F358928

General Info

Members Datasets Scaffolds Average Seq Length
247 175 494 83

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000002|Ga0079104_1000002277
Length 89
Sequence MSQAVAITITVRYFASIREALGTGSETLSTEAATVGALREELIARGGAAAEALAPGKAVRMALNQVLCDAGAAIRQGDEVAFFPPVTGG

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
116 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
117 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
169 2721755523 Delftia sp. HK171 Isolate Unclassified
170 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
171 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
172 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
173 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
174 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
175 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 0
Isolates 2.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 0.81
Rhizoplane 2.83
Rhizosphere 75.3
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1000002 3300006946 Bacteria 514469
2 Ga0055526_1001609 3300003771 Bacteria 15859
3 Ga0070658_10125291 3300005327 Bacteria 2138
4 Ga0070676_10500038 3300005328 Bacteria 863
5 Ga0070683_100054494 3300005329 Bacteria 3708
6 Ga0070683_101696252 3300005329 Bacteria 607
7 Ga0070670_100024452 3300005331 Bacteria 5194
8 Ga0070670_100662880 3300005331 Bacteria 937
9 Ga0070677_10004622 3300005333 Bacteria 4502
10 Ga0070677_10075798 3300005333 Bacteria 1427
11 Ga0070682_101153966 3300005337 Bacteria 651
12 Ga0068868_100678379 3300005338 Bacteria 920
13 Ga0070660_100057938 3300005339 Bacteria 3003
14 Ga0070661_100004525 3300005344 Bacteria 9569
15 Ga0070661_100573122 3300005344 Bacteria 910
16 Ga0070669_100049588 3300005353 Bacteria 3065
17 Ga0070669_100164186 3300005353 Bacteria 1728
18 Ga0070675_100000158 3300005354 Bacteria 41146
19 Ga0070675_101569342 3300005354 Bacteria 607
20 Ga0070671_100004317 3300005355 Bacteria 11249
21 Ga0070671_100065474 3300005355 Bacteria 3027
22 Ga0070674_100010555 3300005356 Bacteria 5589
23 Ga0070674_100011597 3300005356 Bacteria 5372
24 Ga0070674_100065145 3300005356 Bacteria 2556
25 Ga0070673_100046916 3300005364 Bacteria 3358
26 Ga0070673_100251091 3300005364 Bacteria 1542
27 Ga0070673_100257176 3300005364 Bacteria 1524
28 Ga0070688_100545351 3300005365 Bacteria 881
29 Ga0070659_100027525 3300005366 Bacteria 4381
30 Ga0070667_100174663 3300005367 Bacteria 1898
31 Ga0070667_101736676 3300005367 Bacteria 587
32 Ga0070678_100031759 3300005456 Bacteria 3647
33 Ga0070678_100336217 3300005456 Bacteria 1294
34 Ga0070678_100367783 3300005456 Bacteria 1241
35 Ga0070662_100517061 3300005457 Bacteria 997
36 Ga0070662_100563020 3300005457 Bacteria 956
37 Ga0070681_10827186 3300005458 Bacteria 843
38 Ga0068867_100002736 3300005459 Bacteria 12430
39 Ga0068867_100131108 3300005459 Bacteria 1948
40 Ga0070685_10207909 3300005466 Bacteria 1276
41 Ga0068853_101686942 3300005539 Bacteria 614
42 Ga0070672_100047628 3300005543 Bacteria 3327
43 Ga0070693_100351639 3300005547 Bacteria 1009
44 Ga0070693_100884945 3300005547 Bacteria 668
45 Ga0070664_100092753 3300005564 Bacteria 2615
46 Ga0070664_100963773 3300005564 Bacteria 801
47 Ga0070664_102361887 3300005564 Bacteria 504
48 Ga0068857_100153822 3300005577 Bacteria 2085
