F359414

General Info

Members Datasets Scaffolds Average Seq Length
247 143 494 378

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_12993_c1|nmdc:mga05p37_12993_c1_6937_8247
Length 410
Sequence VIDWVIAGQSDNQLPNYPITRLGLYVHVPFCSAICNYCNFNRGLFDADLKARYVEALIAEIERAGQAGWTNAAVIGREVAQGFSPASADTIYFGGGTPSLLEPDEVARIIDACASSFDVAADREVTLEANPETVTEARLATFKAAGVNRLSFGVQSLNDAELQRLSRLHSAARARDAVGEARAAGFDNVSVDLMMWLPEQRPADWLETVDGAIALAPDHLSLYLLEVYPNAPLKEAMARARWSQAPDDDAAAMYLTAMERLEDAGLGQYEISNVARAGRQSRHNLKYWTDGEWVGFGCGAHSTRNGVRWKNVSSTEEYLDRLGRQASPALDVHVLSPDERLGDALFTGLRLVDGIDLSAIDIRYGVDVWARFGADLQPFVDAGFLLHKGDGLRLTREGMLIAHEVMAVFV

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
77 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
78 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
82 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
83 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
88 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.24
Rhizosphere 96.76
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_12993_c1 3300050507 Bacteria 9963
2 JGI25406J46586_10001596 3300003203 Bacteria 10703
3 Ga0070683_100130637 3300005329 Bacteria 2377
4 Ga0070690_100204225 3300005330 Bacteria 1376
5 Ga0070670_100074268 3300005331 Bacteria 2920
6 Ga0070689_100062334 3300005340 Bacteria 2901
7 Ga0070689_100075690 3300005340 Bacteria 2636
8 Ga0070669_100062292 3300005353 Bacteria 2742
9 Ga0070675_100000079 3300005354 Bacteria 56265
10 Ga0070675_100029149 3300005354 Bacteria 4449
11 Ga0070675_100112754 3300005354 Unclassified 2302
12 Ga0070671_100062653 3300005355 Bacteria 3096
13 Ga0070673_100046220 3300005364 Bacteria 3380
14 Ga0070688_100027692 3300005365 Bacteria 3376
15 Ga0070688_100053746 3300005365 Bacteria 2520
16 Ga0070688_100116127 3300005365 Bacteria 1787
17 Ga0070667_100003497 3300005367 Bacteria 13388
18 Ga0068867_100021526 3300005459 Bacteria 4601
19 Ga0068867_100032174 3300005459 Unclassified 3791
20 Ga0068867_100129953 3300005459 Bacteria 1956
21 Ga0068867_100262424 3300005459 Bacteria 1409
22 Ga0070706_100192587 3300005467 Bacteria 1905
23 Ga0070698_100057855 3300005471 Bacteria 3922
24 Ga0070699_100088541 3300005518 Bacteria 2704
25 Ga0070672_100049629 3300005543 Bacteria 3266
26 Ga0070665_100018624 3300005548 Bacteria 6959
27 Ga0070664_100073652 3300005564 Bacteria 2931
28 Ga0068859_100149272 3300005617 Bacteria 2413
29 Ga0068864_100106538 3300005618 Bacteria 2493
30 Ga0068861_100097297 3300005719 Bacteria 2334
31 Ga0068863_100004319 3300005841 Bacteria 14007
32 Ga0068863_100072719 3300005841 Bacteria 3253
33 Ga0068858_100004357 3300005842 Bacteria 13886
34 Ga0068858_100098911 3300005842 Unclassified 2720
35 Ga0068858_100163345 3300005842 Bacteria 2097
36 Ga0068858_100172963 3300005842 Bacteria 2037
37 Ga0068860_100216323 3300005843 Bacteria 1859
38 Ga0068862_100203195 3300005844 Bacteria 1787
39 Ga0081455_10026865 3300005937 Bacteria 5286
40 Ga0081539_10000122 3300005985 Bacteria 183393
41 Ga0081539_10000251 3300005985 Bacteria 125220
42 Ga0081539_10008527 3300005985 Bacteria 8890
43 Ga0081539_10070761 3300005985 Bacteria 1871
44 Ga0097621_100001505 3300006237 Bacteria 15948
