F358879

General Info

Members Datasets Scaffolds Average Seq Length
247 145 494 275

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10034001|Ga0081455_100340014
Length 294
Sequence VTDVLGLFEGFEERLLERRGIRLRYFAGGTGPPLLLVHGFGGSAWNFSELAPLLAVGRRLLIPDLPGHGGSTALAAAPNLAAYADPLAALCREEGAVPVDAVGHSLGGSVAVRLAVRHPGLVGRLVLAAAAGISSGTRVAEAFLTTFGLVQPGRLAARRPEAVAHSSFLRRLVFPRFSVADDRALSDRAILGLLSGPALHTDVLAAARPLVQEDPRPDLDRLTAPVLCLWGACDEQVPMQDAFDYARRLRAPLRTIAGCGHLLIAERPDACAHAIEDFLGRPLPRRAGGRTVAP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
49 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 1.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.55
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10034001 3300005937 Bacteria 4573
2 rootH1_10254754 3300003323 Bacteria 1175
3 Ga0070683_100006571 3300005329 Bacteria 9766
4 Ga0070683_100007706 3300005329 Bacteria 9114
5 Ga0070680_100012321 3300005336 Bacteria 6640
6 Ga0070680_100023011 3300005336 Bacteria 4966
7 Ga0068868_100218204 3300005338 Bacteria 1596
8 Ga0070660_100022594 3300005339 Bacteria 4653
9 Ga0070661_100063325 3300005344 Bacteria 2716
10 Ga0070674_100103383 3300005356 Bacteria 2080
11 Ga0070713_100461974 3300005436 Bacteria 1194
12 Ga0070710_10080759 3300005437 Bacteria 1898
13 Ga0070711_100082711 3300005439 Bacteria 2292
14 Ga0070694_100011618 3300005444 Bacteria 5452
15 Ga0070681_10055235 3300005458 Bacteria 3955
16 Ga0070681_10086844 3300005458 Bacteria 3081
17 Ga0070707_100258963 3300005468 Bacteria 1692
18 Ga0070679_100016558 3300005530 Bacteria 7117
19 Ga0070679_100114987 3300005530 Bacteria 2676
20 Ga0070679_100246674 3300005530 Bacteria 1743
21 Ga0070684_100051508 3300005535 Bacteria 3577
22 Ga0070684_100127361 3300005535 Bacteria 2295
23 Ga0070686_100140681 3300005544 Bacteria 1680
24 Ga0068855_100076265 3300005563 Bacteria 3891
25 Ga0068855_100084842 3300005563 Bacteria 3666
26 Ga0068855_100175828 3300005563 Bacteria 2422
27 Ga0068855_100589097 3300005563 Bacteria 1200
28 Ga0068855_100600879 3300005563 Bacteria 1186
29 Ga0070702_100518819 3300005615 Unclassified 878
30 Ga0070717_10154550 3300006028 Bacteria 1987
31 Ga0070716_100137807 3300006173 Bacteria 1552
32 Ga0070712_100024346 3300006175 Bacteria 4011
33 Ga0070712_100207934 3300006175 Bacteria 1542
34 Ga0070712_100234231 3300006175 Bacteria 1460
35 Ga0075433_10052106 3300006852 Bacteria 3566
36 Ga0075434_100051812 3300006871 Bacteria 4078
37 Ga0075435_100050359 3300007076 Bacteria 3352
38 Ga0105240_10026689 3300009093 Bacteria 7577
39 Ga0105240_10277121 3300009093 Bacteria 1928
40 Ga0105245_10125326 3300009098 Bacteria 2404
41 Ga0105242_10033419 3300009176 Bacteria 4118
42 Ga0157370_10010927 3300013104 Bacteria 9533
43 Ga0157369_10003856 3300013105 Bacteria 17824
44 Ga0157369_10004745 3300013105 Bacteria 15975
45 Ga0157375_10155370 3300013308 Unclassified 2426
46 Ga0206353_10961451 3300020082 Bacteria 4685
47 Ga0206353_11534071 3300020082 Bacteria 9507
48 Ga0206353_11814207 3300020082 Bacteria 1819
