F359547

General Info

Members Datasets Scaffolds Average Seq Length
248 183 496 300

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10008440|rootH1_100084403
Length 319
Sequence MSWADVGSNGRRGECVVSVRELVVLGTASQVPTRHRNHNGYFLRWDSEGFLFDPGEGTQRQMVRAGVAAHDLNRICVTHFHGDHSLGLAGVVQRVNLDQVPHPVVAHYPRSGQRFFDRLRYATAYRETVGITESPVAGAGPITVAEGPSYTLEAHRLSHPVESYGYRLVEPDGRRMLPERLAAHGIKGPDVGRLQREGVLGDVTLDDVSEPRRGQRFAFVMDTRLCEGVQVLAEGCDMLVIESTFLDEDAELASDHGHLTAGQAAAVARDAGVRHLVLTHFSQRYSEPEEFERQARAAGFEGELSVARDLLRVPVPKRR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
13 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
14 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
16 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
17 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
18 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
19 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
20 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
21 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
22 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
23 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
24 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
25 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
26 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
27 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
28 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
29 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
30 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
31 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
32 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
33 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
34 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
35 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
36 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
37 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
38 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
39 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
43 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
44 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
45 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
46 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
49 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
50 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
51 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
52 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
55 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
56 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
57 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
62 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
67 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
68 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
92 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
95 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
96 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
117 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
118 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
119 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
120 2643221548 Streptomyces sp. Root55 Isolate Unclassified
121 2643221578 Streptomyces sp. Root63 Isolate Unclassified
122 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
123 2643221670 Streptomyces sp. Root431 Isolate Unclassified
124 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
125 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
126 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
127 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
128 2643221714 Streptomyces sp. Root264 Isolate Unclassified
129 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
130 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
131 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
132 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
133 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
134 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
135 2808606448 Streptomyces sp. 193411 Isolate Unclassified
