F359445

General Info

Members Datasets Scaffolds Average Seq Length
247 210 494 331

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231119|2511701029
Length 373
Sequence TTMSILLILTLSHAQARALSKGSRSLQKAFILKRLKSNRPLAYTVSLLFLAVCTALGISIGSLHIPLSDVFWIGIGRTSSVDPMNVNIMINIRLPRVVLAALVGAALSIAGAAFQGLLKNPLADPYTLGVSSGASAGAVITLFFGIQIPVIGRFTLPVVSIAAAIAVMAAVLFFSRLVHASMSVSTLILTGIIMNSFLGALISLVIALTGNDLLPIVRWLLGSVSMRGWGYVALFLPFFLAGTVLLLINGRELNIMTYGEEKAKLLGVSTGKRKLLMIAAGSLLTGGAVAVSGTIGFVGLVIPHVTRLLWGTDHRHLLPLSALTGAGFLILADLFSRTVIEPVELPIGIMTALAGAPVFALILLRQHHGGKRL

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
88 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
89 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
90 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
91 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
92 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
137 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
138 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
139 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
140 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
141 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
142 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
143 2643221641 Nocardioides sp. Root122 Isolate Unclassified
144 2643221731 Bacillus sp. Root147 Isolate Unclassified
145 2643221732 Bacillus sp. Root239 Isolate Unclassified
146 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
147 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
148 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
149 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
150 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
151 2738541295 Bacillus sp. OK085 Isolate Unclassified
152 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
153 2738543010 Bacillus sp. YR335 Isolate Unclassified
154 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
155 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
156 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
157 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
158 2818991441 Niallia circulans 3243 Isolate Rhizosphere
159 2818991459 Paenibacillus sp. 597 Isolate Unclassified
160 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
161 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
162 2842682962 Bacillus sp. R-72492 Isolate Unclassified
163 2842882022 Bacillus sp. R-71893 Isolate Unclassified
164 2849139964 Bacillus sp. R-71875 Isolate Unclassified
165 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
166 2857581216 Bacillus sp. R-71922 Isolate Unclassified
167 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
168 2860837431 Bacillus sp. WR11 Isolate Unclassified
169 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
170 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
171 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
172 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
173 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
174 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
175 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
176 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
177 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
178 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
179 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
180 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
181 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
182 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
183 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
184 2919720352 Priestia megaterium 4340 Isolate Unclassified
185 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
186 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
187 2929004312 Priestia megaterium 1104 Isolate Unclassified