49 Ga0068857_100165616 3300005577 Bacteria 2007
50 Ga0068854_100082686 3300005578 Bacteria 2373
51 Ga0068852_100171030 3300005616 Bacteria 2036
52 Ga0068859_100664114 3300005617 Bacteria 1134
53 Ga0068864_100074351 3300005618 Bacteria 2965
54 Ga0068864_102532404 3300005618 Bacteria 519
55 Ga0068866_10233867 3300005718 Bacteria 1116
56 Ga0068851_10040795 3300005834 Bacteria 2334
57 Ga0068863_100237018 3300005841 Bacteria 1761
58 Ga0068860_100282312 3300005843 Bacteria 1623
59 Ga0068860_100976687 3300005843 Bacteria 864
60 Ga0075366_10286375 3300006195 Bacteria 1007
61 Ga0075366_10330801 3300006195 Bacteria 934
62 Ga0097621_100119175 3300006237 Bacteria 2237
63 Ga0097620_100664135 3300006931 Bacteria 1134
64 Ga0099794_10045665 3300007265 Bacteria 2096
65 Ga0105243_12391454 3300009148 Bacteria 567
66 Ga0105248_10697748 3300009177 Bacteria 1145
67 Ga0105248_11991001 3300009177 Bacteria 660
68 Ga0105238_10108990 3300009551 Bacteria 2751
69 Ga0157373_10048521 3300013100 Bacteria 3027
70 Ga0157370_10488530 3300013104 Bacteria 1131
71 Ga0157369_10017274 3300013105 Bacteria 8109
72 Ga0157374_10782859 3300013296 Bacteria 969
73 Ga0157374_11827678 3300013296 Bacteria 633
74 Ga0157378_11036419 3300013297 Bacteria 856
75 Ga0157372_10019684 3300013307 Bacteria 7274
76 Ga0157372_11464628 3300013307 Bacteria 787
77 Ga0163163_10496767 3300014325 Bacteria 1282
78 Ga0157380_10747942 3300014326 Bacteria 989
79 Ga0157379_10162431 3300014968 Bacteria 2016
80 Ga0157379_10203822 3300014968 Bacteria 1789
81 Ga0157379_10676500 3300014968 Bacteria 967
82 Ga0157376_10073560 3300014969 Bacteria 2911
83 Ga0157376_10335114 3300014969 Bacteria 1443
84 Ga0182006_1307805 3300015261 Bacteria 520
85 Ga0163161_10588622 3300017792 Bacteria 916
86 Ga0213876_10071176 3300021384 Bacteria 1837
87 Ga0209026_1003680 3300025250 Bacteria 4911
88 Ga0207697_10108593 3300025315 Bacteria 1187
89 Ga0207656_10032769 3300025321 Bacteria 2160
90 Ga0207682_10001652 3300025893 Bacteria 10224
91 Ga0207682_10099945 3300025893 Bacteria 1267
92 Ga0207642_10394757 3300025899 Bacteria 826
93 Ga0207688_10038678 3300025901 Bacteria 2648
94 Ga0207705_10137171 3300025909 Bacteria 1824
95 Ga0207695_11395844 3300025913 Bacteria 581
96 Ga0207657_10021874 3300025919 Bacteria 6005
97 Ga0207649_10137196 3300025920 Bacteria 1669
98 Ga0207649_11619505 3300025920 Bacteria 512
99 Ga0207681_10014932 3300025923 Bacteria 4837
100 Ga0207650_10001711 3300025925 Bacteria 15569
101 Ga0207659_10001143 3300025926 Bacteria 15778
102 Ga0207659_11321528 3300025926 Bacteria 619
103 Ga0207644_10003362 3300025931 Bacteria 10322
104 Ga0207690_10010954 3300025932 Bacteria 5406
105 Ga0207706_10601449 3300025933 Bacteria 944
106 Ga0207706_11236966 3300025933 Bacteria 619
107 Ga0207669_10002815 3300025937 Bacteria 7455
108 Ga0207669_10003638 3300025937 Bacteria 6692
109 Ga0207704_11016427 3300025938 Bacteria 702
110 Ga0207691_10056335 3300025940 Bacteria 3580
111 Ga0207711_10496940 3300025941 Bacteria 1137
112 Ga0207711_11649859 3300025941 Bacteria 584
113 Ga0207661_10072806 3300025944 Bacteria 2812
114 Ga0207679_10033375 3300025945 Bacteria 3621
115 Ga0207679_10915400 3300025945 Bacteria 802
116 Ga0207651_10008073 3300025960 Bacteria 5653
117 Ga0207640_11120103 3300025981 Bacteria 697