136 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
137 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
138 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
139 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
140 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
141 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
142 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
143 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
144 2862574272 Streptomyces sp. AcE210 Isolate Nodule
145 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
146 2867369537 Streptomyces sp. Z26 Isolate Unclassified
147 2867475112 Streptomyces sp. TM32 Isolate Unclassified
148 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
149 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
150 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
151 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
152 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
153 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
154 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
155 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
156 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
157 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
158 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
159 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
160 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
161 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
162 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
163 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
164 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
165 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
166 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
167 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
168 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
169 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
170 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
171 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
172 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
173 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
174 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
175 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
176 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
177 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
178 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
179 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
180 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
181 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
182 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
183 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.58
Metatranscriptomes 0
Isolates 27.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 1.21
Rhizoplane 2.42
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10008440 3300003323 Bacteria 5278
2 JGI25153J46596_10043778 3300003215 Bacteria 1352
3 rootH2_10001113 3300003320 Bacteria 9047
4 rootL2_10060878 3300003322 Bacteria 4693
5 Ga0068853_100152439 3300005539 Bacteria 2081
6 Ga0070665_100155329 3300005548 Bacteria 2290
7 Ga0075363_100051824 3300006048 Bacteria 2189
8 Ga0075367_10062096 3300006178 Bacteria 2231
9 Ga0105251_10036037 3300009011 Bacteria 2438
10 Ga0105243_10042422 3300009148 Bacteria 3561
11 Ga0183367_1006 3300015688 Bacteria 648044
12 Ga0209758_1005479 3300025297 Bacteria 9738
13 Ga0207426_1001844 3300025302 Bacteria 15586
14 Ga0268266_10086950 3300028379 Bacteria 2734
15 Ga0268256_1031456 3300030500 Bacteria 1273
16 Ga0307511_10063902 3300030521 Bacteria 2774
17 Ga0307512_10029189 3300030522 Bacteria 4823
18 Ga0307513_10037423 3300031456 Bacteria 5401
19 Ga0307513_10102352 3300031456 Bacteria 2883
20 Ga0307509_10062292 3300031507 Bacteria 3934
21 Ga0307508_10001064 3300031616 Bacteria 31742
22 Ga0307514_10002714 3300031649 Bacteria 17880
23 Ga0307514_10101877 3300031649 Bacteria 2059
24 Ga0307516_10010436 3300031730 Bacteria 10210
25 Ga0307518_10026796 3300031838 Bacteria 4156