45 Ga0097621_100001628 3300006237 Bacteria 15402
46 Ga0068871_100009149 3300006358 Bacteria 7159
47 Ga0068871_100188507 3300006358 Bacteria 1775
48 Ga0068871_100226909 3300006358 Unclassified 1620
49 Ga0075430_100016513 3300006846 Bacteria 6287
50 Ga0075431_100047819 3300006847 Bacteria 4411
51 Ga0075431_100266242 3300006847 Bacteria 1738
52 Ga0075433_10006686 3300006852 Bacteria 9132
53 Ga0075433_10068745 3300006852 Unclassified 3110
54 Ga0075433_10090951 3300006852 Bacteria 2697
55 Ga0075429_100052440 3300006880 Bacteria 3549
56 Ga0075429_100194202 3300006880 Bacteria 1778
57 Ga0075429_100264035 3300006880 Bacteria 1507
58 Ga0068865_100007952 3300006881 Bacteria 6547
59 Ga0075436_100000578 3300006914 Bacteria 23933
60 Ga0075436_100038177 3300006914 Bacteria 3315
61 Ga0097620_100149274 3300006931 Bacteria 2413
62 Ga0075435_100000084 3300007076 Bacteria 49470
63 Ga0075435_100003133 3300007076 Bacteria 11173
64 Ga0075435_100033310 3300007076 Bacteria 4073
65 Ga0111539_10035225 3300009094 Bacteria 6062
66 Ga0111539_10055578 3300009094 Bacteria 4706
67 Ga0111539_10091262 3300009094 Bacteria 3579
68 Ga0105245_10009333 3300009098 Bacteria 8556
69 Ga0114129_10004308 3300009147 Bacteria 20111
70 Ga0114129_10015271 3300009147 Bacteria 10929
71 Ga0114129_10028394 3300009147 Bacteria 7928
72 Ga0114129_10029657 3300009147 Bacteria 7748
73 Ga0114129_10054565 3300009147 Bacteria 5603
74 Ga0114129_10058770 3300009147 Bacteria 5379
75 Ga0114129_10146778 3300009147 Bacteria 3231
76 Ga0105243_10010296 3300009148 Bacteria 7103
77 Ga0105242_10162281 3300009176 Unclassified 1957
78 Ga0105242_10167810 3300009176 Bacteria 1927
79 Ga0105248_10004279 3300009177 Bacteria 15796
80 Ga0105248_10011760 3300009177 Bacteria 9654
81 Ga0105248_10057659 3300009177 Bacteria 4360
82 Ga0105249_10189655 3300009553 Bacteria 2006
83 Ga0157375_10082985 3300013308 Unclassified 3248
84 Ga0163163_10321396 3300014325 Bacteria 1601
85 Ga0157380_10109253 3300014326 Bacteria 2320
86 Ga0157380_10235053 3300014326 Bacteria 1649
87 Ga0157379_10166748 3300014968 Bacteria 1988
88 Ga0207642_10026083 3300025899 Bacteria 2374
89 Ga0207642_10029952 3300025899 Unclassified 2261
90 Ga0207642_10030499 3300025899 Bacteria 2247
91 Ga0207680_10062657 3300025903 Unclassified 2273
92 Ga0207685_10097855 3300025905 Bacteria 1249
93 Ga0207643_10044551 3300025908 Unclassified 2505
94 Ga0207646_10169133 3300025922 Unclassified 1974
95 Ga0207681_10087437 3300025923 Bacteria 2217
96 Ga0207650_10029444 3300025925 Bacteria 3948
97 Ga0207650_10046356 3300025925 Bacteria 3201
98 Ga0207650_10060582 3300025925 Bacteria 2825
99 Ga0207659_10000541 3300025926 Bacteria 22593
100 Ga0207659_10066819 3300025926 Bacteria 2611
101 Ga0207644_10097725 3300025931 Bacteria 2200
102 Ga0207644_10125257 3300025931 Bacteria 1960
103 Ga0207644_10227036 3300025931 Bacteria 1482
104 Ga0207706_10101484 3300025933 Bacteria 2532
105 Ga0207686_10003504 3300025934 Bacteria 8430
106 Ga0207686_10005375 3300025934 Bacteria 6868
107 Ga0207686_10130770 3300025934 Bacteria 1721
108 Ga0207691_10009708 3300025940 Bacteria 9235
109 Ga0207711_10304525 3300025941 Unclassified 1470