118 Ga0207658_10178315 3300025986 Bacteria 1756
119 Ga0207658_11160879 3300025986 Bacteria 706
120 Ga0207677_10232483 3300026023 Bacteria 1486
121 Ga0207639_10382471 3300026041 Bacteria 1264
122 Ga0207639_11422350 3300026041 Bacteria 651
123 Ga0207678_10433083 3300026067 Bacteria 1141
124 Ga0207648_10005724 3300026089 Bacteria 12451
125 Ga0207648_10156067 3300026089 Bacteria 2015
126 Ga0207676_10749569 3300026095 Bacteria 949
127 Ga0207674_10044440 3300026116 Bacteria 4575
128 Ga0207683_10014615 3300026121 Bacteria 6686
129 Ga0207683_10071124 3300026121 Bacteria 3075
130 Ga0207683_10338604 3300026121 Bacteria 1379
131 Ga0207698_10378159 3300026142 Bacteria 1346
132 Ga0207698_10391764 3300026142 Bacteria 1325
133 Ga0209281_1000007 3300027111 Bacteria 938265
134 Ga0268264_10066308 3300028381 Bacteria 3044
135 Ga0268264_10754128 3300028381 Bacteria 970
136 Ga0307517_10003477 3300028786 Bacteria 24480
137 Ga0307517_10261537 3300028786 Bacteria 1004
138 Ga0307515_10046408 3300028794 Bacteria 6641
139 Ga0307515_10176116 3300028794 Bacteria 2109
140 Ga0307515_10205517 3300028794 Bacteria 1831
141 Ga0307515_10416887 3300028794 Bacteria 964
142 Ga0307513_10196630 3300031456 Bacteria 1862
143 Ga0307513_11020601 3300031456 Bacteria 537
144 Ga0307509_10000120 3300031507 Bacteria 114238
145 Ga0307509_10032544 3300031507 Bacteria 5745
146 Ga0307509_10034762 3300031507 Bacteria 5536
147 Ga0307509_10120223 3300031507 Bacteria 2606
148 Ga0307509_10959809 3300031507 Bacteria 521
149 Ga0307408_100008989 3300031548 Bacteria 6599
150 Ga0307508_10000094 3300031616 Bacteria 104107
151 Ga0307508_10058765 3300031616 Bacteria 3402
152 Ga0307508_10440890 3300031616 Bacteria 894
153 Ga0307508_10470329 3300031616 Bacteria 850
154 Ga0307514_10196055 3300031649 Bacteria 1278
155 Ga0307514_10265988 3300031649 Bacteria 998
156 Ga0307514_10543947 3300031649 Bacteria 538
157 Ga0265314_10147622 3300031711 Bacteria 1446
158 Ga0307516_10022750 3300031730 Bacteria 6434
159 Ga0307516_10951612 3300031730 Bacteria 528
160 Ga0307413_11914268 3300031824 Bacteria 533
161 Ga0307410_10514210 3300031852 Bacteria 987
162 Ga0307406_11083610 3300031901 Bacteria 691
163 Ga0307416_100605604 3300032002 Bacteria 1176
164 Ga0307414_11526777 3300032004 Bacteria 622
165 Ga0307411_10081240 3300032005 Bacteria 2232
166 Ga0307411_11207397 3300032005 Bacteria 686
167 Ga0307415_100654635 3300032126 Bacteria 942
168 Ga0307510_10054117 3300033180 Bacteria 4210
169 Ga0307510_10077257 3300033180 Bacteria 3267
170 Ga0307510_10108768 3300033180 Bacteria 2524
171 Ga0307510_10457232 3300033180 Bacteria 717
172 Ga0307510_10484370 3300033180 Bacteria 679
173 Ga0373936_0195729 3300035113 Bacteria 891
174 Ga0373942_0077668 3300035207 Bacteria 980
175 Ga0373931_0149400 3300035691 Bacteria 1360
176 Ga0373925_0070306 3300037068 Bacteria 2646
177 Ga0436365_0324672 3300039437 Bacteria 2677
178 Ga0451789_0121860 3300041443 Bacteria 708
179 Ga0451789_0775297 3300041443 Bacteria 545
180 Ga0451791_0559572 3300041451 Bacteria 1208
181 Ga0451802_0818610 3300041460 Bacteria 568
182 Ga0451807_2166342 3300041486 Bacteria 513
183 Ga0451837_1855268 3300041494 Bacteria 644
184 Ga0451839_0586821 3300041496 Bacteria 640
185 Ga0451843_1713715 3300041509 Bacteria 555
186 Ga0439446_0313530 3300042156 Bacteria 553