26 Ga0307510_10043333 3300033180 Bacteria 4893
27 Ga0395898_0010473 3300037466 Bacteria 9693
28 Ga0395898_0219031 3300037466 Bacteria 1816
29 Ga0436364_0429055 3300037853 Bacteria 17858
30 Ga0395901_0102113 3300038443 Bacteria 3009
31 Ga0439436_0001564 3300041404 Bacteria 6665
32 Ga0451787_674597 3300041441 Bacteria 1168
33 Ga0451853_0791982 3300041512 Bacteria 9592
34 Ga0439457_001528 3300042014 Bacteria 6940
35 Ga0450894_000155 3300042131 Bacteria 12006
36 Ga0450896_007658 3300042133 Bacteria 1489
37 Ga0450898_001315 3300042134 Bacteria 3243
38 Ga0450899_001734 3300042135 Bacteria 2418
39 Ga0450906_006481 3300042145 Bacteria 2363
40 Ga0466972_0000726 3300044658 Bacteria 15757
41 Ga0466972_0022418 3300044658 Bacteria 3146
42 Ga0466965_0010282 3300044683 Bacteria 4360
43 Ga0466965_0024768 3300044683 Bacteria 2904
44 Ga0466965_0255808 3300044683 Bacteria 940
45 Ga0466966_0003579 3300044684 Bacteria 10253
46 Ga0466966_0177299 3300044684 Bacteria 1294
47 Ga0466971_0037433 3300044719 Bacteria 2174
48 Ga0466970_0009335 3300044765 Bacteria 4955
49 Ga0466957_0124312 3300044842 Bacteria 1647
50 Ga0495617_054866 3300046452 Bacteria 1322
51 Ga0495592_0109344 3300046454 Bacteria 1958
52 Ga0495603_0001982 3300046455 Bacteria 12061
53 Ga0495603_0002447 3300046455 Bacteria 10926
54 Ga0495603_0004064 3300046455 Bacteria 8708
55 Ga0495603_0008666 3300046455 Bacteria 6145
56 Ga0495603_0036441 3300046455 Bacteria 2953
57 Ga0495603_0063575 3300046455 Bacteria 2177
58 Ga0495603_0071700 3300046455 Bacteria 2035
59 Ga0495603_0204965 3300046455 Bacteria 1139
60 Ga0495629_0013131 3300046459 Bacteria 5982
61 Ga0495629_0013151 3300046459 Bacteria 5976
62 Ga0495629_0023437 3300046459 Bacteria 4398
63 Ga0495629_0029103 3300046459 Bacteria 3920
64 Ga0495629_0042608 3300046459 Bacteria 3189
65 Ga0495629_0146930 3300046459 Bacteria 1639
66 Ga0495638_0058830 3300046460 Bacteria 2381
67 Ga0495638_0128746 3300046460 Bacteria 1489
68 Ga0495638_0174718 3300046460 Bacteria 1230
69 Ga0495651_0029000 3300046462 Bacteria 4316
70 Ga0495582_0078898 3300046473 Bacteria 1827
71 Ga0495582_0162851 3300046473 Bacteria 1269
72 Ga0495605_0083855 3300046474 Bacteria 1487
73 Ga0495662_0035462 3300046476 Bacteria 2406
74 Ga0495662_0060658 3300046476 Bacteria 1826
75 Ga0495585_0025674 3300046492 Bacteria 3371
76 Ga0495585_0070158 3300046492 Bacteria 1911
77 Ga0495594_0000649 3300046499 Bacteria 17952
78 Ga0495594_0030739 3300046499 Bacteria 2908
79 Ga0495594_0069859 3300046499 Bacteria 1951
80 Ga0495607_0091293 3300046501 Bacteria 1649
81 Ga0495606_0033636 3300046507 Bacteria 3533
82 Ga0495610_0098614 3300046512 Bacteria 1312
83 Ga0495616_0005236 3300046513 Bacteria 8014
84 Ga0495618_0044729 3300046514 Bacteria 2792
85 Ga0495620_0070974 3300046515 Bacteria 1425
86 Ga0495628_0089449 3300046516 Bacteria 2384
87 Ga0495628_0289071 3300046516 Bacteria 1215
88 Ga0495631_0016746 3300046518 Bacteria 3484
89 Ga0495637_0017165 3300046520 Bacteria 3378
90 Ga0495643_0015827 3300046522 Bacteria 4444
91 Ga0495666_0063251 3300046526 Bacteria 1766
92 Ga0495652_0330541 3300046529 Bacteria 1098
93 Ga0495586_0278650 3300046535 Bacteria 957
94 Ga0495609_0015562 3300046538 Bacteria 3558
95 Ga0495597_0011469 3300046542 Bacteria 4296
96 Ga0495622_0064995 3300046557 Bacteria 1687
97 Ga0495622_0076728 3300046557 Bacteria 1539
98 Ga0495634_0183364 3300046642 Bacteria 1309
99 Ga0495634_0367825 3300046642 Bacteria 858
100 Ga0495611_0045424 3300046648 Bacteria 1967
101 Ga0495625_0025316 3300046660 Bacteria 4501
102 Ga0495625_0190056 3300046660 Bacteria 1361
103 Ga0495635_0027670 3300046663 Bacteria 3943
104 Ga0495635_0104561 3300046663 Bacteria 1935
105 Ga0495635_0212004 3300046663 Bacteria 1311
106 Ga0495661_0105213 3300046665 Bacteria 1581
107 Ga0495588_0006263 3300046674 Bacteria 5351
108 Ga0495588_0048530 3300046674 Bacteria 2181
109 Ga0495657_0013475 3300046675 Bacteria 6030
110 Ga0495657_0081105 3300046675 Bacteria 2098
111 Ga0495657_0129024 3300046675 Bacteria 1585
112 Ga0495623_0029965 3300046679 Bacteria 3502
113 Ga0495613_0001356 3300046689 Bacteria 18654
114 Ga0495613_0027479 3300046689 Bacteria 4233
