F358931

General Info

Members Datasets Scaffolds Average Seq Length
247 180 494 255

Family's Representative Sequence

Representative Sequence 3300006948|Ga0099826_10020194|Ga0099826_100201944
Length 280
Sequence MFWVLLLLLAWAAAGTACTRLCLAAVHAAAADADARRHDLTLYEAAFLSGGPRRVADLTLVSMARQRRLLLAHTGWATVVDPRGRDEMERMVIGAIGPEGQSRIAPVRADAASADAVRSIADRLVDAGLAVPDGARSGIAAAVRQVRLASVAVVALGAIALLVPAPSEMPRHLVALWFALPLALSLSCLAIARMEVHPYSRWASPAGQRLLGALSRRTGSTDERTYLTSVAVRGISAVGEPDLRAAFAHREQHRGRPREEWREERPGGHGEEHRRPHGCD

Samples

Sample ID Description Type Environment
1 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
19 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
20 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
21 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
22 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
23 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
24 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
25 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
26 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
27 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
28 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
32 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
33 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
34 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
35 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
36 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
37 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
45 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
48 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
51 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
54 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
55 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
56 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
57 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
58 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
59 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
83 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
128 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
129 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
130 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
133 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
134 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
135 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
136 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
137 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
138 2643221647 Streptomyces sp. Root369 Isolate Unclassified
139 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
140 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
141 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
142 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
143 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
144 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
145 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
146 2808606448 Streptomyces sp. 193411 Isolate Unclassified
147 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
148 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
149 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
150 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
151 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
