F359399

General Info

Members Datasets Scaffolds Average Seq Length
247 112 494 145

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0164908|Ga0501074_0164908_148_702
Length 168
Sequence VPRRDERGQAAVLIIGLATVLAMTIALVVDATAAYLQRQGLDTLADGAALRGADLGATGRDAYEGGVPDDRLELTAAQARQAVGAYLRSTGAYSRYPGLTYRVRVDPATRSVEVSLRAPLDLPLTVPGSPEVAMVGATRTAPPTRTGHKSRPVPQPGQRTFPPAMITR

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
32 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
45 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
46 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
47 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
52 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
53 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
54 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
55 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
56 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
57 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
58 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
59 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
60 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
61 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
62 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
63 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
67 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
68 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
95 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
107 2643221641 Nocardioides sp. Root122 Isolate Unclassified
108 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
109 2739367898 Nocardioides sp. CF479 Isolate Unclassified
110 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
111 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
112 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 0
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.63
Nodule 0.4
Rhizoplane 6.88
Rhizosphere 53.04
Stem 0
Stem Tuber 0
Unclassified 4.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0164908 3300049590 Bacteria 1582
2 Ga0068869_101380918 3300005334 Bacteria 623
3 Ga0068868_100692106 3300005338 Bacteria 911
4 Ga0070667_100047158 3300005367 Bacteria 3625
5 Ga0070700_101623907 3300005441 Bacteria 553
6 Ga0068853_101195078 3300005539 Bacteria 734
7 Ga0070672_100496785 3300005543 Bacteria 1055
8 Ga0068857_100181912 3300005577 Bacteria 1913
9 Ga0070702_100738964 3300005615 Bacteria 754
10 Ga0070702_101578664 3300005615 Bacteria 542
11 Ga0068864_100526391 3300005618 Bacteria 1140
12 Ga0068861_100717633 3300005719 Bacteria 931
13 Ga0068860_100000389 3300005843 Bacteria 57408
14 Ga0075365_10002944 3300006038 Bacteria 8607
15 Ga0075365_10003733 3300006038 Bacteria 7922
16 Ga0075365_10013787 3300006038 Bacteria 4849
17 Ga0075365_10019919 3300006038 Bacteria 4151
18 Ga0075365_10046800 3300006038 Bacteria 2842
19 Ga0075365_10051639 3300006038 Bacteria 2716
20 Ga0075365_10287980 3300006038 Bacteria 1156
21 Ga0075365_10388444 3300006038 Bacteria 985
22 Ga0075365_10406757 3300006038 Bacteria 961
23 Ga0075365_10509620 3300006038 Bacteria 850
24 Ga0075365_10520099 3300006038 Bacteria 841
25 Ga0075365_10931508 3300006038 Bacteria 612
26 Ga0075365_11003677 3300006038 Bacteria 588
27 Ga0075365_11237848 3300006038 Bacteria 525