49 Ga0207695_10454934 3300025913 Bacteria 1163
50 Ga0207693_10018381 3300025915 Bacteria 5568
51 Ga0207693_10049629 3300025915 Bacteria 3296
52 Ga0207663_10347919 3300025916 Bacteria 1121
53 Ga0207660_10027766 3300025917 Bacteria 3866
54 Ga0207657_10000486 3300025919 Bacteria 41915
55 Ga0207657_10004868 3300025919 Bacteria 14131
56 Ga0207652_10096097 3300025921 Bacteria 2610
57 Ga0207646_10337559 3300025922 Bacteria 1361
58 Ga0207661_10066647 3300025944 Bacteria 2925
59 Ga0207667_10558996 3300025949 Bacteria 1157
60 Ga0207651_10430802 3300025960 Unclassified 1128
61 Ga0207683_10323271 3300026121 Bacteria 1413
62 Ga0265334_10041125 3300028573 Bacteria 1808
63 Ga0265318_10030861 3300028577 Bacteria 2083
64 Ga0265322_10034848 3300028654 Bacteria 1434
65 Ga0265338_10020534 3300028800 Bacteria 6945
66 Ga0265330_10047502 3300031235 Bacteria 1889
67 Ga0265328_10025241 3300031239 Bacteria 2240
68 Ga0265325_10007808 3300031241 Bacteria 6371
69 Ga0265340_10027449 3300031247 Bacteria 2870
70 Ga0265327_10006558 3300031251 Bacteria 9263
71 Ga0265316_10004699 3300031344 Bacteria 13532
72 Ga0265313_10062009 3300031595 Bacteria 1747
73 Ga0265314_10032109 3300031711 Bacteria 3866
74 Ga0265342_10006169 3300031712 Bacteria 8966
75 Ga0373926_0031640 3300035083 Bacteria 1866
76 Ga0373936_0018811 3300035113 Bacteria 2671
77 Ga0373945_0003740 3300035116 Bacteria 4800
78 Ga0373943_0003352 3300035170 Bacteria 7279
79 Ga0373946_0004039 3300035171 Bacteria 5225
80 Ga0373946_0010345 3300035171 Bacteria 3451
81 Ga0373955_0084426 3300035172 Bacteria 1800
82 Ga0373935_0002655 3300035692 Bacteria 10279
83 Ga0373927_0120684 3300035695 Bacteria 1711
84 Ga0373933_0026405 3300035724 Bacteria 3335
85 Ga0373947_0001098 3300035725 Bacteria 16601
86 Ga0373925_0005713 3300037068 Bacteria 9247
87 Ga0373925_0006901 3300037068 Bacteria 8310
88 Ga0395900_0023598 3300037418 Bacteria 6293
89 Ga0395900_0031766 3300037418 Bacteria 5427
90 Ga0395898_0009427 3300037466 Bacteria 10253
91 Ga0395898_0029485 3300037466 Bacteria 5496
92 Ga0395905_0344160 3300037471 Bacteria 1382
93 Ga0395901_0001138 3300038443 Bacteria 28189
94 Ga0395901_0029548 3300038443 Bacteria 5644
95 Ga0395901_0068539 3300038443 Bacteria 3696
96 Ga0395901_0226950 3300038443 Unclassified 1951
97 Ga0395901_0259343 3300038443 Bacteria 1809
98 Ga0395901_0645967 3300038443 Bacteria 1062
99 Ga0436365_1318917 3300039437 Bacteria 1897
100 Ga0436363_0383499 3300039450 Bacteria 2150
101 Ga0466966_0024765 3300044684 Bacteria 3925
102 Ga0466966_0095225 3300044684 Bacteria 1845
103 Ga0466966_0100208 3300044684 Bacteria 1792
104 Ga0466966_0105752 3300044684 Bacteria 1737
105 Ga0466966_0208079 3300044684 Bacteria 1183
106 Ga0466961_0004798 3300044693 Bacteria 8510
107 Ga0466961_0006183 3300044693 Bacteria 7602
108 Ga0466961_0038659 3300044693 Bacteria 3061
109 Ga0466963_0007497 3300044694 Bacteria 6510
110 Ga0466963_0106128 3300044694 Bacteria 1926
111 Ga0466963_0110970 3300044694 Bacteria 1883
112 Ga0466963_0112545 3300044694 Bacteria 1869