188 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
189 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
190 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
191 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
192 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
193 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
194 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
195 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
196 2969141011 Bacillus velezensis MH25 Isolate Unclassified
197 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
198 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
199 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
200 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
201 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
202 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
203 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
204 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
205 8022653035 Bacillus sp. Rc4 Isolate Unclassified
206 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
207 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
208 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
209 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
210 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.8
Metatranscriptomes 2.83
Isolates 30.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.29
Nodule 0
Rhizoplane 6.88
Rhizosphere 62.75
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10016932 3300003187 Bacteria 3176
2 rootH1_10011112 3300003316 Bacteria 15845
3 rootL2_10095634 3300003322 Bacteria 10818
4 Ga0006562J51391_1010457 3300003578 Bacteria 4580
5 Ga0055538_1000128 3300003751 Bacteria 55980
6 Ga0055538_1000244 3300003751 Bacteria 29561
7 Ga0055532_1003688 3300003758 Bacteria 2521
8 Ga0055528_1006178 3300003790 Bacteria 5462
9 Ga0070683_100010282 3300005329 Bacteria 8044
10 Ga0070670_100136034 3300005331 Bacteria 2124
11 Ga0070670_100282725 3300005331 Bacteria 1449
12 Ga0070680_100010158 3300005336 Bacteria 7259
13 Ga0070680_100372596 3300005336 Unclassified 1215
14 Ga0070689_100084648 3300005340 Bacteria 2493
15 Ga0070687_100063997 3300005343 Bacteria 1952
16 Ga0070669_100290376 3300005353 Bacteria 1313
17 Ga0070675_100252754 3300005354 Bacteria 1543
18 Ga0070675_100280686 3300005354 Bacteria 1463
19 Ga0070674_100057372 3300005356 Bacteria 2703
20 Ga0070659_100195763 3300005366 Bacteria 1662
21 Ga0070659_100204285 3300005366 Bacteria 1627
22 Ga0070667_100171813 3300005367 Bacteria 1914
23 Ga0070713_100135044 3300005436 Bacteria 2179
24 Ga0070711_100001646 3300005439 Bacteria 12354
25 Ga0070705_100064533 3300005440 Bacteria 2188
26 Ga0070681_10032750 3300005458 Bacteria 5218
27 Ga0070685_10079632 3300005466 Bacteria 1961
28 Ga0070698_100007273 3300005471 Bacteria 11992
29 Ga0070679_100007483 3300005530 Bacteria 10211
30 Ga0070684_100008075 3300005535 Bacteria 8217
31 Ga0070665_100051261 3300005548 Bacteria 4139
32 Ga0070702_100138693 3300005615 Bacteria 1546
33 Ga0068864_100111444 3300005618 Bacteria 2438
34 Ga0068860_100149093 3300005843 Bacteria 2252
35 Ga0068862_100057724 3300005844 Bacteria 3329
36 Ga0081455_10021287 3300005937 Bacteria 6085
37 Ga0081540_1048194 3300005983 Bacteria 2136
38 Ga0075364_10007239 3300006051 Bacteria 6576
39 Ga0070716_100008432 3300006173 Bacteria 5112
40 Ga0075362_10025959 3300006177 Bacteria 2499
41 Ga0075433_10012694 3300006852 Bacteria 6817
42 Ga0075434_100049260 3300006871 Bacteria 4182
43 Ga0075434_100250216 3300006871 Bacteria 1791
44 Ga0075434_100365375 3300006871 Bacteria 1464
45 Ga0075435_100006964 3300007076 Bacteria 8026
46 Ga0075435_100045289 3300007076 Bacteria 3526
47 Ga0105243_10045841 3300009148 Bacteria 3437
48 Ga0105248_10761587 3300009177 Bacteria 1093
49 Ga0105238_10033121 3300009551 Bacteria 5258
50 Ga0105238_10066673 3300009551 Bacteria 3601