28 Ga0075365_11259185 3300006038 Bacteria 520
29 Ga0075368_10171497 3300006042 Bacteria 912
30 Ga0075363_100002098 3300006048 Bacteria 7990
31 Ga0075363_100073082 3300006048 Bacteria 1865
32 Ga0075363_100141157 3300006048 Bacteria 1356
33 Ga0075363_100189562 3300006048 Bacteria 1172
34 Ga0075363_100238519 3300006048 Unclassified 1045
35 Ga0075363_100527765 3300006048 Bacteria 703
36 Ga0075364_10007811 3300006051 Bacteria 6370
37 Ga0075364_10036794 3300006051 Bacteria 3166
38 Ga0075364_10053648 3300006051 Bacteria 2635
39 Ga0075364_10250496 3300006051 Bacteria 1204
40 Ga0075364_10953084 3300006051 Bacteria 584
41 Ga0075362_10008378 3300006177 Unclassified 3951
42 Ga0075362_10187419 3300006177 Bacteria 1004
43 Ga0075367_10020195 3300006178 Bacteria 3706
44 Ga0075367_10087114 3300006178 Bacteria 1896
45 Ga0075367_10089492 3300006178 Bacteria 1872
46 Ga0075367_10103100 3300006178 Bacteria 1746
47 Ga0075367_10456618 3300006178 Bacteria 810
48 Ga0075367_10527239 3300006178 Bacteria 750
49 Ga0075367_10585128 3300006178 Bacteria 709
50 Ga0075370_10007115 3300006353 Bacteria 5680
51 Ga0075370_10021116 3300006353 Bacteria 3566
52 Ga0075370_10055227 3300006353 Bacteria 2256
53 Ga0075370_10144285 3300006353 Bacteria 1393
54 Ga0075370_10221367 3300006353 Bacteria 1119
55 Ga0075370_10262154 3300006353 Bacteria 1025
56 Ga0075370_10512890 3300006353 Bacteria 724
57 Ga0105245_11521706 3300009098 Bacteria 720
58 Ga0105243_10056363 3300009148 Bacteria 3125
59 Ga0157375_10418406 3300013308 Bacteria 1506
60 Ga0163163_12434092 3300014325 Bacteria 582
61 Ga0157380_10743688 3300014326 Bacteria 991
62 Ga0207691_10365168 3300025940 Bacteria 1234
63 Ga0207677_11484727 3300026023 Bacteria 626
64 Ga0207708_10220260 3300026075 Bacteria 1520
65 Ga0207674_10535286 3300026116 Bacteria 1132
66 Ga0207675_100116198 3300026118 Bacteria 2528
67 Ga0207675_100564297 3300026118 Bacteria 1139
68 Ga0207698_10976685 3300026142 Bacteria 857
69 Ga0209813_10005643 3300027866 Bacteria 3048
70 Ga0209813_10020924 3300027866 Bacteria 1835
71 Ga0268264_10000250 3300028381 Bacteria 100909
72 Ga0307405_10146379 3300031731 Bacteria 1655
73 Ga0307405_10466952 3300031731 Bacteria 1004
74 Ga0307413_10627440 3300031824 Bacteria 883
75 Ga0307410_10053520 3300031852 Bacteria 2732
76 Ga0307410_10147442 3300031852 Bacteria 1748
77 Ga0307406_11193657 3300031901 Bacteria 660
78 Ga0307406_11365290 3300031901 Bacteria 620
79 Ga0307407_10415862 3300031903 Bacteria 968
80 Ga0307407_10823308 3300031903 Bacteria 708
81 Ga0307407_10929153 3300031903 Bacteria 669
82 Ga0307409_100044307 3300031995 Bacteria 3350
83 Ga0307409_100069139 3300031995 Bacteria 2796
84 Ga0307409_100326572 3300031995 Bacteria 1438
85 Ga0307409_100407099 3300031995 Bacteria 1301
86 Ga0307409_102716772 3300031995 Bacteria 523
87 Ga0307416_100023557 3300032002 Bacteria 4470
88 Ga0307416_100541267 3300032002 Bacteria 1236
89 Ga0307416_100587524 3300032002 Bacteria 1192
90 Ga0307414_10062975 3300032004 Bacteria 2635
91 Ga0307414_10403615 3300032004 Bacteria 1188
92 Ga0307414_11315293 3300032004 Bacteria 671
93 Ga0307411_10206170 3300032005 Bacteria 1514
94 Ga0307411_11860838 3300032005 Bacteria 560
95 Ga0307415_100001443 3300032126 Bacteria 11378
96 Ga0307415_100065129 3300032126 Bacteria 2538
97 Ga0307415_100481346 3300032126 Bacteria 1081