110 Ga0207711_10492416 3300025941 Bacteria 1142
111 Ga0207661_10101645 3300025944 Bacteria 2416
112 Ga0207679_10100497 3300025945 Bacteria 2260
113 Ga0207667_10271123 3300025949 Bacteria 1735
114 Ga0207651_10084722 3300025960 Bacteria 2297
115 Ga0207658_10122020 3300025986 Bacteria 2079
116 Ga0207641_10013328 3300026088 Bacteria 6742
117 Ga0207648_10097825 3300026089 Bacteria 2569
118 Ga0207648_10109501 3300026089 Bacteria 2425
119 Ga0207648_10167814 3300026089 Unclassified 1940
120 Ga0207675_100007777 3300026118 Bacteria 10112
121 Ga0207675_100128137 3300026118 Bacteria 2405
122 Ga0207698_10091926 3300026142 Bacteria 2486
123 Ga0207428_10029386 3300027907 Bacteria 4556
124 Ga0207428_10047777 3300027907 Bacteria 3436
125 Ga0268266_10015169 3300028379 Bacteria 6615
126 Ga0268264_10106759 3300028381 Bacteria 2445
127 Ga0268264_10331475 3300028381 Bacteria 1442
128 Ga0307407_10060233 3300031903 Bacteria 2215
129 Ga0373930_0002016 3300034816 Bacteria 3111
130 Ga0373958_0000413 3300034819 Bacteria 5205
131 Ga0373938_0000954 3300034957 Bacteria 4637
132 Ga0373934_0006544 3300035086 Bacteria 4323
133 Ga0373949_0000162 3300035090 Bacteria 25518
134 Ga0373951_0000272 3300035091 Bacteria 16526
135 Ga0373932_0000163 3300035112 Bacteria 19481
136 Ga0373939_0003466 3300035114 Bacteria 3701
137 Ga0373941_0001779 3300035115 Bacteria 4634
138 Ga0373957_0006108 3300035120 Bacteria 3777
139 Ga0373960_0000236 3300035121 Bacteria 10271
140 Ga0373942_0000021 3300035207 Bacteria 30804
141 Ga0373962_0001134 3300035242 Bacteria 6224
142 Ga0373931_0000446 3300035691 Bacteria 16799
143 Ga0373947_0065364 3300035725 Bacteria 2219
144 Ga0373947_0095754 3300035725 Unclassified 1858
145 Ga0373937_0484386 3300036401 Bacteria 1175
146 Ga0451577_0057985 3300042876 Bacteria 3451
147 Ga0451576_0021152 3300045051 Bacteria 7072
148 Ga0451576_0239822 3300045051 Bacteria 1894
149 Ga0495635_0131536 3300046663 Bacteria 1706
150 Ga0495658_0070686 3300046683 Bacteria 2026
151 Ga0496100_0029651 3300048903 Unclassified 3386
152 Ga0496101_0001544 3300048904 Bacteria 13795
153 Ga0496102_0169094 3300048905 Unclassified 2058
154 Ga0496104_0124562 3300048907 Unclassified 2474
155 Ga0496105_0101287 3300048908 Unclassified 2378
156 Ga0496106_0130485 3300048909 Bacteria 1970
157 Ga0496112_0011967 3300048915 Bacteria 7952
158 Ga0496114_0004726 3300048917 Bacteria 10595
159 Ga0501031_0000245 3300049568 Bacteria 30428
160 Ga0501031_0055703 3300049568 Bacteria 2576
161 Ga0501032_0001350 3300049569 Bacteria 19494
162 Ga0501032_0050020 3300049569 Bacteria 2818
163 Ga0501032_0211119 3300049569 Bacteria 1265
164 Ga0501033_0003588 3300049570 Bacteria 12679
165 Ga0501033_0011723 3300049570 Bacteria 6703
166 Ga0501033_0013213 3300049570 Bacteria 6290
167 Ga0501034_0011053 3300049571 Bacteria 9374
168 Ga0501034_0135694 3300049571 Bacteria 2441
169 Ga0501036_0003522 3300049572 Bacteria 12523
170 Ga0501036_0005387 3300049572 Bacteria 10365
171 Ga0501036_0026996 3300049572 Bacteria 4852
172 Ga0501037_0001557 3300049573 Bacteria 16735
173 Ga0501037_0007962 3300049573 Bacteria 7767
174 Ga0501037_0095370 3300049573 Bacteria 2150