51 Ga0105238_10465418 3300009551 Bacteria 1262
52 Ga0105246_10021383 3300011119 Bacteria 4164
53 Ga0157371_10011557 3300013102 Bacteria 6789
54 Ga0157374_10025921 3300013296 Bacteria 5271
55 Ga0163162_10207776 3300013306 Bacteria 2087
56 Ga0163162_10438950 3300013306 Bacteria 1438
57 Ga0157375_10094779 3300013308 Bacteria 3055
58 Ga0157377_10153009 3300014745 Bacteria 1428
59 Ga0209784_100051 3300025224 Bacteria 183666
60 Ga0209784_100438 3300025224 Bacteria 17908
61 Ga0209147_100831 3300025229 Bacteria 14555
62 Ga0209673_1013445 3300025273 Bacteria 3228
63 Ga0209676_1004268 3300025292 Bacteria 8058
64 Ga0209025_1005550 3300025294 Bacteria 10227
65 Ga0209025_1010096 3300025294 Bacteria 6451
66 Ga0209025_1030839 3300025294 Bacteria 2553
67 Ga0207426_1022410 3300025302 Bacteria 2168
68 Ga0207697_10029096 3300025315 Bacteria 2260
69 Ga0207655_1047898 3300025728 Bacteria 1760
70 Ga0207713_1014333 3300025735 Bacteria 4126
71 Ga0207684_10179841 3300025910 Unclassified 1823
72 Ga0207707_10054930 3300025912 Bacteria 3466
73 Ga0207663_10004911 3300025916 Bacteria 6692
74 Ga0207662_10012140 3300025918 Bacteria 4794
75 Ga0207652_10339871 3300025921 Bacteria 1355
76 Ga0207681_10089739 3300025923 Bacteria 2192
77 Ga0207681_10162142 3300025923 Bacteria 1687
78 Ga0207694_10010112 3300025924 Bacteria 7110
79 Ga0207694_10070004 3300025924 Bacteria 2741
80 Ga0207694_10295961 3300025924 Bacteria 1332
81 Ga0207700_10159203 3300025928 Bacteria 1874
82 Ga0207709_10022161 3300025935 Bacteria 3601
83 Ga0207669_10015990 3300025937 Bacteria 3800
84 Ga0207665_10009515 3300025939 Bacteria 6383
85 Ga0207665_10101204 3300025939 Bacteria 2012
86 Ga0207691_10038046 3300025940 Bacteria 4451
87 Ga0207689_10202858 3300025942 Bacteria 1637
88 Ga0207651_10125580 3300025960 Bacteria 1954
89 Ga0207712_10194734 3300025961 Bacteria 1602
90 Ga0207703_10037045 3300026035 Bacteria 3885
91 Ga0207708_10092349 3300026075 Bacteria 2335
92 Ga0207641_10004178 3300026088 Bacteria 12579
93 Ga0207648_10061877 3300026089 Bacteria 3264
94 Ga0209371_1002542 3300027312 Bacteria 10094
95 Ga0268256_1002248 3300030500 Bacteria 10094
96 Ga0265316_10009352 3300031344 Bacteria 9031
97 Ga0307408_100040664 3300031548 Bacteria 3293
98 Ga0307408_100135909 3300031548 Bacteria 1924
99 Ga0316579_10032207 3300031691 Bacteria 2404
100 Ga0307412_10162562 3300031911 Bacteria 1661
101 Ga0307409_100131639 3300031995 Bacteria 2139
102 Ga0307416_100041080 3300032002 Bacteria 3600
103 Ga0307416_100272679 3300032002 Bacteria 1662
104 Ga0316582_0047254 3300036647 Bacteria 2717
105 Ga0373925_0272780 3300037068 Bacteria 1361
106 Ga0395900_0307704 3300037418 Bacteria 1569
107 Ga0400484_32398 3300038725 Bacteria 1701
108 Ga0400484_42629 3300038725 Bacteria 12540
109 Ga0400485_01958 3300038735 Bacteria 8449
110 Ga0400488_44291 3300038741 Bacteria 1203
111 Ga0400486_20053 3300038742 Bacteria 8363
112 Ga0400486_23601 3300038742 Bacteria 2826
113 Ga0400483_021327 3300039062 Bacteria 2915
114 Ga0400483_234775 3300039062 Bacteria 4723
115 Ga0400483_246509 3300039062 Bacteria 3020
116 Ga0400483_247710 3300039062 Bacteria 13362
117 Ga0400487_11193 3300039110 Bacteria 30216
118 Ga0400487_36903 3300039110 Bacteria 2572
119 Ga0400487_51179 3300039110 Bacteria 5046
120 Ga0436365_1194966 3300039437 Bacteria 4676
121 Ga0451577_0204203 3300042876 Bacteria 1784
122 Ga0495603_0159311 3300046455 Bacteria 1309
123 Ga0495580_0011007 3300046472 Bacteria 7011
124 Ga0495582_0000693 3300046473 Bacteria 18587
125 Ga0495656_0095203 3300046615 Bacteria 1368
126 Ga0495661_0172898 3300046665 Bacteria 1151
127 Ga0495674_0115765 3300047319 Bacteria 2269
128 Ga0495672_0038929 3300047320 Bacteria 2896
129 Ga0495683_0043530 3300047323 Bacteria 2260
130 Ga0495626_0082512 3300048091 Bacteria 1426
131 Ga0496100_0017932 3300048903 Bacteria 4188
132 Ga0496100_0348992 3300048903 Bacteria 1117