115 Ga0495613_0029348 3300046689 Bacteria 4089
116 Ga0495613_0286570 3300046689 Bacteria 1142
117 Ga0495613_0301732 3300046689 Bacteria 1108
118 Ga0495613_0323869 3300046689 Bacteria 1063
119 Ga0495624_0288438 3300046690 Bacteria 990
120 Ga0495670_0022284 3300046691 Bacteria 3127
121 Ga0495670_0036397 3300046691 Bacteria 2452
122 Ga0495649_0025031 3300046694 Bacteria 3325
123 Ga0495589_0023016 3300046794 Bacteria 3174
124 Ga0495589_0040808 3300046794 Bacteria 2316
125 Ga0495589_0070272 3300046794 Bacteria 1711
126 Ga0495660_0058517 3300046810 Bacteria 2075
127 Ga0495581_0193061 3300047315 Bacteria 1191
128 Ga0495581_0210873 3300047315 Bacteria 1136
129 Ga0495604_0026521 3300047317 Bacteria 4612
130 Ga0495604_0058751 3300047317 Bacteria 2952
131 Ga0495636_0000860 3300047318 Bacteria 11223
132 Ga0495636_0001020 3300047318 Bacteria 10495
133 Ga0495636_0016178 3300047318 Bacteria 2977
134 Ga0495676_0000494 3300047321 Bacteria 32369
135 Ga0495676_0054384 3300047321 Bacteria 3183
136 Ga0495676_0054600 3300047321 Bacteria 3174
137 Ga0495676_0100795 3300047321 Bacteria 2137
138 Ga0495676_0142416 3300047321 Bacteria 1716
139 Ga0495680_0002821 3300047322 Bacteria 17481
140 Ga0495683_0066940 3300047323 Bacteria 1769
141 Ga0495687_008961 3300047443 Bacteria 5658
142 Ga0495687_016114 3300047443 Bacteria 3769
143 Ga0495687_068149 3300047443 Bacteria 1437
144 Ga0495687_099834 3300047443 Bacteria 1091
145 Ga0495685_039861 3300047447 Bacteria 1607
146 Ga0495685_043870 3300047447 Bacteria 1526
147 Ga0495681_0000676 3300047470 Bacteria 25904
148 Ga0495686_0074770 3300047472 Bacteria 2078
149 Ga0495593_0111796 3300047673 Bacteria 1394
150 Ga0495614_0000337 3300048089 Bacteria 18552
151 Ga0495614_0048569 3300048089 Bacteria 1819
152 Ga0495626_0013713 3300048091 Bacteria 4205
153 Ga0496105_0408540 3300048908 Bacteria 1077
154 Ga0496106_0100134 3300048909 Bacteria 2247
155 Ga0496108_0117272 3300048911 Bacteria 2281
156 Ga0496109_0029412 3300048912 Bacteria 4920
157 Ga0501031_0048633 3300049568 Bacteria 2763
158 Ga0501032_0066988 3300049569 Bacteria 2399
159 Ga0501033_0004179 3300049570 Bacteria 11621
160 Ga0501033_0168918 3300049570 Bacteria 1571
161 Ga0501034_0183977 3300049571 Bacteria 2053
162 Ga0501036_0014988 3300049572 Bacteria 6467
163 Ga0501036_0042021 3300049572 Bacteria 3870
164 Ga0501037_0035191 3300049573 Bacteria 3694
165 Ga0501038_0040112 3300049574 Bacteria 4092
166 Ga0501038_0127681 3300049574 Bacteria 2091
167 Ga0501039_0100290 3300049575 Bacteria 2260
168 Ga0501042_0043847 3300049578 Bacteria 3186
169 Ga0501043_0052010 3300049579 Bacteria 3218
170 Ga0501043_0056639 3300049579 Bacteria 3079
171 Ga0501043_0158202 3300049579 Bacteria 1771
172 Ga0501046_0034027 3300049580 Bacteria 4115
173 Ga0501047_0000262 3300049581 Bacteria 61769
174 Ga0501047_0023047 3300049581 Bacteria 5977
175 Ga0501047_0152919 3300049581 Bacteria 2182
176 Ga0501047_0184901 3300049581 Bacteria 1949
177 Ga0501047_0206216 3300049581 Bacteria 1825
178 Ga0501035_0404328 3300049822 Bacteria 1135
179 Ga0501044_0011413 3300049823 Bacteria 9624
180 nmdc:mga06z11_25143_c1 3300050494 Bacteria 2819
181 2554258650 2554235005 Bacteria 6457341
182 2585301352 2582581312 Bacteria 7308206
183 2616701804 2616644814 Bacteria 11555299
184 2616899824 2616644941 Bacteria 8510691
185 2643759698 2643221548 Bacteria 8053412
186 2643897815 2643221578 Bacteria 9213798
187 2643944741 2643221587 Bacteria 7586415
188 2644385329 2643221670 Bacteria 6497041
189 2644408960 2643221673 Bacteria 9196637
190 2644431639 2643221677 Bacteria 7584031
191 2644436306 2643221678 Bacteria 9540101
192 2644462887 2643221682 Bacteria 6743283
193 2644625832 2643221714 Bacteria 9015452
194 2784587808 2784132148 Bacteria 8627943
195 2785368513 2784746768 Bacteria 10036182
196 2793984392 2791355406 Bacteria 11364898
197 2804844825 2802429296 Bacteria 7227771
198 2808841203 2808606359 Bacteria 9866990
199 2808919719 2808606375 Bacteria 9466072
200 2809231391 2808606448 Bacteria 8656184
201 2811848211 2808606982 Bacteria 7791042
202 2812359052 2811994879 Bacteria 9313447
203 2819693730 2818991463 Bacteria 7948711
204 2852641207 2852635781 Bacteria 8251373