175 Ga0501038_0003039 3300049574 Bacteria 15643
176 Ga0501038_0008258 3300049574 Bacteria 9583
177 Ga0501038_0010850 3300049574 Bacteria 8325
178 Ga0501039_0022017 3300049575 Bacteria 4891
179 Ga0501039_0145892 3300049575 Bacteria 1860
180 Ga0501042_0000489 3300049578 Bacteria 20562
181 Ga0501042_0164223 3300049578 Bacteria 1602
182 Ga0501043_0001483 3300049579 Bacteria 20526
183 Ga0501043_0016559 3300049579 Bacteria 5779
184 Ga0501046_0000981 3300049580 Bacteria 27870
185 Ga0501046_0014248 3300049580 Bacteria 6715
186 Ga0501047_0001185 3300049581 Bacteria 25820
187 Ga0501048_0004576 3300049582 Bacteria 10524
188 Ga0501048_0023449 3300049582 Bacteria 4508
189 Ga0501067_0000172 3300049583 Bacteria 36346
190 Ga0501067_0027456 3300049583 Bacteria 3154
191 Ga0501067_0115008 3300049583 Bacteria 1496
192 Ga0501068_0000559 3300049584 Bacteria 18915
193 Ga0501068_0012284 3300049584 Bacteria 4847
194 Ga0501068_0121083 3300049584 Bacteria 1631
195 Ga0501069_0000114 3300049585 Bacteria 36063
196 Ga0501069_0019655 3300049585 Bacteria 3655
197 Ga0501070_0009491 3300049586 Bacteria 8225
198 Ga0501071_0007370 3300049587 Bacteria 7215
199 Ga0501073_0000590 3300049589 Bacteria 25627
200 Ga0501073_0002146 3300049589 Bacteria 14753
201 Ga0501073_0029252 3300049589 Bacteria 3936
202 Ga0501074_0000334 3300049590 Bacteria 27398
203 Ga0501074_0001042 3300049590 Bacteria 18032
204 Ga0501074_0159971 3300049590 Bacteria 1608
205 Ga0501075_0025786 3300049591 Bacteria 4320
206 Ga0501076_0034393 3300049592 Bacteria 3961
207 Ga0501076_0072948 3300049592 Bacteria 2748
208 Ga0501079_0004579 3300049741 Bacteria 10258
209 Ga0501079_0009510 3300049741 Bacteria 7370
210 Ga0501079_0011271 3300049741 Bacteria 6819
211 Ga0501080_0019378 3300049742 Bacteria 6303
212 Ga0501083_0003418 3300049744 Bacteria 11097
213 Ga0501083_0076916 3300049744 Bacteria 2214
214 Ga0501035_0007972 3300049822 Bacteria 9877
215 Ga0501035_0012624 3300049822 Bacteria 7805
216 Ga0501044_0008530 3300049823 Bacteria 11228
217 Ga0501044_0154413 3300049823 Bacteria 2275
218 Ga0501045_0001298 3300049824 Bacteria 16572
219 Ga0501045_0018245 3300049824 Bacteria 4989
220 nmdc:mga05p37_130162_c1 3300050507 Bacteria 3088
221 nmdc:mga05p37_130925_c1 3300050507 Bacteria 3078
222 nmdc:mga05p37_20997_c1 3300050507 Bacteria 7904
223 nmdc:mga05p37_47042_c1 3300050507 Bacteria 5305
224 nmdc:mga05p37_53036_c1 3300050507 Bacteria 4988
225 nmdc:mga09592_333220_c1 3300050508 Bacteria 1314
226 nmdc:mga0qj67_78901_c1 3300050509 Bacteria 2636
227 nmdc:mga06r32_125531_c1 3300050510 Bacteria 2534
228 nmdc:mga06r32_13326_c1 3300050510 Bacteria 7446
229 nmdc:mga08y16_77048_c1 3300050511 Bacteria 3476
230 nmdc:mga0n895_116232_c1 3300050512 Unclassified 2694
231 nmdc:mga0n895_25903_c1 3300050512 Bacteria 5546
232 nmdc:mga0rr50_2164_c1 3300050513 Bacteria 10993
233 nmdc:mga0rr50_278622_c1 3300050513 Bacteria 1395
234 nmdc:mga0rr50_29669_c1 3300050513 Bacteria 3861
235 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
236 nmdc:mga08x19_340_c1 3300050514 Bacteria 33767
237 nmdc:mga08x19_70348_c1 3300050514 Bacteria 2280
238 nmdc:mga0a205_23743_c2 3300050515 Bacteria 4186