152 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
153 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
154 2862574272 Streptomyces sp. AcE210 Isolate Nodule
155 2867428634 Streptomyces sp. RP5T Isolate Unclassified
156 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
157 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
158 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
159 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
160 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
161 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
162 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
163 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
164 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
165 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
166 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
167 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
168 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
169 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
170 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
171 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
172 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
173 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
174 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
175 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
176 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
177 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
178 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
179 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
180 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.16
Metatranscriptomes 0
Isolates 19.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.88
Nodule 0.81
Rhizoplane 0.81
Rhizosphere 75.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099826_10020194 3300006948 Bacteria 5000
2 rootH2_10024281 3300003320 Bacteria 1773
3 rootH1_10082842 3300003323 Bacteria 4627
4 JGI25160J50197_1040692 3300003354 Bacteria 1074
5 Ga0068852_100831954 3300005616 Bacteria 938
6 Ga0075365_10077368 3300006038 Bacteria 2248
7 Ga0075368_10030681 3300006042 Bacteria 2082
8 Ga0075363_100075256 3300006048 Bacteria 1839
9 Ga0075363_100098545 3300006048 Bacteria 1616
10 Ga0075363_100190743 3300006048 Bacteria 1169
11 Ga0075367_10024405 3300006178 Bacteria 3409
12 Ga0105250_10037939 3300009092 Bacteria 1933
13 Ga0105246_10010370 3300011119 Bacteria 5765
14 Ga0182008_10006336 3300014497 Bacteria 6625
15 Ga0182006_1031649 3300015261 Bacteria 2130
16 Ga0182007_10000145 3300015262 Bacteria 47705
17 Ga0183367_1001 3300015688 Bacteria 1225545
18 Ga0207426_1011229 3300025302 Bacteria 3426
19 Ga0207426_1011915 3300025302 Bacteria 3290
20 Ga0207426_1057463 3300025302 Bacteria 1132
21 Ga0207696_1046788 3300025711 Bacteria 1247
22 Ga0307517_10003088 3300028786 Bacteria 26275
23 Ga0307515_10000279 3300028794 Bacteria 125422
24 Ga0307511_10003004 3300030521 Bacteria 17457
25 Ga0307512_10052733 3300030522 Bacteria 3240
26 Ga0307513_10033738 3300031456 Bacteria 5750
27 Ga0307509_10015029 3300031507 Bacteria 9065
28 Ga0307509_10065389 3300031507 Bacteria 3819
29 Ga0307508_10035468 3300031616 Bacteria 4495
30 Ga0307514_10079630 3300031649 Bacteria 2427
31 Ga0307516_10120418 3300031730 Bacteria 2416