113 Ga0466963_0157071 3300044694 Bacteria 1582
114 Ga0466963_0316886 3300044694 Unclassified 1097
115 Ga0466963_0437932 3300044694 Bacteria 922
116 Ga0466964_0015899 3300044706 Bacteria 2867
117 Ga0466971_0065531 3300044719 Bacteria 1645
118 Ga0466968_0060600 3300044735 Bacteria 1632
119 Ga0466968_0066833 3300044735 Bacteria 1558
120 Ga0466968_0097504 3300044735 Bacteria 1309
121 Ga0466968_0098655 3300044735 Bacteria 1302
122 Ga0466970_0105853 3300044765 Bacteria 1534
123 Ga0466957_0037168 3300044842 Bacteria 2931
124 Ga0466957_0045605 3300044842 Bacteria 2659
125 Ga0466957_0048820 3300044842 Bacteria 2572
126 Ga0466959_0021530 3300045049 Bacteria 4756
127 Ga0466959_0030873 3300045049 Bacteria 3967
128 Ga0466959_0077436 3300045049 Bacteria 2400
129 Ga0466959_0119901 3300045049 Unclassified 1871
130 Ga0466959_0122552 3300045049 Bacteria 1847
131 Ga0466958_0001411 3300045836 Bacteria 11368
132 Ga0466967_0003288 3300045976 Bacteria 10489
133 Ga0466967_0012607 3300045976 Bacteria 6478
134 Ga0466967_0013793 3300045976 Bacteria 6263
135 Ga0466967_0030889 3300045976 Bacteria 4501
136 Ga0466967_0039646 3300045976 Bacteria 4051
137 Ga0466967_0153795 3300045976 Bacteria 2153
138 Ga0466967_0318287 3300045976 Bacteria 1500
139 Ga0466967_0498987 3300045976 Bacteria 1194
140 Ga0495592_0175854 3300046454 Bacteria 1462
141 Ga0495592_0188776 3300046454 Bacteria 1398
142 Ga0495629_0029064 3300046459 Bacteria 3922
143 Ga0495641_0000513 3300046461 Bacteria 32468
144 Ga0495651_0198835 3300046462 Bacteria 1404
145 Ga0495653_0024449 3300046463 Bacteria 4868
146 Ga0495653_0024628 3300046463 Bacteria 4846
147 Ga0495582_0000553 3300046473 Bacteria 20635
148 Ga0495639_0000429 3300046475 Bacteria 20027
149 Ga0495639_0055146 3300046475 Bacteria 1813
150 Ga0495662_0002761 3300046476 Bacteria 8880
151 Ga0495662_0190019 3300046476 Bacteria 1013
152 Ga0495664_0035738 3300046477 Bacteria 2927
153 Ga0495664_0093828 3300046477 Bacteria 1806
154 Ga0495594_0261653 3300046499 Bacteria 985
155 Ga0495608_0006732 3300046511 Bacteria 8149
156 Ga0495608_0021201 3300046511 Bacteria 4459
157 Ga0495608_0035630 3300046511 Bacteria 3355
158 Ga0495618_0062068 3300046514 Unclassified 2371
159 Ga0495618_0078844 3300046514 Bacteria 2100
160 Ga0495628_0029985 3300046516 Bacteria 4406
161 Ga0495630_0002498 3300046517 Bacteria 12751
162 Ga0495630_0003150 3300046517 Bacteria 11443
163 Ga0495630_0006642 3300046517 Bacteria 8242
164 Ga0495666_0101869 3300046526 Bacteria 1352
165 Ga0495652_0332805 3300046529 Bacteria 1093
166 Ga0495665_0003772 3300046531 Bacteria 8202
167 Ga0495640_0005060 3300046533 Bacteria 10466
168 Ga0495640_0251542 3300046533 Bacteria 1106
169 Ga0495587_0043112 3300046536 Bacteria 2688
170 Ga0495645_0065853 3300046543 Bacteria 2621
171 Ga0495645_0155248 3300046543 Bacteria 1586
172 Ga0495667_0005148 3300046559 Bacteria 8836
173 Ga0495667_0019740 3300046559 Bacteria 4548
174 Ga0495667_0041078 3300046559 Bacteria 3068
175 Ga0495635_0190074 3300046663 Bacteria 1394
176 Ga0495646_0016478 3300046680 Bacteria 4692