187 Ga0466969_0115160 3300044656 Bacteria 1255
188 Ga0466965_0046614 3300044683 Bacteria 2146
189 Ga0466965_0352397 3300044683 Bacteria 806
190 Ga0466970_0622402 3300044765 Bacteria 627
191 Ga0466957_0155691 3300044842 Bacteria 1481
192 Ga0495592_0027877 3300046454 Bacteria 4278
193 Ga0495590_0306923 3300046457 Bacteria 598
194 Ga0495638_0235964 3300046460 Bacteria 1015
195 Ga0495582_0115554 3300046473 Bacteria 1509
196 Ga0495584_0000001 3300046491 Bacteria 649329
197 Ga0495584_0000561 3300046491 Bacteria 25005
198 Ga0495584_0111009 3300046491 Bacteria 1387
199 Ga0495585_0024125 3300046492 Bacteria 3489
200 Ga0495596_0013403 3300046500 Bacteria 3479
201 Ga0495583_0094704 3300046506 Bacteria 1282
202 Ga0495610_0105105 3300046512 Bacteria 1259
203 Ga0495620_0192539 3300046515 Bacteria 786
204 Ga0495620_0246150 3300046515 Bacteria 682
205 Ga0495628_0321832 3300046516 Bacteria 1141
206 Ga0495630_0178237 3300046517 Bacteria 1620
207 Ga0495642_0075043 3300046528 Bacteria 1418
208 Ga0495622_0018705 3300046557 Bacteria 3227
209 Ga0495611_0536960 3300046648 Bacteria 530
210 Ga0495625_0421147 3300046660 Bacteria 830
211 Ga0495646_0183681 3300046680 Bacteria 1146
212 Ga0495624_0033651 3300046690 Bacteria 3319
213 Ga0495670_0018235 3300046691 Bacteria 3455
214 Ga0495649_0081896 3300046694 Bacteria 1725
215 Ga0495649_0253298 3300046694 Bacteria 904
216 Ga0495604_0685553 3300047317 Bacteria 651
217 Ga0495676_0087436 3300047321 Bacteria 2342
218 Ga0495687_025280 3300047443 Bacteria 2810
219 Ga0495593_0058807 3300047673 Bacteria 2015
220 Ga0495602_0344295 3300048088 Bacteria 1077
221 Ga0495614_0127209 3300048089 Bacteria 1126
222 Ga0495626_0060100 3300048091 Bacteria 1733
223 Ga0496106_0134694 3300048909 Bacteria 1939
224 Ga0496106_0607235 3300048909 Bacteria 876
225 Ga0496122_0031232 3300048925 Bacteria 4438
226 Ga0496123_0057543 3300048926 Bacteria 2529
227 Ga0496124_0163091 3300048927 Bacteria 1735
228 Ga0496125_0014210 3300048928 Bacteria 7763
229 Ga0496126_0015938 3300048929 Bacteria 7540
230 nmdc:mga0k408_274305_c1 3300050493 Bacteria 1007
231 nmdc:mga0k408_685485_c1 3300050493 Bacteria 601
232 nmdc:mga07m45_811764_c1 3300050496 Unclassified 536
233 nmdc:mga0qj67_1591248_c1 3300050509 Bacteria 501
234 Ga0495619_0310616 3300053085 Bacteria 1092
235 Ga0500651_0741020 3300053093 Unclassified 522
236 Ga0500559_0000011 3300053136 Bacteria 164751
237 Ga0500559_0526218 3300053136 Bacteria 541
238 Ga0500619_012900 3300053154 Bacteria 2199
239 Ga0500636_0376739 3300053177 Bacteria 667
240 Ga0500587_002900 3300053739 Bacteria 2425
241 2722882276 2721755523 Bacteria 6430384
242 2839139980 2839138175 Bacteria 6549354
243 2885195584 2885192300 Bacteria 5882526
244 2904480192 2904479285 Bacteria 5073931
245 2904543936 2904541872 Bacteria 8915136
246 2929162505 2929160207 Bacteria 9075316
247 2939631946 2939631187 Bacteria 6118131
248 Ga0079104_1000002
249 Ga0055526_1001609
250 Ga0070658_10125291
251 Ga0070676_10500038
252 Ga0070683_100054494
253 Ga0070683_101696252
254 Ga0070670_100024452
255 Ga0070670_100662880
256 Ga0070677_10004622
257 Ga0070677_10075798
258 Ga0070682_101153966
259 Ga0068868_100678379
260 Ga0070660_100057938
261 Ga0070661_100004525
262 Ga0070661_100573122
263 Ga0070669_100049588