133 Ga0496102_0332284 3300048905 Bacteria 1431
134 Ga0496104_0002823 3300048907 Bacteria 14978
135 Ga0496104_0008171 3300048907 Bacteria 9291
136 Ga0496104_0207391 3300048907 Bacteria 1872
137 Ga0496104_0557637 3300048907 Bacteria 1056
138 Ga0496105_0002086 3300048908 Bacteria 14459
139 Ga0496105_0022164 3300048908 Bacteria 5145
140 Ga0496106_0001886 3300048909 Bacteria 15709
141 Ga0496108_0047812 3300048911 Bacteria 3576
142 Ga0496109_0000858 3300048912 Bacteria 25390
143 Ga0496110_0008879 3300048913 Bacteria 8102
144 Ga0496110_0218566 3300048913 Bacteria 1733
145 Ga0496112_0141371 3300048915 Bacteria 2376
146 Ga0496115_0006115 3300048918 Bacteria 8799
147 Ga0496115_0027100 3300048918 Bacteria 4479
148 Ga0496119_0021213 3300048922 Bacteria 4704
149 Ga0496119_0083503 3300048922 Bacteria 1834
150 Ga0496120_0030051 3300048923 Bacteria 3309
151 Ga0496122_0016077 3300048925 Bacteria 7111
152 Ga0496124_0160459 3300048927 Bacteria 1753
153 Ga0496125_0023328 3300048928 Bacteria 5713
154 Ga0501343_000719 3300049132 Bacteria 2055
155 Ga0501343_001030 3300049132 Bacteria 1815
156 Ga0501305_004220 3300049161 Bacteria 1677
157 Ga0501312_001296 3300049528 Bacteria 2409
158 Ga0501315_000154 3300049531 Bacteria 3940
159 Ga0501315_004928 3300049531 Bacteria 1423
160 Ga0501033_0039132 3300049570 Bacteria 3542
161 Ga0501036_0025561 3300049572 Bacteria 4982
162 Ga0501039_0128986 3300049575 Bacteria 1984
163 Ga0501047_0065296 3300049581 Bacteria 3508
164 Ga0501035_0201334 3300049822 Bacteria 1707
165 Ga0501044_0062552 3300049823 Bacteria 3804
166 nmdc:mga00v17_102908_c1 3300050491 Bacteria 1804
167 nmdc:mga0n895_4091_c1 3300050512 Bacteria 11880
168 nmdc:mga0rr50_27622_c1 3300050513 Bacteria 3977
169 nmdc:mga0a205_71528_c1 3300050515 Bacteria 3350
170 Ga0495601_0066703 3300053077 Bacteria 2291
171 Ga0495612_0037682 3300053078 Bacteria 1964
172 Ga0500641_0138928 3300053096 Bacteria 1049
173 2511701029 2511231119 Bacteria 4019861
174 2511174589 2510917026 Bacteria 7046020
175 2511177044 2510917027 Bacteria 5287437
176 2540608230 2540341094 Bacteria 4061186
177 2545559491 2545555800 Bacteria 4222588
178 2578930448 2576861599 Bacteria 4217202
179 2631986374 2630968484 Bacteria 3876276
180 2644228219 2643221641 Bacteria 4490190
181 2644717336 2643221731 Bacteria 5623886
182 2644726148 2643221732 Bacteria 5756404
183 2651530646 2648501850 Bacteria 3975476
184 2672338733 2671180330 Bacteria 5521719
185 2674422032 2671180844 Bacteria 4164150
186 2695628984 2695420354 Bacteria 3922431
187 2717915318 2716884898 Bacteria 3928789
188 2738817938 2738541295 Bacteria 5730091
189 2738839154 2738541299 Bacteria 4020721
190 2739230827 2738543010 Bacteria 5583595
191 2776372683 2775506925 Bacteria 7237746
192 2808868982 2808606364 Bacteria 4465927
193 2809053358 2808606399 Bacteria 4021018
194 2816865343 2816332186 Bacteria 5331395
195 2819569708 2818991441 Bacteria 5062707
196 2819675013 2818991459 Bacteria 8736032
197 2819685482 2818991461 Bacteria 7026071
198 2819710752 2818991465 Bacteria 5388835
199 2842687585 2842682962 Bacteria 5589973
200 2842883190 2842882022 Bacteria 6158489
201 2849142997 2849139964 Bacteria 5613304
202 2852674216 2852673933 Bacteria 3347676
203 2857583128 2857581216 Bacteria 5522813
204 2857605725 2857604169 Bacteria 5111450
205 2860841021 2860837431 Bacteria 4202080
206 2863071335 2863067949 Bacteria 8541735
207 2866552434 2866552031 Bacteria 5824618
208 2877771915 2877768649 Bacteria 3957164
209 2880172754 2880169592 Bacteria 3900066
210 2886632695 2886627955 Bacteria 7618130
211 2888378531 2888373701 Bacteria 5098052
212 2897113030 2897109615 Bacteria 4009619
213 2898909430 2898907183 Bacteria 4067722
214 2904526137 2904524088 Bacteria 5887454
215 2904561351 2904560550 Bacteria 4029838
216 2904761431 2904755435 Bacteria 7986759
217 2916974384 2916971899 Bacteria 4250608
218 2919145271 2919143609 Bacteria 6219228