239 nmdc:mga0a205_362596_c1 3300050515 Bacteria 1316
240 nmdc:mga0a205_99617_c1 3300050515 Bacteria 2804
241 Ga0495619_0045718 3300053085 Bacteria 2877
242 Ga0501084_0002132 3300054114 Bacteria 15810
243 Ga0501084_0004358 3300054114 Bacteria 11532
244 Ga0590071_007533 3300059421 Bacteria 2577
245 Ga0501082_0001188 3300060353 Bacteria 22878
246 Ga0501082_0001263 3300060353 Bacteria 22209
247 Ga0501082_0166856 3300060353 Bacteria 1913
248 nmdc:mga05p37_12993_c1
249 JGI25406J46586_10001596
250 Ga0070683_100130637
251 Ga0070690_100204225
252 Ga0070670_100074268
253 Ga0070689_100062334
254 Ga0070689_100075690
255 Ga0070669_100062292
256 Ga0070675_100000079
257 Ga0070675_100029149
258 Ga0070675_100112754
259 Ga0070671_100062653
260 Ga0070673_100046220
261 Ga0070688_100027692
262 Ga0070688_100053746
263 Ga0070688_100116127
264 Ga0070667_100003497
265 Ga0068867_100021526
266 Ga0068867_100032174
267 Ga0068867_100129953
268 Ga0068867_100262424
269 Ga0070706_100192587
270 Ga0070698_100057855
271 Ga0070699_100088541
272 Ga0070672_100049629
273 Ga0070665_100018624
274 Ga0070664_100073652
275 Ga0068859_100149272
276 Ga0068864_100106538
277 Ga0068861_100097297
278 Ga0068863_100004319
279 Ga0068863_100072719
280 Ga0068858_100004357
281 Ga0068858_100098911
282 Ga0068858_100163345
283 Ga0068858_100172963
284 Ga0068860_100216323
285 Ga0068862_100203195
286 Ga0081455_10026865
287 Ga0081539_10000122
288 Ga0081539_10000251
289 Ga0081539_10008527
290 Ga0081539_10070761
291 Ga0097621_100001505
292 Ga0097621_100001628
293 Ga0068871_100009149
294 Ga0068871_100188507
295 Ga0068871_100226909
296 Ga0075430_100016513
297 Ga0075431_100047819
298 Ga0075431_100266242
299 Ga0075433_10006686
300 Ga0075433_10068745
301 Ga0075433_10090951
302 Ga0075429_100052440
303 Ga0075429_100194202
304 Ga0075429_100264035
305 Ga0068865_100007952
306 Ga0075436_100000578
307 Ga0075436_100038177
308 Ga0097620_100149274
309 Ga0075435_100000084
310 Ga0075435_100003133
311 Ga0075435_100033310
312 Ga0111539_10035225
313 Ga0111539_10055578
314 Ga0111539_10091262
315 Ga0105245_10009333
316 Ga0114129_10004308
317 Ga0114129_10015271
318 Ga0114129_10028394
319 Ga0114129_10029657
320 Ga0114129_10054565
321 Ga0114129_10058770
322 Ga0114129_10146778
323 Ga0105243_10010296
324 Ga0105242_10162281
325 Ga0105242_10167810
326 Ga0105248_10004279
327 Ga0105248_10011760
328 Ga0105248_10057659
329 Ga0105249_10189655
330 Ga0157375_10082985
331 Ga0163163_10321396
332 Ga0157380_10109253
333 Ga0157380_10235053
334 Ga0157379_10166748
335 Ga0207642_10026083
336 Ga0207642_10029952
337 Ga0207642_10030499
338 Ga0207680_10062657
339 Ga0207685_10097855
340 Ga0207643_10044551
341 Ga0207646_10169133
342 Ga0207681_10087437
343 Ga0207650_10029444
344 Ga0207650_10046356
345 Ga0207650_10060582
346 Ga0207659_10000541
347 Ga0207659_10066819
348 Ga0207644_10097725
349 Ga0207644_10125257
350 Ga0207644_10227036
351 Ga0207706_10101484
352 Ga0207686_10003504
353 Ga0207686_10005375
354 Ga0207686_10130770
355 Ga0207691_10009708
356 Ga0207711_10304525
357 Ga0207711_10492416
358 Ga0207661_10101645
359 Ga0207679_10100497
360 Ga0207667_10271123