264 Ga0070669_100164186
265 Ga0070675_100000158
266 Ga0070675_101569342
267 Ga0070671_100004317
268 Ga0070671_100065474
269 Ga0070674_100010555
270 Ga0070674_100011597
271 Ga0070674_100065145
272 Ga0070673_100046916
273 Ga0070673_100251091
274 Ga0070673_100257176
275 Ga0070688_100545351
276 Ga0070659_100027525
277 Ga0070667_100174663
278 Ga0070667_101736676
279 Ga0070678_100031759
280 Ga0070678_100336217
281 Ga0070678_100367783
282 Ga0070662_100517061
283 Ga0070662_100563020
284 Ga0070681_10827186
285 Ga0068867_100002736
286 Ga0068867_100131108
287 Ga0070685_10207909
288 Ga0068853_101686942
289 Ga0070672_100047628
290 Ga0070693_100351639
291 Ga0070693_100884945
292 Ga0070664_100092753
293 Ga0070664_100963773
294 Ga0070664_102361887
295 Ga0068857_100153822
296 Ga0068857_100165616
297 Ga0068854_100082686
298 Ga0068852_100171030
299 Ga0068859_100664114
300 Ga0068864_100074351
301 Ga0068864_102532404
302 Ga0068866_10233867
303 Ga0068851_10040795
304 Ga0068863_100237018
305 Ga0068860_100282312
306 Ga0068860_100976687
307 Ga0075366_10286375
308 Ga0075366_10330801
309 Ga0097621_100119175
310 Ga0097620_100664135
311 Ga0099794_10045665
312 Ga0105243_12391454
313 Ga0105248_10697748
314 Ga0105248_11991001
315 Ga0105238_10108990
316 Ga0157373_10048521
317 Ga0157370_10488530
318 Ga0157369_10017274
319 Ga0157374_10782859
320 Ga0157374_11827678
321 Ga0157378_11036419
322 Ga0157372_10019684
323 Ga0157372_11464628
324 Ga0163163_10496767
325 Ga0157380_10747942
326 Ga0157379_10162431
327 Ga0157379_10203822
328 Ga0157379_10676500
329 Ga0157376_10073560
330 Ga0157376_10335114
331 Ga0182006_1307805
332 Ga0163161_10588622
333 Ga0213876_10071176
334 Ga0209026_1003680
335 Ga0207697_10108593
336 Ga0207656_10032769
337 Ga0207682_10001652
338 Ga0207682_10099945
339 Ga0207642_10394757
340 Ga0207688_10038678
341 Ga0207705_10137171
342 Ga0207695_11395844
343 Ga0207657_10021874
344 Ga0207649_10137196
345 Ga0207649_11619505
346 Ga0207681_10014932
347 Ga0207650_10001711
348 Ga0207659_10001143
349 Ga0207659_11321528
350 Ga0207644_10003362
351 Ga0207690_10010954
352 Ga0207706_10601449
353 Ga0207706_11236966
354 Ga0207669_10002815
355 Ga0207669_10003638
356 Ga0207704_11016427
357 Ga0207691_10056335
358 Ga0207711_10496940
359 Ga0207711_11649859
360 Ga0207661_10072806
361 Ga0207679_10033375
362 Ga0207679_10915400
363 Ga0207651_10008073
364 Ga0207640_11120103
365 Ga0207658_10178315
366 Ga0207658_11160879
367 Ga0207677_10232483
368 Ga0207639_10382471
369 Ga0207639_11422350
370 Ga0207678_10433083
371 Ga0207648_10005724
372 Ga0207648_10156067
373 Ga0207676_10749569
374 Ga0207674_10044440
375 Ga0207683_10014615
376 Ga0207683_10071124
377 Ga0207683_10338604
378 Ga0207698_10378159
379 Ga0207698_10391764
380 Ga0209281_1000007
381 Ga0268264_10066308
382 Ga0268264_10754128
383 Ga0307517_10003477
384 Ga0307517_10261537
385 Ga0307515_10046408
386 Ga0307515_10176116
387 Ga0307515_10205517
388 Ga0307515_10416887
389 Ga0307513_10196630
390 Ga0307513_11020601
391 Ga0307509_10000120
392 Ga0307509_10032544
393 Ga0307509_10034762
394 Ga0307509_10120223
395 Ga0307509_10959809
396 Ga0307408_100008989
397 Ga0307508_10000094
398 Ga0307508_10058765
399 Ga0307508_10440890
400 Ga0307508_10470329
401 Ga0307514_10196055
402 Ga0307514_10265988
403 Ga0307514_10543947