32 Ga0307518_10125549 3300031838 Bacteria 1810
33 Ga0307518_10168244 3300031838 Bacteria 1497
34 Ga0307507_10012468 3300033179 Bacteria 10501
35 Ga0307507_10276207 3300033179 Bacteria 1055
36 Ga0307510_10016053 3300033180 Bacteria 8844
37 Ga0307510_10048955 3300033180 Bacteria 4501
38 Ga0307510_10166584 3300033180 Bacteria 1790
39 Ga0307510_10180695 3300033180 Bacteria 1673
40 Ga0395898_0018538 3300037466 Bacteria 7094
41 Ga0395898_0034496 3300037466 Bacteria 5042
42 Ga0439436_0004165 3300041404 Bacteria 4432
43 Ga0439439_0007397 3300041406 Bacteria 2567
44 Ga0439433_0000577 3300041999 Bacteria 6966
45 Ga0439448_0009625 3300042005 Bacteria 2852
46 Ga0439449_0000019 3300042007 Bacteria 46468
47 Ga0439449_0031134 3300042007 Bacteria 1988
48 Ga0450903_000136 3300042138 Bacteria 16124
49 Ga0466969_0019237 3300044656 Bacteria 3553
50 Ga0466972_0014361 3300044658 Bacteria 3967
51 Ga0466972_0032332 3300044658 Bacteria 2569
52 Ga0466965_0203897 3300044683 Bacteria 1050
53 Ga0466966_0028391 3300044684 Bacteria 3644
54 Ga0466961_0006135 3300044693 Bacteria 7626
55 Ga0466963_0000594 3300044694 Bacteria 17256
56 Ga0466963_0047754 3300044694 Bacteria 2826
57 Ga0466964_0027326 3300044706 Bacteria 2240
58 Ga0466964_0060472 3300044706 Bacteria 1576
59 Ga0466971_0002739 3300044719 Bacteria 7447
60 Ga0466970_0001581 3300044765 Bacteria 10999
61 Ga0466957_0000224 3300044842 Bacteria 26690
62 Ga0466959_0001264 3300045049 Bacteria 15277
63 Ga0466958_0012142 3300045836 Bacteria 4869
64 Ga0466967_0000194 3300045976 Bacteria 25425
65 Ga0466967_0114355 3300045976 Bacteria 2484
66 Ga0466967_0583122 3300045976 Bacteria 1102
67 Ga0495592_0028284 3300046454 Bacteria 4246
68 Ga0495592_0053264 3300046454 Bacteria 3002
69 Ga0495603_0000999 3300046455 Bacteria 16318
70 Ga0495603_0001149 3300046455 Bacteria 15459
71 Ga0495603_0011016 3300046455 Bacteria 5483
72 Ga0495629_0003422 3300046459 Bacteria 12006
73 Ga0495629_0006538 3300046459 Bacteria 8633
74 Ga0495629_0009525 3300046459 Bacteria 7097
75 Ga0495629_0276315 3300046459 Bacteria 1153
76 Ga0495638_0053922 3300046460 Bacteria 2501
77 Ga0495638_0079612 3300046460 Bacteria 1992
78 Ga0495651_0010045 3300046462 Bacteria 7276
79 Ga0495651_0237359 3300046462 Bacteria 1252
80 Ga0495580_0076583 3300046472 Bacteria 2333
81 Ga0495605_0046207 3300046474 Bacteria 2142
82 Ga0495639_0083380 3300046475 Bacteria 1491
83 Ga0495639_0195603 3300046475 Bacteria 988
84 Ga0495662_0005737 3300046476 Bacteria 6209
85 Ga0495662_0017081 3300046476 Bacteria 3512
86 Ga0495664_0001104 3300046477 Bacteria 13966
87 Ga0495585_0067598 3300046492 Bacteria 1954
88 Ga0495594_0017570 3300046499 Bacteria 3781
89 Ga0495594_0022877 3300046499 Bacteria 3346
90 Ga0495583_0044576 3300046506 Bacteria 2056
91 Ga0495583_0067408 3300046506 Bacteria 1581
92 Ga0495606_0250553 3300046507 Bacteria 983
93 Ga0495608_0189166 3300046511 Bacteria 1300
94 Ga0495618_0035281 3300046514 Bacteria 3139
95 Ga0495620_0014249 3300046515 Bacteria 4046
96 Ga0495620_0045299 3300046515 Bacteria 1906
97 Ga0495628_0155133 3300046516 Bacteria 1742
98 Ga0495628_0186259 3300046516 Bacteria 1568
99 Ga0495643_0003336 3300046522 Bacteria 11829
100 Ga0495648_0077011 3300046524 Bacteria 1913
101 Ga0495652_0009252 3300046529 Bacteria 8956
102 Ga0495640_0008249 3300046533 Bacteria 8175
103 Ga0495587_0131568 3300046536 Bacteria 1430