361 Ga0207651_10084722
362 Ga0207658_10122020
363 Ga0207641_10013328
364 Ga0207648_10097825
365 Ga0207648_10109501
366 Ga0207648_10167814
367 Ga0207675_100007777
368 Ga0207675_100128137
369 Ga0207698_10091926
370 Ga0207428_10029386
371 Ga0207428_10047777
372 Ga0268266_10015169
373 Ga0268264_10106759
374 Ga0268264_10331475
375 Ga0307407_10060233
376 Ga0373930_0002016
377 Ga0373958_0000413
378 Ga0373938_0000954
379 Ga0373934_0006544
380 Ga0373949_0000162
381 Ga0373951_0000272
382 Ga0373932_0000163
383 Ga0373939_0003466
384 Ga0373941_0001779
385 Ga0373957_0006108
386 Ga0373960_0000236
387 Ga0373942_0000021
388 Ga0373962_0001134
389 Ga0373931_0000446
390 Ga0373947_0065364
391 Ga0373947_0095754
392 Ga0373937_0484386
393 Ga0451577_0057985
394 Ga0451576_0021152
395 Ga0451576_0239822
396 Ga0495635_0131536
397 Ga0495658_0070686
398 Ga0496100_0029651
399 Ga0496101_0001544
400 Ga0496102_0169094
401 Ga0496104_0124562
402 Ga0496105_0101287
403 Ga0496106_0130485
404 Ga0496112_0011967
405 Ga0496114_0004726
406 Ga0501031_0000245
407 Ga0501031_0055703
408 Ga0501032_0001350
409 Ga0501032_0050020
410 Ga0501032_0211119
411 Ga0501033_0003588
412 Ga0501033_0011723
413 Ga0501033_0013213
414 Ga0501034_0011053
415 Ga0501034_0135694
416 Ga0501036_0003522
417 Ga0501036_0005387
418 Ga0501036_0026996
419 Ga0501037_0001557
420 Ga0501037_0007962
421 Ga0501037_0095370
422 Ga0501038_0003039
423 Ga0501038_0008258
424 Ga0501038_0010850
425 Ga0501039_0022017
426 Ga0501039_0145892
427 Ga0501042_0000489
428 Ga0501042_0164223
429 Ga0501043_0001483
430 Ga0501043_0016559
431 Ga0501046_0000981
432 Ga0501046_0014248
433 Ga0501047_0001185
434 Ga0501048_0004576
435 Ga0501048_0023449
436 Ga0501067_0000172
437 Ga0501067_0027456
438 Ga0501067_0115008
439 Ga0501068_0000559
440 Ga0501068_0012284
441 Ga0501068_0121083
442 Ga0501069_0000114
443 Ga0501069_0019655
444 Ga0501070_0009491
445 Ga0501071_0007370
446 Ga0501073_0000590
447 Ga0501073_0002146
448 Ga0501073_0029252
449 Ga0501074_0000334
450 Ga0501074_0001042
451 Ga0501074_0159971
452 Ga0501075_0025786
453 Ga0501076_0034393
454 Ga0501076_0072948
455 Ga0501079_0004579
456 Ga0501079_0009510
457 Ga0501079_0011271
458 Ga0501080_0019378
459 Ga0501083_0003418
460 Ga0501083_0076916
461 Ga0501035_0007972
462 Ga0501035_0012624
463 Ga0501044_0008530
464 Ga0501044_0154413
465 Ga0501045_0001298
466 Ga0501045_0018245
467 nmdc:mga05p37_130162_c1
468 nmdc:mga05p37_130925_c1
469 nmdc:mga05p37_20997_c1
470 nmdc:mga05p37_47042_c1
471 nmdc:mga05p37_53036_c1
472 nmdc:mga09592_333220_c1
473 nmdc:mga0qj67_78901_c1
474 nmdc:mga06r32_125531_c1
475 nmdc:mga06r32_13326_c1
476 nmdc:mga08y16_77048_c1
477 nmdc:mga0n895_116232_c1
478 nmdc:mga0n895_25903_c1
479 nmdc:mga0rr50_2164_c1
480 nmdc:mga0rr50_278622_c1
481 nmdc:mga0rr50_29669_c1
482 nmdc:mga0rr50_2_c1
483 nmdc:mga08x19_340_c1
484 nmdc:mga08x19_70348_c1
485 nmdc:mga0a205_23743_c2
486 nmdc:mga0a205_362596_c1
487 nmdc:mga0a205_99617_c1
488 Ga0495619_0045718
489 Ga0501084_0002132
490 Ga0501084_0004358
491 Ga0590071_007533
492 Ga0501082_0001188
493 Ga0501082_0001263
494 Ga0501082_0166856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06969