404 Ga0265314_10147622
405 Ga0307516_10022750
406 Ga0307516_10951612
407 Ga0307413_11914268
408 Ga0307410_10514210
409 Ga0307406_11083610
410 Ga0307416_100605604
411 Ga0307414_11526777
412 Ga0307411_10081240
413 Ga0307411_11207397
414 Ga0307415_100654635
415 Ga0307510_10054117
416 Ga0307510_10077257
417 Ga0307510_10108768
418 Ga0307510_10457232
419 Ga0307510_10484370
420 Ga0373936_0195729
421 Ga0373942_0077668
422 Ga0373931_0149400
423 Ga0373925_0070306
424 Ga0436365_0324672
425 Ga0451789_0121860
426 Ga0451789_0775297
427 Ga0451791_0559572
428 Ga0451802_0818610
429 Ga0451807_2166342
430 Ga0451837_1855268
431 Ga0451839_0586821
432 Ga0451843_1713715
433 Ga0439446_0313530
434 Ga0466969_0115160
435 Ga0466965_0046614
436 Ga0466965_0352397
437 Ga0466970_0622402
438 Ga0466957_0155691
439 Ga0495592_0027877
440 Ga0495590_0306923
441 Ga0495638_0235964
442 Ga0495582_0115554
443 Ga0495584_0000001
444 Ga0495584_0000561
445 Ga0495584_0111009
446 Ga0495585_0024125
447 Ga0495596_0013403
448 Ga0495583_0094704
449 Ga0495610_0105105
450 Ga0495620_0192539
451 Ga0495620_0246150
452 Ga0495628_0321832
453 Ga0495630_0178237
454 Ga0495642_0075043
455 Ga0495622_0018705
456 Ga0495611_0536960
457 Ga0495625_0421147
458 Ga0495646_0183681
459 Ga0495624_0033651
460 Ga0495670_0018235
461 Ga0495649_0081896
462 Ga0495649_0253298
463 Ga0495604_0685553
464 Ga0495676_0087436
465 Ga0495687_025280
466 Ga0495593_0058807
467 Ga0495602_0344295
468 Ga0495614_0127209
469 Ga0495626_0060100
470 Ga0496106_0134694
471 Ga0496106_0607235
472 Ga0496122_0031232
473 Ga0496123_0057543
474 Ga0496124_0163091
475 Ga0496125_0014210
476 Ga0496126_0015938
477 nmdc:mga0k408_274305_c1
478 nmdc:mga0k408_685485_c1
479 nmdc:mga07m45_811764_c1
480 nmdc:mga0qj67_1591248_c1
481 Ga0495619_0310616
482 Ga0500651_0741020
483 Ga0500559_0000011
484 Ga0500559_0526218
485 Ga0500619_012900
486 Ga0500636_0376739
487 Ga0500587_002900
488 2722882276
489 2839139980
490 2885195584
491 2904480192
492 2904543936
493 2929162505
494 2939631946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

11

89

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8607 4 85
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8411 4 85
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8311 1 85
2qie-assembly1.cif.gz_D staphylococcus aureus molybdopterin synthase in complex with precursor z 0.8293 4 85
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8152 2 85
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9117 3 85 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8905 3 85 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8615 4 82 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8549 1 85 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8454 1 85 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7C4U1E9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9931 1 85 GO:0000166
GO:0006777
GO:1990133
AF-A0A259DF16-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9926 1 78
AF-A0A4R5W6M9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9904 1 85 GO:0000166
GO:0006777
GO:1990133
AF-A0A352S8N1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9892 1 77
AF-A0A3A0F957-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9887 1 85 GO:0000166
GO:0006777
GO:1990133

Map