98 Ga0307415_100603856 3300032126 Unclassified 977
99 Ga0307415_101126012 3300032126 Bacteria 736
100 Ga0395898_1349480 3300037466 Bacteria 642
101 Ga0451793_1816007 3300041452 Bacteria 826
102 Ga0451797_1512412 3300041453 Bacteria 525
103 Ga0451849_1506801 3300041505 Bacteria 586
104 Ga0451843_0153385 3300041509 Bacteria 512
105 Ga0451843_0985795 3300041509 Bacteria 869
106 Ga0466963_0057608 3300044694 Bacteria 2588
107 Ga0466963_0496011 3300044694 Bacteria 862
108 Ga0466964_0404482 3300044706 Bacteria 714
109 Ga0466967_0070320 3300045976 Bacteria 3131
110 Ga0466967_0072992 3300045976 Bacteria 3077
111 Ga0466967_0555988 3300045976 Bacteria 1130
112 Ga0466967_1850363 3300045976 Bacteria 601
113 Ga0495603_0181133 3300046455 Bacteria 1219
114 Ga0495641_0340347 3300046461 Bacteria 678
115 Ga0495620_0278247 3300046515 Unclassified 637
116 Ga0495647_0071016 3300046681 Bacteria 1394
117 Ga0496100_1333003 3300048903 Bacteria 566
118 Ga0496101_0326787 3300048904 Bacteria 1204
119 Ga0496101_0987242 3300048904 Bacteria 662
120 Ga0496102_0168518 3300048905 Bacteria 2061
121 Ga0496102_1321524 3300048905 Bacteria 640
122 Ga0496106_0380397 3300048909 Bacteria 1134
123 Ga0496107_0164329 3300048910 Bacteria 1646
124 Ga0496108_1280574 3300048911 Bacteria 617
125 Ga0496109_1139753 3300048912 Bacteria 717
126 Ga0496110_0469626 3300048913 Bacteria 1146
127 Ga0496110_1094227 3300048913 Bacteria 705
128 Ga0496111_0146861 3300048914 Bacteria 1748
129 Ga0496113_0795044 3300048916 Bacteria 752
130 Ga0496114_0063680 3300048917 Bacteria 3087
131 Ga0496114_0126896 3300048917 Bacteria 2200
132 Ga0496117_0412985 3300048920 Bacteria 677
133 Ga0496118_0198400 3300048921 Bacteria 1192
134 Ga0501031_0008220 3300049568 Bacteria 6788
135 Ga0501031_0215685 3300049568 Bacteria 1250
136 Ga0501032_0082498 3300049569 Bacteria 2139
137 Ga0501034_0630293 3300049571 Unclassified 975
138 Ga0501036_0348646 3300049572 Bacteria 1236
139 Ga0501036_0412020 3300049572 Bacteria 1127
140 Ga0501036_0619068 3300049572 Bacteria 897
141 Ga0501038_0069484 3300049574 Bacteria 2992
142 Ga0501038_0105733 3300049574 Bacteria 2338
143 Ga0501039_0021381 3300049575 Bacteria 4965
144 Ga0501039_0074607 3300049575 Bacteria 2636
145 Ga0501039_0106035 3300049575 Unclassified 2195
146 Ga0501039_0152239 3300049575 Bacteria 1817
147 Ga0501039_0210436 3300049575 Bacteria 1529
148 Ga0501040_0355555 3300049576 Bacteria 1049
149 Ga0501041_0007539 3300049577 Bacteria 6388
150 Ga0501042_0020483 3300049578 Bacteria 4603
151 Ga0501042_0419454 3300049578 Bacteria 970
152 Ga0501042_1122880 3300049578 Bacteria 573
153 Ga0501046_1066336 3300049580 Bacteria 559
154 Ga0501048_0027454 3300049582 Bacteria 4136
155 Ga0501048_0969011 3300049582 Bacteria 612
156 Ga0501067_0012430 3300049583 Bacteria 4722
157 Ga0501067_0364842 3300049583 Bacteria 805
158 Ga0501068_0132665 3300049584 Bacteria 1558
159 Ga0501069_0045893 3300049585 Bacteria 2422
160 Ga0501069_0376870 3300049585 Unclassified 838
161 Ga0501070_0007398 3300049586 Bacteria 9329
162 Ga0501070_0242044 3300049586 Bacteria 1477
163 Ga0501070_0755466 3300049586 Bacteria 766
164 Ga0501071_0084614 3300049587 Bacteria 2325
165 Ga0501071_0117794 3300049587 Bacteria 1967
166 Ga0501071_0133853 3300049587 Bacteria 1843
167 Ga0501071_0169108 3300049587 Bacteria 1636