177 Ga0495647_0004297 3300046681 Bacteria 4615
178 Ga0495658_0000300 3300046683 Bacteria 28107
179 Ga0495658_0060147 3300046683 Bacteria 2178
180 Ga0495613_0001388 3300046689 Bacteria 18420
181 Ga0495600_0058880 3300046809 Bacteria 2509
182 Ga0495600_0235986 3300046809 Bacteria 1166
183 Ga0495581_0001770 3300047315 Bacteria 12063
184 Ga0495581_0168857 3300047315 Bacteria 1279
185 Ga0495604_0017490 3300047317 Bacteria 5740
186 Ga0495604_0043313 3300047317 Bacteria 3524
187 Ga0495674_0025719 3300047319 Bacteria 5391
188 Ga0495674_0044734 3300047319 Bacteria 3934
189 Ga0495674_0479000 3300047319 Bacteria 997
190 Ga0495676_0001459 3300047321 Bacteria 20404
191 Ga0495676_0091529 3300047321 Bacteria 2273
192 Ga0495680_0002487 3300047322 Bacteria 18843
193 Ga0495680_0009392 3300047322 Bacteria 8796
194 Ga0495680_0030411 3300047322 Bacteria 4409
195 Ga0495680_0314702 3300047322 Bacteria 1096
196 Ga0495675_0108041 3300047444 Bacteria 1738
197 Ga0495684_0168095 3300047471 Bacteria 1632
198 Ga0495684_0189272 3300047471 Bacteria 1522
199 Ga0495593_0014474 3300047673 Bacteria 4484
200 Ga0495593_0043813 3300047673 Bacteria 2396
201 Ga0495602_0039780 3300048088 Bacteria 4324
202 Ga0495614_0017315 3300048089 Bacteria 3131
203 Ga0496100_0004961 3300048903 Bacteria 7114
204 Ga0496100_0189196 3300048903 Bacteria 1493
205 Ga0496101_0016979 3300048904 Bacteria 4928
206 Ga0496101_0042517 3300048904 Bacteria 3243
207 Ga0496101_0062013 3300048904 Unclassified 2717
208 Ga0496101_0134785 3300048904 Bacteria 1878
209 Ga0496101_0398511 3300048904 Bacteria 1083
210 Ga0496102_0067845 3300048905 Bacteria 3272
211 Ga0496103_0064231 3300048906 Bacteria 2288
212 Ga0496103_0067356 3300048906 Bacteria 2236
213 Ga0496103_0094212 3300048906 Bacteria 1892
214 Ga0496104_0006637 3300048907 Bacteria 10184
215 Ga0496104_0570374 3300048907 Bacteria 1042
216 Ga0496105_0001009 3300048908 Bacteria 19456
217 Ga0496106_0002641 3300048909 Bacteria 13330
218 Ga0496107_0008627 3300048910 Bacteria 7060
219 Ga0496107_0009294 3300048910 Bacteria 6814
220 Ga0496107_0136005 3300048910 Bacteria 1815
221 Ga0496109_0017956 3300048912 Bacteria 6211
222 Ga0496109_0292617 3300048912 Bacteria 1535
223 Ga0496110_0002201 3300048913 Bacteria 14564
224 Ga0496111_0428327 3300048914 Bacteria 977
225 Ga0496112_0268347 3300048915 Bacteria 1655
226 Ga0496112_0292937 3300048915 Bacteria 1573
227 Ga0496112_0413217 3300048915 Bacteria 1288
228 Ga0496112_0504277 3300048915 Bacteria 1145
229 Ga0496113_0027030 3300048916 Bacteria 4109
230 Ga0496114_0007006 3300048917 Bacteria 8888
231 Ga0496114_0039058 3300048917 Bacteria 3928
232 Ga0496115_0001699 3300048918 Bacteria 15776
233 Ga0496115_0316475 3300048918 Bacteria 1277
234 Ga0501067_0195402 3300049583 Bacteria 1127
235 Ga0501035_0182652 3300049822 Bacteria 1807
236 nmdc:mga0rr50_224302_c1 3300050513 Bacteria 1553
237 nmdc:mga0a205_55040_c1 3300050515 Bacteria 3842
238 Ga0495601_0065777 3300053077 Bacteria 2308
239 Ga0495601_0204063 3300053077 Bacteria 1291