104 Ga0495597_0010992 3300046542 Bacteria 4401
105 Ga0495597_0018741 3300046542 Bacteria 3244
106 Ga0495645_0027979 3300046543 Bacteria 4095
107 Ga0495667_0176321 3300046559 Bacteria 1373
108 Ga0495668_0086202 3300046616 Bacteria 1722
109 Ga0495625_0020156 3300046660 Bacteria 5152
110 Ga0495635_0001134 3300046663 Bacteria 17766
111 Ga0495635_0076472 3300046663 Bacteria 2294
112 Ga0495661_0207007 3300046665 Bacteria 1024
113 Ga0495588_0001232 3300046674 Bacteria 11021
114 Ga0495588_0010261 3300046674 Bacteria 4350
115 Ga0495588_0122219 3300046674 Bacteria 1372
116 Ga0495657_0000512 3300046675 Bacteria 36227
117 Ga0495657_0006550 3300046675 Bacteria 9101
118 Ga0495657_0172215 3300046675 Bacteria 1332
119 Ga0495623_0116756 3300046679 Bacteria 1612
120 Ga0495646_0001690 3300046680 Bacteria 13217
121 Ga0495613_0009840 3300046689 Bacteria 7111
122 Ga0495613_0042602 3300046689 Bacteria 3358
123 Ga0495613_0043006 3300046689 Bacteria 3342
124 Ga0495613_0221777 3300046689 Bacteria 1327
125 Ga0495670_0043766 3300046691 Bacteria 2235
126 Ga0495671_0003480 3300046692 Bacteria 9657
127 Ga0495649_0025533 3300046694 Bacteria 3291
128 Ga0495649_0071437 3300046694 Bacteria 1860
129 Ga0495589_0003612 3300046794 Bacteria 8356
130 Ga0495589_0011426 3300046794 Bacteria 4611
131 Ga0495589_0018902 3300046794 Bacteria 3534
132 Ga0495589_0120553 3300046794 Bacteria 1263
133 Ga0495600_0016335 3300046809 Bacteria 4708
134 Ga0495600_0084225 3300046809 Bacteria 2075
135 Ga0495581_0014460 3300047315 Bacteria 4577
136 Ga0495604_0002006 3300047317 Bacteria 16414
137 Ga0495604_0003805 3300047317 Bacteria 12015
138 Ga0495636_0002311 3300047318 Bacteria 7321
139 Ga0495636_0033632 3300047318 Bacteria 2107
140 Ga0495674_0081429 3300047319 Bacteria 2777
141 Ga0495676_0008129 3300047321 Bacteria 9624
142 Ga0495676_0034656 3300047321 Bacteria 4232
143 Ga0495676_0068233 3300047321 Bacteria 2748
144 Ga0495680_0007232 3300047322 Bacteria 10223
145 Ga0495687_000755 3300047443 Bacteria 34995
146 Ga0495687_002726 3300047443 Bacteria 13705
147 Ga0495687_030546 3300047443 Bacteria 2480
148 Ga0495687_036457 3300047443 Bacteria 2200
149 Ga0495675_0023405 3300047444 Bacteria 3935
150 Ga0495675_0026031 3300047444 Bacteria 3728
151 Ga0495677_0087419 3300047445 Bacteria 1172
152 Ga0495685_004306 3300047447 Bacteria 4590
153 Ga0495685_007169 3300047447 Bacteria 3673
154 Ga0495685_046045 3300047447 Bacteria 1484
155 Ga0495685_080975 3300047447 Bacteria 1081
156 Ga0495685_083792 3300047447 Bacteria 1060
157 Ga0495681_0000720 3300047470 Bacteria 25364
158 Ga0495686_0050343 3300047472 Bacteria 2618
159 Ga0495593_0006545 3300047673 Bacteria 6820
160 Ga0495602_0024819 3300048088 Bacteria 5812
161 Ga0495602_0055641 3300048088 Bacteria 3484
162 Ga0495614_0003443 3300048089 Bacteria 7081
163 Ga0495614_0076815 3300048089 Bacteria 1444
164 Ga0495614_0120104 3300048089 Bacteria 1158
165 Ga0496108_0104840 3300048911 Bacteria 2413
166 Ga0496109_0707841 3300048912 Bacteria 945
167 Ga0501032_0209785 3300049569 Bacteria 1270
168 Ga0501033_0010884 3300049570 Bacteria 6974
169 Ga0501033_0053341 3300049570 Bacteria 2994
170 Ga0501033_0330694 3300049570 Bacteria 1069
171 Ga0501034_0011203 3300049571 Bacteria 9310
172 Ga0501036_0036606 3300049572 Bacteria 4153
173 Ga0501036_0501789 3300049572 Bacteria 1009
174 Ga0501037_0365791 3300049573 Bacteria 993
175 Ga0501038_0009330 3300049574 Bacteria 8999