168 Ga0501071_0252946 3300049587 Bacteria 1330
169 Ga0501071_0471978 3300049587 Bacteria 961
170 Ga0501072_0017795 3300049588 Bacteria 5465
171 Ga0501072_0020721 3300049588 Bacteria 5096
172 Ga0501072_0033426 3300049588 Bacteria 4030
173 Ga0501072_0384409 3300049588 Bacteria 1114
174 Ga0501072_0760397 3300049588 Bacteria 760
175 Ga0501073_0006677 3300049589 Bacteria 8591
176 Ga0501074_0020404 3300049590 Bacteria 4816
177 Ga0501074_0031865 3300049590 Bacteria 3820
178 Ga0501075_0384158 3300049591 Bacteria 1070
179 Ga0501075_0537046 3300049591 Bacteria 892
180 Ga0501076_0094775 3300049592 Bacteria 2404
181 Ga0501076_0496214 3300049592 Bacteria 1006
182 Ga0501077_0133267 3300049593 Bacteria 1576
183 Ga0501077_0202078 3300049593 Bacteria 1262
184 Ga0501077_0741705 3300049593 Bacteria 631
185 Ga0501079_0167462 3300049741 Bacteria 1713
186 Ga0501079_0256431 3300049741 Bacteria 1367
187 Ga0501080_0047994 3300049742 Bacteria 3976
188 Ga0501080_0059646 3300049742 Bacteria 3550
189 Ga0501083_0008879 3300049744 Bacteria 7098
190 Ga0501035_0086627 3300049822 Bacteria 2760
191 Ga0501045_0018049 3300049824 Bacteria 5012
192 Ga0501045_0189609 3300049824 Bacteria 1532
193 Ga0501045_0306455 3300049824 Bacteria 1182
194 Ga0501045_0671745 3300049824 Bacteria 765
195 nmdc:mga03683_102930_c1 3300050489 Unclassified 1256
196 nmdc:mga03n38_130893_c1 3300050490 Bacteria 1243
197 nmdc:mga03n38_164460_c1 3300050490 Unclassified 1126
198 nmdc:mga03n38_219557_c1 3300050490 Bacteria 991
199 nmdc:mga03n38_41013_c1 3300050490 Bacteria 2015
200 nmdc:mga03n38_545605_c1 3300050490 Bacteria 655
201 nmdc:mga03n38_605466_c1 3300050490 Bacteria 624
202 nmdc:mga03n38_9342_c1 3300050490 Bacteria 3563
203 nmdc:mga00v17_134576_c1 3300050491 Bacteria 1581
204 nmdc:mga00v17_205473_c1 3300050491 Bacteria 1274
205 nmdc:mga00v17_309130_c1 3300050491 Bacteria 1027
206 nmdc:mga00v17_610498_c1 3300050491 Bacteria 703
207 nmdc:mga00v17_615731_c1 3300050491 Unclassified 700
208 nmdc:mga00v17_741069_c1 3300050491 Bacteria 628
209 nmdc:mga00v17_756395_c1 3300050491 Bacteria 621
210 nmdc:mga0yw44_1200747_c1 3300050492 Bacteria 512
211 nmdc:mga0yw44_1247410_c1 3300050492 Bacteria 501
212 nmdc:mga0yw44_194374_c1 3300050492 Bacteria 1339
213 nmdc:mga0yw44_20406_c1 3300050492 Unclassified 3677
214 nmdc:mga0yw44_210255_c1 3300050492 Bacteria 1287
215 nmdc:mga0yw44_2175_c2 3300050492 Bacteria 4768
216 nmdc:mga0yw44_256246_c1 3300050492 Bacteria 1165
217 nmdc:mga0yw44_301001_c1 3300050492 Bacteria 1074
218 nmdc:mga0yw44_391585_c1 3300050492 Bacteria 939
219 nmdc:mga0yw44_59436_c1 3300050492 Bacteria 2339
220 nmdc:mga0yw44_64410_c1 3300050492 Bacteria 2256
221 nmdc:mga0yw44_67438_c1 3300050492 Bacteria 2211
222 nmdc:mga0yw44_81469_c1 3300050492 Bacteria 2029
223 nmdc:mga0yw44_933847_c1 3300050492 Bacteria 588
224 nmdc:mga06z11_310244_c1 3300050494 Bacteria 939
225 nmdc:mga06z11_42030_c1 3300050494 Bacteria 2290
226 nmdc:mga06z11_42314_c1 3300050494 Bacteria 2284
227 nmdc:mga06z11_725598_c1 3300050494 Bacteria 605
228 nmdc:mga04h51_540941_c1 3300050495 Bacteria 501
229 nmdc:mga04h51_5416_c1 3300050495 Bacteria 3254
230 nmdc:mga04h51_69001_c1 3300050495 Bacteria 1230
231 nmdc:mga07m45_157979_c1 3300050496 Bacteria 1316
232 nmdc:mga07m45_163666_c1 3300050496 Bacteria 1292
