648_10075748
410 Ga0207648_10111132
411 Ga0207648_10405322
412 Ga0207648_10833103
413 Ga0207674_11140740
414 Ga0207675_100002329
415 Ga0207428_10019602
416 Ga0207428_10158216
417 Ga0268265_10025651
418 Ga0307513_10631025
419 Ga0316576_10563151
420 Ga0373958_0065818
421 Ga0373926_0344733
422 Ga0373960_0004534
423 Ga0373943_0072883
424 Ga0373943_0713914
425 Ga0373962_0087419
426 Ga0373931_0461926
427 Ga0373947_0145276
428 Ga0373925_0205364
429 Ga0450920_014899
430 Ga0450923_005340
431 Ga0450894_009272
432 Ga0450908_004737
433 Ga0439435_0006384
434 Ga0466967_0595561
435 Ga0495638_0007626
436 Ga0495674_1091369
437 Ga0496100_0391720
438 Ga0496104_0196663
439 Ga0496106_1067000
440 Ga0496107_0235296
441 Ga0496112_0070709
442 Ga0496112_0767107
443 Ga0501031_0091216
444 Ga0501033_0181612
445 Ga0501034_0030152
446 Ga0501036_0270941
447 Ga0501036_0514805
448 Ga0501038_0236397
449 Ga0501039_0160685
450 Ga0501040_0035844
451 Ga0501040_0432528
452 Ga0501041_0041438
453 Ga0501041_0054308
454 Ga0501042_0023694
455 Ga0501042_0371916
456 Ga0501042_1256385
457 Ga0501046_0565479
458 Ga0501048_0036313
459 Ga0501048_0166614
460 Ga0501071_0062243
461 Ga0501071_0097243
462 Ga0501072_0118918
463 Ga0501074_0687599
464 Ga0501075_0033309
465 Ga0501075_0136530
466 Ga0501076_0070841
467 Ga0501076_0436338
468 Ga0501077_0333740
469 Ga0501079_0316370
470 Ga0501080_0111404
471 Ga0501080_1344332
472 Ga0501081_0271290
473 Ga0501045_0012697
474 Ga0501045_0270239
475 nmdc:mga00v17_256289_c1
476 nmdc:mga00v17_957483_c1
477 nmdc:mga0yw44_2307_c1
478 nmdc:mga0yw44_270534_c1
479 nmdc:mga06z11_531714_c1
480 nmdc:mga05p37_191562_c2
481 nmdc:mga05p37_216724_c1
482 nmdc:mga05p37_95715_c1
483 nmdc:mga08y16_266319_c1
484 nmdc:mga08y16_532452_c1
485 nmdc:mga08y16_8741_c1
486 nmdc:mga0n895_15813_c1
487 nmdc:mga0n895_167731_c1
488 nmdc:mga0rr50_28496_c1
489 nmdc:mga08x19_352516_c1
490 nmdc:mga08x19_45250_c1
491 nmdc:mga0a205_221568_c1
492 Ga0501084_0097488
493 Ga0501084_0552218
494 Ga0501082_0090722
495 Ga0501082_0229477
496 Ga0530510_0446987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

31

116

0.93

PF13279

4HBT_2

Thioesterase-like superfamily

23

142

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ae8-assembly1.cif.gz_B crystal structure of human them4 0.9152 59 116
4ae8-assembly2.cif.gz_C crystal structure of human them4 0.9129 59 116
1psu-assembly1.cif.gz_A structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9104 59 116
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9073 9 136
1z54-assembly1.cif.gz_C crystal structure of a hypothetical protein tt1821 from thermus thermophilus 0.906 9 135
ID Description Score Start End Superfamily
af_Q940V5_3_144_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9358 60 116 3.10.129.10
af_P34419_18_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9326 58 118 3.10.129.10
af_A0A1D6I7U7_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9143 53 129 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9073 9 136 3.10.129.10
af_Q86HX3_15_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9052 61 114 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1Q7QXD5-F1-model_v4 Uncharacterized protein 0.9493 23 136 GO:0047617
AF-A0A3L7THT7-F1-model_v4 Acyl-CoA thioesterase 0.9386 32 135 GO:0006633
GO:0016790
AF-A0A6A7KY39-F1-model_v4 YbgC/FadM family acyl-CoA thioesterase (EC 3.1.2.-) 0.9362 8 136 GO:0047617
AF-A0A1F2S755-F1-model_v4 Thioesterase domain-containing protein 0.9337 9 135 GO:0047617
AF-A0A2V8E0S2-F1-model_v4 Acyl-CoA thioesterase 0.93 1 136 GO:0047617

Map