176 Ga0501038_0067057 3300049574 Bacteria 3054
177 Ga0501039_0007880 3300049575 Bacteria 8120
178 Ga0501043_0465508 3300049579 Bacteria 948
179 Ga0501047_0053419 3300049581 Bacteria 3907
180 Ga0501048_0277920 3300049582 Bacteria 1191
181 Ga0501068_0154170 3300049584 Bacteria 1445
182 Ga0501070_0001961 3300049586 Bacteria 18157
183 Ga0501074_0002509 3300049590 Bacteria 12793
184 Ga0501080_0126993 3300049742 Bacteria 2362
185 Ga0501035_0012968 3300049822 Bacteria 7692
186 Ga0501035_0079979 3300049822 Bacteria 2886
187 Ga0501044_0004151 3300049823 Bacteria 16268
188 Ga0501044_0021524 3300049823 Bacteria 6877
189 nmdc:mga03n38_6561_c1 3300050490 Bacteria 4052
190 nmdc:mga0yw44_83459_c1 3300050492 Bacteria 2007
191 nmdc:mga04h51_6427_c1 3300050495 Bacteria 3048
192 Ga0495612_0083021 3300053078 Bacteria 1348
193 Ga0500578_0233782 3300053086 Bacteria 1113
194 Ga0500566_0186646 3300053094 Bacteria 1059
195 Ga0500553_036918 3300053101 Bacteria 2415
196 Ga0500560_033920 3300053107 Bacteria 1562
197 Ga0466962_0000221 3300061719 Bacteria 23682
198 Ga0466962_0136047 3300061719 Bacteria 1189
199 2547407478 2547132111 Bacteria 8013147
200 2585307333 2582581313 Bacteria 10042643
201 2585317519 2582581314 Bacteria 11452267
202 2616902415 2616644941 Bacteria 8510691
203 2644016641 2643221601 Bacteria 7493239
204 2644174963 2643221631 Bacteria 8168043
205 2644264871 2643221647 Bacteria 10741251
206 2644442503 2643221678 Bacteria 9540101
207 2644460781 2643221682 Bacteria 6743283
208 2784591196 2784132148 Bacteria 8627943
209 2785372224 2784746768 Bacteria 10036182
210 2786673304 2786546132 Bacteria 10419719
211 2808844678 2808606359 Bacteria 9866990
212 2808914244 2808606375 Bacteria 9466072
213 2809234769 2808606448 Bacteria 8656184
214 2811843835 2808606982 Bacteria 7791042
215 2812355273 2811994879 Bacteria 9313447
216 2812477988 2811994917 Bacteria 7761064
217 2819740182 2818991472 Bacteria 10089953
218 2852638762 2852635781 Bacteria 8251373
219 2862283988 2862281513 Bacteria 9621493
220 2862516569 2862507626 Bacteria 9425308
221 2862576832 2862574272 Bacteria 10567477
222 2867434519 2867428634 Bacteria 9590268
223 2877678417 2877676314 Bacteria 9512378
224 2912716917 2912715099 Bacteria 9460473
225 2912729488 2912723979 Bacteria 8557534
226 2919474947 2919468124 Bacteria 9133025
227 2946070618 2946064051 Bacteria 8957905
228 2947226195 2947224130 Bacteria 9938529
229 2954010348 2954002825 Bacteria 9173742
230 2954383364 2954380949 Bacteria 10050426
231 2954679607 2954673503 Bacteria 9685905
232 2954684548 2954682443 Bacteria 9862841
233 2954694075 2954691527 Bacteria 10720516
234 2954709181 2954701450 Bacteria 10834262
235 2954713681 2954711539 Bacteria 10867210
236 2954723645 2954721474 Bacteria 10456478
237 2954738188 2954731030 Bacteria 10243860
238 2954742547 2954740390 Bacteria 10229294
239 2954757048 2954749733 Bacteria 10366972
240 2954761512 2954759201 Bacteria 9358192
241 2990067161 2990059506 Bacteria 9321252
242 3006499625 3006493962 Bacteria 8825450
243 8008576516 8008574985 Bacteria 7815457
244 8023624722 8023623736 Bacteria 8593882
245 8054164361 8054160619 Bacteria 7783213
246 8056449530 8056447290 Bacteria 7680491
247 8056829891 8056829672 Bacteria 9045328
248 Ga0099826_10020194
249 rootH2_10024281
250 rootH1_10082842
251 JGI25160J50197_1040692
252 Ga0068852_100831954