233 nmdc:mga07m45_18281_c2 3300050496 Bacteria 2575
234 nmdc:mga07m45_450552_c1 3300050496 Bacteria 746
235 Ga0500644_0000225 3300053088 Bacteria 32583
236 Ga0500641_0049714 3300053096 Bacteria 1721
237 Ga0500554_097857 3300053102 Bacteria 980
238 Ga0501084_0175493 3300054114 Bacteria 1809
239 Ga0501082_0034580 3300060353 Bacteria 4355
240 Ga0501082_0647539 3300060353 Bacteria 925
241 Ga0530510_0335907 3300061734 Bacteria 1134
242 2644231143 2643221641 Bacteria 4490190
243 2644321507 2643221657 Bacteria 5490246
244 2740166490 2739367898 Bacteria 4367674
245 2855388987 2855386786 Bacteria 4752232
246 2857482773 2857481737 Bacteria 4761446
247 8054610485 8054609563 Bacteria 5170090
248 Ga0501074_0164908
249 Ga0068869_101380918
250 Ga0068868_100692106
251 Ga0070667_100047158
252 Ga0070700_101623907
253 Ga0068853_101195078
254 Ga0070672_100496785
255 Ga0068857_100181912
256 Ga0070702_100738964
257 Ga0070702_101578664
258 Ga0068864_100526391
259 Ga0068861_100717633
260 Ga0068860_100000389
261 Ga0075365_10002944
262 Ga0075365_10003733
263 Ga0075365_10013787
264 Ga0075365_10019919
265 Ga0075365_10046800
266 Ga0075365_10051639
267 Ga0075365_10287980
268 Ga0075365_10388444
269 Ga0075365_10406757
270 Ga0075365_10509620
271 Ga0075365_10520099
272 Ga0075365_10931508
273 Ga0075365_11003677
274 Ga0075365_11237848
275 Ga0075365_11259185
276 Ga0075368_10171497
277 Ga0075363_100002098
278 Ga0075363_100073082
279 Ga0075363_100141157
280 Ga0075363_100189562
281 Ga0075363_100238519
282 Ga0075363_100527765
283 Ga0075364_10007811
284 Ga0075364_10036794
285 Ga0075364_10053648
286 Ga0075364_10250496
287 Ga0075364_10953084
288 Ga0075362_10008378
289 Ga0075362_10187419
290 Ga0075367_10020195
291 Ga0075367_10087114
292 Ga0075367_10089492
293 Ga0075367_10103100
294 Ga0075367_10456618
295 Ga0075367_10527239
296 Ga0075367_10585128
297 Ga0075370_10007115
298 Ga0075370_10021116
299 Ga0075370_10055227
300 Ga0075370_10144285
301 Ga0075370_10221367
302 Ga0075370_10262154
303 Ga0075370_10512890
304 Ga0105245_11521706
305 Ga0105243_10056363
306 Ga0157375_10418406
307 Ga0163163_12434092
308 Ga0157380_10743688
309 Ga0207691_10365168
310 Ga0207677_11484727
311 Ga0207708_10220260
312 Ga0207674_10535286
313 Ga0207675_100116198
314 Ga0207675_100564297
315 Ga0207698_10976685
316 Ga0209813_10005643
317 Ga0209813_10020924
318 Ga0268264_10000250
319 Ga0307405_10146379
320 Ga0307405_10466952
321 Ga0307413_10627440
322 Ga0307410_10053520
323 Ga0307410_10147442
324 Ga0307406_11193657
325 Ga0307406_11365290
326 Ga0307407_10415862
327 Ga0307407_10823308
328 Ga0307407_10929153
329 Ga0307409_100044307
330 Ga0307409_100069139
331 Ga0307409_100326572
332 Ga0307409_100407099
333 Ga0307409_102716772
334 Ga0307416_100023557
335 Ga0307416_100541267
336 Ga0307416_100587524
337 Ga0307414_10062975
338 Ga0307414_10403615
339 Ga0307414_11315293
340 Ga0307411_10206170
341 Ga0307411_11860838
342 Ga0307415_100001443
343 Ga0307415_100065129
344 Ga0307415_100481346
345 Ga0307415_100603856
346 Ga0307415_101126012
347 Ga0395898_1349480
348 Ga0451793_1816007
349 Ga0451797_1512412
350 Ga0451849_1506801
351 Ga0451843_0153385
352 Ga0451843_0985795
353 Ga0466963_0057608
354 Ga0466963_0496011
355 Ga0466964_0404482
356 Ga0466967_0070320
357 Ga0466967_0072992
358 Ga0466967_0555988
359 Ga0466967_1850363