240 Ga0495612_0049226 3300053078 Bacteria 1729
241 Ga0495595_0032933 3300053084 Bacteria 2336
242 Ga0495619_0023827 3300053085 Bacteria 3923
243 Ga0495619_0057692 3300053085 Bacteria 2576
244 Ga0495619_0303629 3300053085 Bacteria 1105
245 Ga0495619_0366846 3300053085 Unclassified 995
246 Ga0466962_0000349 3300061719 Bacteria 19818
247 Ga0466962_0009541 3300061719 Bacteria 4654
248 Ga0081455_10034001
249 rootH1_10254754
250 Ga0070683_100006571
251 Ga0070683_100007706
252 Ga0070680_100012321
253 Ga0070680_100023011
254 Ga0068868_100218204
255 Ga0070660_100022594
256 Ga0070661_100063325
257 Ga0070674_100103383
258 Ga0070713_100461974
259 Ga0070710_10080759
260 Ga0070711_100082711
261 Ga0070694_100011618
262 Ga0070681_10055235
263 Ga0070681_10086844
264 Ga0070707_100258963
265 Ga0070679_100016558
266 Ga0070679_100114987
267 Ga0070679_100246674
268 Ga0070684_100051508
269 Ga0070684_100127361
270 Ga0070686_100140681
271 Ga0068855_100076265
272 Ga0068855_100084842
273 Ga0068855_100175828
274 Ga0068855_100589097
275 Ga0068855_100600879
276 Ga0070702_100518819
277 Ga0070717_10154550
278 Ga0070716_100137807
279 Ga0070712_100024346
280 Ga0070712_100207934
281 Ga0070712_100234231
282 Ga0075433_10052106
283 Ga0075434_100051812
284 Ga0075435_100050359
285 Ga0105240_10026689
286 Ga0105240_10277121
287 Ga0105245_10125326
288 Ga0105242_10033419
289 Ga0157370_10010927
290 Ga0157369_10003856
291 Ga0157369_10004745
292 Ga0157375_10155370
293 Ga0206353_10961451
294 Ga0206353_11534071
295 Ga0206353_11814207
296 Ga0207695_10454934
297 Ga0207693_10018381
298 Ga0207693_10049629
299 Ga0207663_10347919
300 Ga0207660_10027766
301 Ga0207657_10000486
302 Ga0207657_10004868
303 Ga0207652_10096097
304 Ga0207646_10337559
305 Ga0207661_10066647
306 Ga0207667_10558996
307 Ga0207651_10430802
308 Ga0207683_10323271
309 Ga0265334_10041125
310 Ga0265318_10030861
311 Ga0265322_10034848
312 Ga0265338_10020534
313 Ga0265330_10047502
314 Ga0265328_10025241
315 Ga0265325_10007808
316 Ga0265340_10027449
317 Ga0265327_10006558
318 Ga0265316_10004699
319 Ga0265313_10062009
320 Ga0265314_10032109
321 Ga0265342_10006169
322 Ga0373926_0031640
323 Ga0373936_0018811
324 Ga0373945_0003740
325 Ga0373943_0003352
326 Ga0373946_0004039
327 Ga0373946_0010345
328 Ga0373955_0084426
329 Ga0373935_0002655
330 Ga0373927_0120684
331 Ga0373933_0026405
332 Ga0373947_0001098
333 Ga0373925_0005713
334 Ga0373925_0006901
335 Ga0395900_0023598
336 Ga0395900_0031766
337 Ga0395898_0009427
338 Ga0395898_0029485
339 Ga0395905_0344160
340 Ga0395901_0001138
341 Ga0395901_0029548
342 Ga0395901_0068539
343 Ga0395901_0226950
344 Ga0395901_0259343
345 Ga0395901_0645967
346 Ga0436365_1318917
347 Ga0436363_0383499
348 Ga0466966_0024765
349 Ga0466966_0095225
350 Ga0466966_0100208
351 Ga0466966_0105752
352 Ga0466966_0208079
353 Ga0466961_0004798
354 Ga0466961_0006183
355 Ga0466961_0038659
356 Ga0466963_0007497
357 Ga0466963_0106128
358 Ga0466963_0110970
359 Ga0466963_0112545
360 Ga0466963_0157071
361 Ga0466963_0316886