253 Ga0075365_10077368
254 Ga0075368_10030681
255 Ga0075363_100075256
256 Ga0075363_100098545
257 Ga0075363_100190743
258 Ga0075367_10024405
259 Ga0105250_10037939
260 Ga0105246_10010370
261 Ga0182008_10006336
262 Ga0182006_1031649
263 Ga0182007_10000145
264 Ga0183367_1001
265 Ga0207426_1011229
266 Ga0207426_1011915
267 Ga0207426_1057463
268 Ga0207696_1046788
269 Ga0307517_10003088
270 Ga0307515_10000279
271 Ga0307511_10003004
272 Ga0307512_10052733
273 Ga0307513_10033738
274 Ga0307509_10015029
275 Ga0307509_10065389
276 Ga0307508_10035468
277 Ga0307514_10079630
278 Ga0307516_10120418
279 Ga0307518_10125549
280 Ga0307518_10168244
281 Ga0307507_10012468
282 Ga0307507_10276207
283 Ga0307510_10016053
284 Ga0307510_10048955
285 Ga0307510_10166584
286 Ga0307510_10180695
287 Ga0395898_0018538
288 Ga0395898_0034496
289 Ga0439436_0004165
290 Ga0439439_0007397
291 Ga0439433_0000577
292 Ga0439448_0009625
293 Ga0439449_0000019
294 Ga0439449_0031134
295 Ga0450903_000136
296 Ga0466969_0019237
297 Ga0466972_0014361
298 Ga0466972_0032332
299 Ga0466965_0203897
300 Ga0466966_0028391
301 Ga0466961_0006135
302 Ga0466963_0000594
303 Ga0466963_0047754
304 Ga0466964_0027326
305 Ga0466964_0060472
306 Ga0466971_0002739
307 Ga0466970_0001581
308 Ga0466957_0000224
309 Ga0466959_0001264
310 Ga0466958_0012142
311 Ga0466967_0000194
312 Ga0466967_0114355
313 Ga0466967_0583122
314 Ga0495592_0028284
315 Ga0495592_0053264
316 Ga0495603_0000999
317 Ga0495603_0001149
318 Ga0495603_0011016
319 Ga0495629_0003422
320 Ga0495629_0006538
321 Ga0495629_0009525
322 Ga0495629_0276315
323 Ga0495638_0053922
324 Ga0495638_0079612
325 Ga0495651_0010045
326 Ga0495651_0237359
327 Ga0495580_0076583
328 Ga0495605_0046207
329 Ga0495639_0083380
330 Ga0495639_0195603
331 Ga0495662_0005737
332 Ga0495662_0017081
333 Ga0495664_0001104
334 Ga0495585_0067598
335 Ga0495594_0017570
336 Ga0495594_0022877
337 Ga0495583_0044576
338 Ga0495583_0067408
339 Ga0495606_0250553
340 Ga0495608_0189166
341 Ga0495618_0035281
342 Ga0495620_0014249
343 Ga0495620_0045299
344 Ga0495628_0155133
345 Ga0495628_0186259
346 Ga0495643_0003336
347 Ga0495648_0077011
348 Ga0495652_0009252
349 Ga0495640_0008249
350 Ga0495587_0131568
351 Ga0495597_0010992
352 Ga0495597_0018741
353 Ga0495645_0027979
354 Ga0495667_0176321
355 Ga0495668_0086202
356 Ga0495625_0020156
357 Ga0495635_0001134
358 Ga0495635_0076472
359 Ga0495661_0207007
360 Ga0495588_0001232
361 Ga0495588_0010261
362 Ga0495588_0122219
363 Ga0495657_0000512
364 Ga0495657_0006550
365 Ga0495657_0172215
366 Ga0495623_0116756
367 Ga0495646_0001690
368 Ga0495613_0009840
369 Ga0495613_0042602
370 Ga0495613_0043006
371 Ga0495613_0221777
372 Ga0495670_0043766
373 Ga0495671_0003480
374 Ga0495649_0025533
375 Ga0495649_0071437
376 Ga0495589_0003612
377 Ga0495589_0011426
378 Ga0495589_0018902
379 Ga0495589_0120553
380 Ga0495600_0016335
381 Ga0495600_0084225
382 Ga0495581_0014460
383 Ga0495604_0002006
384 Ga0495604_0003805
385 Ga0495636_0002311
386 Ga0495636_0033632
387 Ga0495674_0081429
388 Ga0495676_0008129
389 Ga0495676_0034656
390 Ga0495676_0068233
391 Ga0495680_0007232
392 Ga0495687_000755
393 Ga0495687_002726
394 Ga0495687_030546
395 Ga0495687_036457
396 Ga0495675_0023405
397 Ga0495675_0026031
398 Ga0495677_0087419
399 Ga0495685_004306
400 Ga0495685_007169
401 Ga0495685_046045
402 Ga0495685_080975
403 Ga0495685_083792