360 Ga0495603_0181133
361 Ga0495641_0340347
362 Ga0495620_0278247
363 Ga0495647_0071016
364 Ga0496100_1333003
365 Ga0496101_0326787
366 Ga0496101_0987242
367 Ga0496102_0168518
368 Ga0496102_1321524
369 Ga0496106_0380397
370 Ga0496107_0164329
371 Ga0496108_1280574
372 Ga0496109_1139753
373 Ga0496110_0469626
374 Ga0496110_1094227
375 Ga0496111_0146861
376 Ga0496113_0795044
377 Ga0496114_0063680
378 Ga0496114_0126896
379 Ga0496117_0412985
380 Ga0496118_0198400
381 Ga0501031_0008220
382 Ga0501031_0215685
383 Ga0501032_0082498
384 Ga0501034_0630293
385 Ga0501036_0348646
386 Ga0501036_0412020
387 Ga0501036_0619068
388 Ga0501038_0069484
389 Ga0501038_0105733
390 Ga0501039_0021381
391 Ga0501039_0074607
392 Ga0501039_0106035
393 Ga0501039_0152239
394 Ga0501039_0210436
395 Ga0501040_0355555
396 Ga0501041_0007539
397 Ga0501042_0020483
398 Ga0501042_0419454
399 Ga0501042_1122880
400 Ga0501046_1066336
401 Ga0501048_0027454
402 Ga0501048_0969011
403 Ga0501067_0012430
404 Ga0501067_0364842
405 Ga0501068_0132665
406 Ga0501069_0045893
407 Ga0501069_0376870
408 Ga0501070_0007398
409 Ga0501070_0242044
410 Ga0501070_0755466
411 Ga0501071_0084614
412 Ga0501071_0117794
413 Ga0501071_0133853
414 Ga0501071_0169108
415 Ga0501071_0252946
416 Ga0501071_0471978
417 Ga0501072_0017795
418 Ga0501072_0020721
419 Ga0501072_0033426
420 Ga0501072_0384409
421 Ga0501072_0760397
422 Ga0501073_0006677
423 Ga0501074_0020404
424 Ga0501074_0031865
425 Ga0501075_0384158
426 Ga0501075_0537046
427 Ga0501076_0094775
428 Ga0501076_0496214
429 Ga0501077_0133267
430 Ga0501077_0202078
431 Ga0501077_0741705
432 Ga0501079_0167462
433 Ga0501079_0256431
434 Ga0501080_0047994
435 Ga0501080_0059646
436 Ga0501083_0008879
437 Ga0501035_0086627
438 Ga0501045_0018049
439 Ga0501045_0189609
440 Ga0501045_0306455
441 Ga0501045_0671745
442 nmdc:mga03683_102930_c1
443 nmdc:mga03n38_130893_c1
444 nmdc:mga03n38_164460_c1
445 nmdc:mga03n38_219557_c1
446 nmdc:mga03n38_41013_c1
447 nmdc:mga03n38_545605_c1
448 nmdc:mga03n38_605466_c1
449 nmdc:mga03n38_9342_c1
450 nmdc:mga00v17_134576_c1
451 nmdc:mga00v17_205473_c1
452 nmdc:mga00v17_309130_c1
453 nmdc:mga00v17_610498_c1
454 nmdc:mga00v17_615731_c1
455 nmdc:mga00v17_741069_c1
456 nmdc:mga00v17_756395_c1
457 nmdc:mga0yw44_1200747_c1
458 nmdc:mga0yw44_1247410_c1
459 nmdc:mga0yw44_194374_c1
460 nmdc:mga0yw44_20406_c1
461 nmdc:mga0yw44_210255_c1
462 nmdc:mga0yw44_2175_c2
463 nmdc:mga0yw44_256246_c1
464 nmdc:mga0yw44_301001_c1
465 nmdc:mga0yw44_391585_c1
466 nmdc:mga0yw44_59436_c1
467 nmdc:mga0yw44_64410_c1
468 nmdc:mga0yw44_67438_c1
469 nmdc:mga0yw44_81469_c1
470 nmdc:mga0yw44_933847_c1
471 nmdc:mga06z11_310244_c1
472 nmdc:mga06z11_42030_c1
473 nmdc:mga06z11_42314_c1
474 nmdc:mga06z11_725598_c1
475 nmdc:mga04h51_540941_c1
476 nmdc:mga04h51_5416_c1
477 nmdc:mga04h51_69001_c1
478 nmdc:mga07m45_157979_c1
479 nmdc:mga07m45_163666_c1
480 nmdc:mga07m45_18281_c2
481 nmdc:mga07m45_450552_c1
482 Ga0500644_0000225
483 Ga0500641_0049714
484 Ga0500554_097857
485 Ga0501084_0175493
486 Ga0501082_0034580
487 Ga0501082_0647539
488 Ga0530510_0335907
489 2644231143
490 2644321507
491 2740166490
492 2855388987
493 2857482773
494 8054610485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13400

Tad

Putative Flp pilus-assembly TadE/G-like

8

55

0.94

Map