362 Ga0466963_0437932
363 Ga0466964_0015899
364 Ga0466971_0065531
365 Ga0466968_0060600
366 Ga0466968_0066833
367 Ga0466968_0097504
368 Ga0466968_0098655
369 Ga0466970_0105853
370 Ga0466957_0037168
371 Ga0466957_0045605
372 Ga0466957_0048820
373 Ga0466959_0021530
374 Ga0466959_0030873
375 Ga0466959_0077436
376 Ga0466959_0119901
377 Ga0466959_0122552
378 Ga0466958_0001411
379 Ga0466967_0003288
380 Ga0466967_0012607
381 Ga0466967_0013793
382 Ga0466967_0030889
383 Ga0466967_0039646
384 Ga0466967_0153795
385 Ga0466967_0318287
386 Ga0466967_0498987
387 Ga0495592_0175854
388 Ga0495592_0188776
389 Ga0495629_0029064
390 Ga0495641_0000513
391 Ga0495651_0198835
392 Ga0495653_0024449
393 Ga0495653_0024628
394 Ga0495582_0000553
395 Ga0495639_0000429
396 Ga0495639_0055146
397 Ga0495662_0002761
398 Ga0495662_0190019
399 Ga0495664_0035738
400 Ga0495664_0093828
401 Ga0495594_0261653
402 Ga0495608_0006732
403 Ga0495608_0021201
404 Ga0495608_0035630
405 Ga0495618_0062068
406 Ga0495618_0078844
407 Ga0495628_0029985
408 Ga0495630_0002498
409 Ga0495630_0003150
410 Ga0495630_0006642
411 Ga0495666_0101869
412 Ga0495652_0332805
413 Ga0495665_0003772
414 Ga0495640_0005060
415 Ga0495640_0251542
416 Ga0495587_0043112
417 Ga0495645_0065853
418 Ga0495645_0155248
419 Ga0495667_0005148
420 Ga0495667_0019740
421 Ga0495667_0041078
422 Ga0495635_0190074
423 Ga0495646_0016478
424 Ga0495647_0004297
425 Ga0495658_0000300
426 Ga0495658_0060147
427 Ga0495613_0001388
428 Ga0495600_0058880
429 Ga0495600_0235986
430 Ga0495581_0001770
431 Ga0495581_0168857
432 Ga0495604_0017490
433 Ga0495604_0043313
434 Ga0495674_0025719
435 Ga0495674_0044734
436 Ga0495674_0479000
437 Ga0495676_0001459
438 Ga0495676_0091529
439 Ga0495680_0002487
440 Ga0495680_0009392
441 Ga0495680_0030411
442 Ga0495680_0314702
443 Ga0495675_0108041
444 Ga0495684_0168095
445 Ga0495684_0189272
446 Ga0495593_0014474
447 Ga0495593_0043813
448 Ga0495602_0039780
449 Ga0495614_0017315
450 Ga0496100_0004961
451 Ga0496100_0189196
452 Ga0496101_0016979
453 Ga0496101_0042517
454 Ga0496101_0062013
455 Ga0496101_0134785
456 Ga0496101_0398511
457 Ga0496102_0067845
458 Ga0496103_0064231
459 Ga0496103_0067356
460 Ga0496103_0094212
461 Ga0496104_0006637
462 Ga0496104_0570374
463 Ga0496105_0001009
464 Ga0496106_0002641
465 Ga0496107_0008627
466 Ga0496107_0009294
467 Ga0496107_0136005
468 Ga0496109_0017956
469 Ga0496109_0292617
470 Ga0496110_0002201
471 Ga0496111_0428327
472 Ga0496112_0268347
473 Ga0496112_0292937
474 Ga0496112_0413217
475 Ga0496112_0504277
476 Ga0496113_0027030
477 Ga0496114_0007006
478 Ga0496114_0039058
479 Ga0496115_0001699
480 Ga0496115_0316475
481 Ga0501067_0195402
482 Ga0501035_0182652
483 nmdc:mga0rr50_224302_c1
484 nmdc:mga0a205_55040_c1
485 Ga0495601_0065777
486 Ga0495601_0204063
487 Ga0495612_0049226
488 Ga0495595_0032933
489 Ga0495619_0023827
490 Ga0495619_0057692
491 Ga0495619_0303629
492 Ga0495619_0366846
493 Ga0466962_0000349
494 Ga0466962_0009541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00975