404 Ga0495681_0000720
405 Ga0495686_0050343
406 Ga0495593_0006545
407 Ga0495602_0024819
408 Ga0495602_0055641
409 Ga0495614_0003443
410 Ga0495614_0076815
411 Ga0495614_0120104
412 Ga0496108_0104840
413 Ga0496109_0707841
414 Ga0501032_0209785
415 Ga0501033_0010884
416 Ga0501033_0053341
417 Ga0501033_0330694
418 Ga0501034_0011203
419 Ga0501036_0036606
420 Ga0501036_0501789
421 Ga0501037_0365791
422 Ga0501038_0009330
423 Ga0501038_0067057
424 Ga0501039_0007880
425 Ga0501043_0465508
426 Ga0501047_0053419
427 Ga0501048_0277920
428 Ga0501068_0154170
429 Ga0501070_0001961
430 Ga0501074_0002509
431 Ga0501080_0126993
432 Ga0501035_0012968
433 Ga0501035_0079979
434 Ga0501044_0004151
435 Ga0501044_0021524
436 nmdc:mga03n38_6561_c1
437 nmdc:mga0yw44_83459_c1
438 nmdc:mga04h51_6427_c1
439 Ga0495612_0083021
440 Ga0500578_0233782
441 Ga0500566_0186646
442 Ga0500553_036918
443 Ga0500560_033920
444 Ga0466962_0000221
445 Ga0466962_0136047
446 2547407478
447 2585307333
448 2585317519
449 2616902415
450 2644016641
451 2644174963
452 2644264871
453 2644442503
454 2644460781
455 2784591196
456 2785372224
457 2786673304
458 2808844678
459 2808914244
460 2809234769
461 2811843835
462 2812355273
463 2812477988
464 2819740182
465 2852638762
466 2862283988
467 2862516569
468 2862576832
469 2867434519
470 2877678417
471 2912716917
472 2912729488
473 2919474947
474 2946070618
475 2947226195
476 2954010348
477 2954383364
478 2954679607
479 2954684548
480 2954694075
481 2954709181
482 2954713681
483 2954723645
484 2954738188
485 2954742547
486 2954757048
487 2954761512
488 2990067161
489 3006499625
490 8008576516
491 8023624722
492 8054164361
493 8056449530
494 8056829891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hup-assembly1.cif.gz_C cryoem structure of human full-length alpha1beta3gamma2l gaba(a)r in complex with diazepam (valium), gaba and megabody mb38. 0.7312 136 190
7smq-assembly1.cif.gz_C cryo-em structure of torpedo acetylcholine receptor in apo form with added cholesterol 0.6796 139 197
7qn9-assembly1.cif.gz_E cryo-em structure of human full-length extrasynaptic alpha4beta3delta gaba(a)r in complex with gaba, histamine and nanobody nb25 in a pre-open/closed state 0.5759 136 248
6x40-assembly1.cif.gz_E human gabaa receptor alpha1-beta2-gamma2 subtype in complex with gaba plus picrotoxin 0.5467 136 232
5tin-assembly1.cif.gz_B crystal structure of human glycine receptor alpha-3 mutant n38q bound to am-3607 0.525 136 232
ID Description Score Start End Superfamily
af_Q2MKA5_256_374_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6754 131 197 1.20.58.390
af_Q9U298_240_344_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6674 137 201 1.20.58.390
4ew8B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6503 136 200 1.10.287.130
af_A0A0S0WNY8_233_344_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6483 131 194 1.20.58.390
af_Q15825_246_356_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6483 131 201 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A6B1MUD7-F1-model_v4 deleted 0.9909 57 131
AF-A0A6B1MUD7-F1-model_v4 deleted 0.9654 57 131
AF-A0A6B3AXA9-F1-model_v4 TIGR04222 domain-containing membrane protein 0.9256 61 132
AF-A0A1T3P3P6-F1-model_v4 Uncharacterized protein 0.9212 37 133
AF-A0A6B3FZV2-F1-model_v4 TIGR04222 domain-containing membrane protein 0.9048 37 132

Map