205 2862182550 2862178590 Bacteria 8583590
206 2862288215 2862281513 Bacteria 9621493
207 2862296940 2862290372 Bacteria 7471434
208 2862384643 2862382967 Bacteria 10317375
209 2862580055 2862574272 Bacteria 10567477
210 2862709813 2862705112 Bacteria 6563286
211 2867371035 2867369537 Bacteria 6501581
212 2867480905 2867475112 Bacteria 6909112
213 2875393736 2875391855 Bacteria 7600475
214 2918503758 2918501144 Bacteria 8668083
215 2919468604 2919468124 Bacteria 9133025
216 2935392225 2935390628 Bacteria 7043367
217 2946050926 2946045630 Bacteria 8527308
218 2946066826 2946064051 Bacteria 8957905
219 2946075151 2946072368 Bacteria 8999607
220 2954003731 2954002825 Bacteria 9173742
221 2954717087 2954711539 Bacteria 10867210
222 2954727057 2954721474 Bacteria 10456478
223 2954734745 2954731030 Bacteria 10243860
224 2954745959 2954740390 Bacteria 10229294
225 2954753632 2954749733 Bacteria 10366972
226 2954764930 2954759201 Bacteria 9358192
227 2966603347 2966598605 Bacteria 7676064
228 2990046348 2990044586 Bacteria 6603797
229 2990061952 2990059506 Bacteria 9321252
230 2990090477 2990088156 Bacteria 6657676
231 2997456496 2997451912 Bacteria 8492419
232 2997608221 2997600082 Bacteria 9896405
233 3006487020 3006486233 Bacteria 8157040
234 8008488961 8008485437 Bacteria 7198341
235 8008559486 8008558824 Bacteria 10610750
236 8023628142 8023623736 Bacteria 8593882
237 8025419268 8025413630 Bacteria 7014048
238 8025528444 8025524527 Bacteria 7197316
239 8033689298 8033684223 Bacteria 6906479
240 8047899001 8047893842 Bacteria 11723082
241 8048127639 8048127548 Bacteria 11053136
242 8048359919 8048356638 Bacteria 11044339
243 8048375965 8048369669 Bacteria 11666822
244 8048382155 8048379754 Bacteria 11877923
245 8054165201 8054160619 Bacteria 7783213
246 8056453555 8056447290 Bacteria 7680491
247 8056673321 8056667051 Bacteria 6953971
248 8056836878 8056829672 Bacteria 9045328
249 rootH1_10008440
250 JGI25153J46596_10043778
251 rootH2_10001113
252 rootL2_10060878
253 Ga0068853_100152439
254 Ga0070665_100155329
255 Ga0075363_100051824
256 Ga0075367_10062096
257 Ga0105251_10036037
258 Ga0105243_10042422
259 Ga0183367_1006
260 Ga0209758_1005479
261 Ga0207426_1001844
262 Ga0268266_10086950
263 Ga0268256_1031456
264 Ga0307511_10063902
265 Ga0307512_10029189
266 Ga0307513_10037423
267 Ga0307513_10102352
268 Ga0307509_10062292
269 Ga0307508_10001064
270 Ga0307514_10002714
271 Ga0307514_10101877
272 Ga0307516_10010436
273 Ga0307518_10026796
274 Ga0307510_10043333
275 Ga0395898_0010473
276 Ga0395898_0219031
277 Ga0436364_0429055
278 Ga0395901_0102113
279 Ga0439436_0001564
280 Ga0451787_674597
281 Ga0451853_0791982
282 Ga0439457_001528
283 Ga0450894_000155
284 Ga0450896_007658
285 Ga0450898_001315
286 Ga0450899_001734
287 Ga0450906_006481
288 Ga0466972_0000726
289 Ga0466972_0022418
290 Ga0466965_0010282
291 Ga0466965_0024768
292 Ga0466965_0255808
293 Ga0466966_0003579
294 Ga0466966_0177299
295 Ga0466971_0037433
296 Ga0466970_0009335
297 Ga0466957_0124312
298 Ga0495617_054866
299 Ga0495592_0109344
300 Ga0495603_0001982
301 Ga0495603_0002447
302 Ga0495603_0004064
303 Ga0495603_0008666
304 Ga0495603_0036441
305 Ga0495603_0063575
306 Ga0495603_0071700
307 Ga0495603_0204965
308 Ga0495629_0013131
309 Ga0495629_0013151
310 Ga0495629_0023437
311 Ga0495629_0029103
312 Ga0495629_0042608
313 Ga0495629_0146930
314 Ga0495638_0058830
315 Ga0495638_0128746
316 Ga0495638_0174718
317 Ga0495651_0029000
318 Ga0495582_0078898
319 Ga0495582_0162851
320 Ga0495605_0083855
321 Ga0495662_0035462
322 Ga0495662_0060658
323 Ga0495585_0025674
324 Ga0495585_0070158
325 Ga0495594_0000649
326 Ga0495594_0030739
327 Ga0495594_0069859
328 Ga0495607_0091293
329 Ga0495606_0033636
330 Ga0495610_0098614
331 Ga0495616_0005236
332 Ga0495618_0044729
333 Ga0495620_0070974
334 Ga0495628_0089449
335 Ga0495628_0289071
336 Ga0495631_0016746
337 Ga0495637_0017165
338 Ga0495643_0015827
339 Ga0495666_0063251
340 Ga0495652_0330541
341 Ga0495586_0278650
342 Ga0495609_0015562
343 Ga0495597_0011469
344 Ga0495622_0064995
345 Ga0495622_0076728
346 Ga0495634_0183364
347 Ga0495634_0367825
348 Ga0495611_0045424