Thioesterase

Thioesterase domain

32

128

0.9

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

32

268

0.83

PF12146

Hydrolase_4

Serine aminopeptidase, S33

33

268

0.72

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

34

274

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pi1-assembly1.cif.gz_B bicyclic incypro pseudomonas fluorescens esterase 0.8188 14 270
3hi4-assembly2.cif.gz_D switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase 0.815 14 271
2puh-assembly1.cif.gz_A crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda 0.8144 10 271
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.8144 14 271
3fob-assembly1.cif.gz_B crystal structure of bromoperoxidase from bacillus anthracis 0.8101 12 271
ID Description Score Start End Superfamily
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9335 8 121 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9216 8 88 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8786 12 121 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8706 21 121 3.40.50.12270
af_A0A0N7KCX9_11_155_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8591 31 130 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q6BAY2-F1-model_v4 Alpha/beta fold hydrolase 0.9671 12 101 GO:0016787
AF-A0A538GTK3-F1-model_v4 Alpha/beta hydrolase 0.9569 52 268 GO:0016787
AF-A0A538JHW1-F1-model_v4 Alpha/beta fold hydrolase 0.9505 7 271 GO:0016020
GO:0016787
AF-A0A538LQH0-F1-model_v4 Alpha/beta hydrolase 0.9504 1 271 GO:0016787
AF-A0A538J4S8-F1-model_v4 Alpha/beta fold hydrolase 0.9472 5 257 GO:0016787

Map