219 2919418601 2919414237 Bacteria 5429133
220 2919520459 2919517244 Bacteria 5858162
221 2919721592 2919720352 Bacteria 5986006
222 2928094650 2928093941 Bacteria 5965005
223 2928510857 2928510474 Bacteria 4815308
224 2929006828 2929004312 Bacteria 5678476
225 2932399651 2932398195 Bacteria 3847976
226 2936365763 2936361878 Bacteria 5632809
227 2939597766 2939593269 Bacteria 4798695
228 2960324493 2960319331 Bacteria 5502575
229 2960376144 2960375949 Bacteria 5361395
230 2962294256 2962290636 Bacteria 4072939
231 2964377113 2964375228 Bacteria 4909004
232 2969140230 2969136845 Bacteria 3923176
233 2969144466 2969141011 Bacteria 4118468
234 2969771324 2969770375 Bacteria 4271280
235 2980127490 2980125574 Bacteria 5567337
236 2980496016 2980492589 Bacteria 4072961
237 3001269699 3001267043 Bacteria 4823521
238 3001275045 3001272096 Bacteria 4729684
239 3006882755 3006879489 Bacteria 4064221
240 3006990833 3006988479 Bacteria 4767936
241 8022633180 8022630665 Bacteria 3886130
242 8022657044 8022653035 Bacteria 4035078
243 8022896319 8022893055 Bacteria 5300455
244 8022916267 8022914991 Bacteria 5584517
245 8051954470 8051952484 Bacteria 3926774
246 8052175448 8052174270 Bacteria 3881265
247 8056212402 8056207758 Bacteria 8639239
248 JGI25151J46595_10016932
249 rootH1_10011112
250 rootL2_10095634
251 Ga0006562J51391_1010457
252 Ga0055538_1000128
253 Ga0055538_1000244
254 Ga0055532_1003688
255 Ga0055528_1006178
256 Ga0070683_100010282
257 Ga0070670_100136034
258 Ga0070670_100282725
259 Ga0070680_100010158
260 Ga0070680_100372596
261 Ga0070689_100084648
262 Ga0070687_100063997
263 Ga0070669_100290376
264 Ga0070675_100252754
265 Ga0070675_100280686
266 Ga0070674_100057372
267 Ga0070659_100195763
268 Ga0070659_100204285
269 Ga0070667_100171813
270 Ga0070713_100135044
271 Ga0070711_100001646
272 Ga0070705_100064533
273 Ga0070681_10032750
274 Ga0070685_10079632
275 Ga0070698_100007273
276 Ga0070679_100007483
277 Ga0070684_100008075
278 Ga0070665_100051261
279 Ga0070702_100138693
280 Ga0068864_100111444
281 Ga0068860_100149093
282 Ga0068862_100057724
283 Ga0081455_10021287
284 Ga0081540_1048194
285 Ga0075364_10007239
286 Ga0070716_100008432
287 Ga0075362_10025959
288 Ga0075433_10012694
289 Ga0075434_100049260
290 Ga0075434_100250216
291 Ga0075434_100365375
292 Ga0075435_100006964
293 Ga0075435_100045289
294 Ga0105243_10045841
295 Ga0105248_10761587
296 Ga0105238_10033121
297 Ga0105238_10066673
298 Ga0105238_10465418
299 Ga0105246_10021383
300 Ga0157371_10011557
301 Ga0157374_10025921
302 Ga0163162_10207776
303 Ga0163162_10438950
304 Ga0157375_10094779
305 Ga0157377_10153009
306 Ga0209784_100051
307 Ga0209784_100438
308 Ga0209147_100831
309 Ga0209673_1013445
310 Ga0209676_1004268
311 Ga0209025_1005550
312 Ga0209025_1010096
313 Ga0209025_1030839
314 Ga0207426_1022410
315 Ga0207697_10029096
316 Ga0207655_1047898
317 Ga0207713_1014333
318 Ga0207684_10179841
319 Ga0207707_10054930
320 Ga0207663_10004911
321 Ga0207662_10012140
322 Ga0207652_10339871
323 Ga0207681_10089739
324 Ga0207681_10162142
325 Ga0207694_10010112
326 Ga0207694_10070004
327 Ga0207694_10295961
328 Ga0207700_10159203
329 Ga0207709_10022161
330 Ga0207669_10015990
331 Ga0207665_10009515
332 Ga0207665_10101204
333 Ga0207691_10038046
334 Ga0207689_10202858
335 Ga0207651_10125580
336 Ga0207712_10194734
337 Ga0207703_10037045
338 Ga0207708_10092349
339 Ga0207641_10004178
340 Ga0207648_10061877
341 Ga0209371_1002542
342 Ga0268256_1002248
343 Ga0265316_10009352
344 Ga0307408_100040664
345 Ga0307408_100135909
346 Ga0316579_10032207
347 Ga0307412_10162562
348 Ga0307409_100131639
349 Ga0307416_100041080
350 Ga0307416_100272679
351 Ga0316582_0047254
352 Ga0373925_0272780
353 Ga0395900_0307704
354 Ga0400484_32398
355 Ga0400484_42629
356 Ga0400485_01958
357 Ga0400488_44291
358 Ga0400486_20053
359 Ga0400486_23601
360 Ga0400483_021327