349 Ga0495625_0025316
350 Ga0495625_0190056
351 Ga0495635_0027670
352 Ga0495635_0104561
353 Ga0495635_0212004
354 Ga0495661_0105213
355 Ga0495588_0006263
356 Ga0495588_0048530
357 Ga0495657_0013475
358 Ga0495657_0081105
359 Ga0495657_0129024
360 Ga0495623_0029965
361 Ga0495613_0001356
362 Ga0495613_0027479
363 Ga0495613_0029348
364 Ga0495613_0286570
365 Ga0495613_0301732
366 Ga0495613_0323869
367 Ga0495624_0288438
368 Ga0495670_0022284
369 Ga0495670_0036397
370 Ga0495649_0025031
371 Ga0495589_0023016
372 Ga0495589_0040808
373 Ga0495589_0070272
374 Ga0495660_0058517
375 Ga0495581_0193061
376 Ga0495581_0210873
377 Ga0495604_0026521
378 Ga0495604_0058751
379 Ga0495636_0000860
380 Ga0495636_0001020
381 Ga0495636_0016178
382 Ga0495676_0000494
383 Ga0495676_0054384
384 Ga0495676_0054600
385 Ga0495676_0100795
386 Ga0495676_0142416
387 Ga0495680_0002821
388 Ga0495683_0066940
389 Ga0495687_008961
390 Ga0495687_016114
391 Ga0495687_068149
392 Ga0495687_099834
393 Ga0495685_039861
394 Ga0495685_043870
395 Ga0495681_0000676
396 Ga0495686_0074770
397 Ga0495593_0111796
398 Ga0495614_0000337
399 Ga0495614_0048569
400 Ga0495626_0013713
401 Ga0496105_0408540
402 Ga0496106_0100134
403 Ga0496108_0117272
404 Ga0496109_0029412
405 Ga0501031_0048633
406 Ga0501032_0066988
407 Ga0501033_0004179
408 Ga0501033_0168918
409 Ga0501034_0183977
410 Ga0501036_0014988
411 Ga0501036_0042021
412 Ga0501037_0035191
413 Ga0501038_0040112
414 Ga0501038_0127681
415 Ga0501039_0100290
416 Ga0501042_0043847
417 Ga0501043_0052010
418 Ga0501043_0056639
419 Ga0501043_0158202
420 Ga0501046_0034027
421 Ga0501047_0000262
422 Ga0501047_0023047
423 Ga0501047_0152919
424 Ga0501047_0184901
425 Ga0501047_0206216
426 Ga0501035_0404328
427 Ga0501044_0011413
428 nmdc:mga06z11_25143_c1
429 2554258650
430 2585301352
431 2616701804
432 2616899824
433 2643759698
434 2643897815
435 2643944741
436 2644385329
437 2644408960
438 2644431639
439 2644436306
440 2644462887
441 2644625832
442 2784587808
443 2785368513
444 2793984392
445 2804844825
446 2808841203
447 2808919719
448 2809231391
449 2811848211
450 2812359052
451 2819693730
452 2852641207
453 2862182550
454 2862288215
455 2862296940
456 2862384643
457 2862580055
458 2862709813
459 2867371035
460 2867480905
461 2875393736
462 2918503758
463 2919468604
464 2935392225
465 2946050926
466 2946066826
467 2946075151
468 2954003731
469 2954717087
470 2954727057
471 2954734745
472 2954745959
473 2954753632
474 2954764930
475 2966603347
476 2990046348
477 2990061952
478 2990090477
479 2997456496
480 2997608221
481 3006487020
482 8008488961
483 8008559486
484 8023628142
485 8025419268
486 8025528444
487 8033689298
488 8047899001
489 8048127639
490 8048359919
491 8048375965
492 8048382155
493 8054165201
494 8056453555
495 8056673321
496 8056836878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

207

281

0.93

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

33

170

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.8788 5 298
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.8665 5 298
2fk6-assembly1.cif.gz_A-2 crystal structure of rnase z/trna(thr) complex 0.8458 5 298
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.845 5 298
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8323 5 294
ID Description Score Start End Superfamily
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8305 5 297 3.60.15.10
af_D3ZB91_3_360_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8297 5 299 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8251 5 297 3.60.15.10
af_D3ZB91_3_360_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8119 5 299 3.60.15.10
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8079 5 297 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A0B8NLV8-F1-model_v4 Ribonuclease Z 0.9647 203 301 GO:0042781
AF-A0A0B8NLV8-F1-model_v4 Ribonuclease Z 0.9552 203 301 GO:0042781
AF-A0A0R2S549-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9386 201 289 GO:0042781
AF-A0A7J9PYU7-F1-model_v4 Ribonuclease Z 0.9228 192 298 GO:0042781
AF-X1SN85-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9175 192 298 GO:0042781

Map