HemN_C

HemN C-terminal domain

335

401

0.98

PF04055

Radical_SAM

Radical SAM superfamily

25

211

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.8592 2 382
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.8489 2 382
6fd2-assembly1.cif.gz_B radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine 0.7417 34 212
6qk7-assembly1.cif.gz_C elongator catalytic subcomplex elp123 lobe 0.7402 1 229
8asw-assembly1.cif.gz_C cryo-em structure of yeast elp123 in complex with alanine trna 0.7375 1 229
ID Description Score Start End Superfamily
af_Q5SUV1_33_283_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9387 3 250 3.20.20.70
af_A4IGH2_157_284_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9363 121 247 3.30.750.200
af_A4IGH2_157_284_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9225 121 247 3.30.750.200
af_Q2FXY9_297_360_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9196 306 368 1.10.10.10
af_Q5SUV1_33_283_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9065 3 250 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V8A9R6-F1-model_v4 Oxygen-independent coproporphyrinogen III oxidase 0.9848 224 374 GO:0005737
GO:0006779
GO:0051539
AF-A0A2M8NNS1-F1-model_v4 Heme chaperone HemW 0.966 73 380 GO:0004109
GO:0005737
GO:0006779
GO:0046872
GO:0051539
AF-A0A2V8A9R6-F1-model_v4 Oxygen-independent coproporphyrinogen III oxidase 0.9658 224 374 GO:0005737
GO:0006779
GO:0051539
AF-A0A0W8E6N5-F1-model_v4 Radical SAM core domain-containing protein 0.9634 76 381 GO:0004109
GO:0005737
GO:0006779
GO:0051539
AF-X1AZX0-F1-model_v4 Radical SAM core domain-containing protein 0.963 121 265 GO:0003824
GO:0005737
GO:0006779
GO:0051539

Map