361 Ga0400483_234775
362 Ga0400483_246509
363 Ga0400483_247710
364 Ga0400487_11193
365 Ga0400487_36903
366 Ga0400487_51179
367 Ga0436365_1194966
368 Ga0451577_0204203
369 Ga0495603_0159311
370 Ga0495580_0011007
371 Ga0495582_0000693
372 Ga0495656_0095203
373 Ga0495661_0172898
374 Ga0495674_0115765
375 Ga0495672_0038929
376 Ga0495683_0043530
377 Ga0495626_0082512
378 Ga0496100_0017932
379 Ga0496100_0348992
380 Ga0496102_0332284
381 Ga0496104_0002823
382 Ga0496104_0008171
383 Ga0496104_0207391
384 Ga0496104_0557637
385 Ga0496105_0002086
386 Ga0496105_0022164
387 Ga0496106_0001886
388 Ga0496108_0047812
389 Ga0496109_0000858
390 Ga0496110_0008879
391 Ga0496110_0218566
392 Ga0496112_0141371
393 Ga0496115_0006115
394 Ga0496115_0027100
395 Ga0496119_0021213
396 Ga0496119_0083503
397 Ga0496120_0030051
398 Ga0496122_0016077
399 Ga0496124_0160459
400 Ga0496125_0023328
401 Ga0501343_000719
402 Ga0501343_001030
403 Ga0501305_004220
404 Ga0501312_001296
405 Ga0501315_000154
406 Ga0501315_004928
407 Ga0501033_0039132
408 Ga0501036_0025561
409 Ga0501039_0128986
410 Ga0501047_0065296
411 Ga0501035_0201334
412 Ga0501044_0062552
413 nmdc:mga00v17_102908_c1
414 nmdc:mga0n895_4091_c1
415 nmdc:mga0rr50_27622_c1
416 nmdc:mga0a205_71528_c1
417 Ga0495601_0066703
418 Ga0495612_0037682
419 Ga0500641_0138928
420 2511701029
421 2511174589
422 2511177044
423 2540608230
424 2545559491
425 2578930448
426 2631986374
427 2644228219
428 2644717336
429 2644726148
430 2651530646
431 2672338733
432 2674422032
433 2695628984
434 2717915318
435 2738817938
436 2738839154
437 2739230827
438 2776372683
439 2808868982
440 2809053358
441 2816865343
442 2819569708
443 2819675013
444 2819685482
445 2819710752
446 2842687585
447 2842883190
448 2849142997
449 2852674216
450 2857583128
451 2857605725
452 2860841021
453 2863071335
454 2866552434
455 2877771915
456 2880172754
457 2886632695
458 2888378531
459 2897113030
460 2898909430
461 2904526137
462 2904561351
463 2904761431
464 2916974384
465 2919145271
466 2919418601
467 2919520459
468 2919721592
469 2928094650
470 2928510857
471 2929006828
472 2932399651
473 2936365763
474 2939597766
475 2960324493
476 2960376144
477 2962294256
478 2964377113
479 2969140230
480 2969144466
481 2969771324
482 2980127490
483 2980496016
484 3001269699
485 3001275045
486 3006882755
487 3006990833
488 8022633180
489 8022657044
490 8022896319
491 8022916267
492 8051954470
493 8052175448
494 8056212402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01032

FecCD

FecCD transport family

48

365

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.8656 9 330
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.8602 9 330
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.8576 1 330
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.85 1 330
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.8463 13 330
ID Description Score Start End Superfamily
af_P23877_5_330_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8927 9 334 1.10.3470.10
af_Q57552_11_347_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8916 9 332 1.10.3470.10
af_Q2G1N5_4_331_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.886 11 334 1.10.3470.10
af_P23877_5_330_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8851 9 334 1.10.3470.10
af_Q2G1N5_4_331_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8732 11 334 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A7X5F637-F1-model_v4 Iron chelate uptake ABC transporter family permease subunit 0.9357 9 331 GO:0005886
GO:0022857
GO:0033214
AF-A0A2V0R7Z1-F1-model_v4 deleted 0.9325 79 330
AF-A0A1X0VQ83-F1-model_v4 deleted 0.9276 9 330
AF-A0A3M3LCU7-F1-model_v4 Putative hemin ABC transporter, permease protein 0.9252 10 330 GO:0005886
GO:0022857
GO:0033214
AF-A0A7Y3DJS3-F1-model_v4 Iron ABC transporter permease 0.9231 9 335 GO:0005886
GO:0022857
GO:0033214

Map