F358847

General Info

Members Datasets Scaffolds Average Seq Length
247 172 248 224

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100304439|Ga0070704_1003044392
Length 239
Sequence LSARSRAGIRVSDQARAALEAVLAMLAEDPAAPSAVRDPERAWRVHVADSLTGLEVEALRAARRVADLGAGAGFPGLPVAVARPECRVDLIESVGRKCEFIRGAIQRAGIGNAEVVCGRSESWAAEPPPDGGREGYDAVTARAVGRLSTLAELASPLLVHGGVLVAWKGRRDAEEEAELGRASTRLAMEAEEVRWVGPYAGSRHRHLHVVRKTGPTPANLPRRPGMAKKRPPGAISPRG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 12.96
Rhizosphere 81.38
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10135645 3300003316 Unclassified 1691
2 rootH1_10135645 3300003323 Bacteria 5855
3 Ga0070683_100028190 3300005329 Bacteria 5073
4 Ga0070670_100508092 3300005331 Bacteria 1072
5 Ga0070666_10003848 3300005335 Bacteria 9107
6 Ga0070666_10135453 3300005335 Unclassified 1713
7 Ga0070680_100111059 3300005336 Bacteria 2282
8 Ga0070682_100000029 3300005337 Bacteria 183516
9 Ga0068868_100016667 3300005338 Bacteria 5463
10 Ga0070689_100112301 3300005340 Bacteria 2169
11 Ga0070691_10033839 3300005341 Bacteria 2405
12 Ga0070675_100000015 3300005354 Bacteria 201080
13 Ga0070688_100008093 3300005365 Bacteria 5694
14 Ga0070659_100060046 3300005366 Bacteria 3003
15 Ga0070667_100484117 3300005367 Unclassified 1133
16 Ga0070714_100061733 3300005435 Bacteria 3220
17 Ga0070713_100000014 3300005436 Bacteria 124804
18 Ga0070711_100020732 3300005439 Bacteria 4240
19 Ga0070678_100015997 3300005456 Bacteria 4782
20 Ga0070662_100000008 3300005457 Bacteria 168754
21 Ga0068867_100000518 3300005459 Bacteria 25679
22 Ga0070685_10000028 3300005466 Bacteria 90128
23 Ga0070685_10069795 3300005466 Bacteria 2079
24 Ga0070679_100000812 3300005530 Bacteria 27087
25 Ga0070684_100005423 3300005535 Bacteria 9772
26 Ga0070684_100091719 3300005535 Bacteria 2703
27 Ga0070665_100000120 3300005548 Bacteria 148340
28 Ga0070665_100005793 3300005548 Bacteria 12678
29 Ga0070665_100065830 3300005548 Bacteria 3634
30 Ga0070665_100068856 3300005548 Bacteria 3548
31 Ga0070704_100304439 3300005549 Bacteria 1329
32 Ga0070704_100462174 3300005549 Bacteria 1095
33 Ga0068855_100077537 3300005563 Bacteria 3856
34 Ga0068855_100713629 3300005563 Bacteria 1072
35 Ga0068857_100414441 3300005577 Bacteria 1255
36 Ga0068854_100003092 3300005578 Bacteria 10364
37 Ga0068856_100005266 3300005614 Bacteria 12756
38 Ga0068856_100102162 3300005614 Bacteria 2860
39 Ga0068851_10000347 3300005834 Bacteria 20830
40 Ga0068858_100000035 3300005842 Bacteria 140466
41 Ga0081455_10064359 3300005937 Bacteria 3070
42 Ga0081538_10001487 3300005981 Bacteria 24067
43 Ga0081538_10045876 3300005981 Bacteria 2703
44 Ga0075364_10435494 3300006051 Bacteria 896
45 Ga0075367_10134652 3300006178 Bacteria 1528
46 Ga0075431_100187125 3300006847 Bacteria 2123
47 Ga0075433_10368425 3300006852 Bacteria 1269
48 Ga0075434_100048203 3300006871 Bacteria 4227
49 Ga0068865_100000001 3300006881 Bacteria 288199
50 Ga0075435_100156687 3300007076 Bacteria 1916
51 Ga0105245_10000045 3300009098 Bacteria 134057
52 Ga0105245_10000053 3300009098 Bacteria 125678
53 Ga0105245_10013033 3300009098 Bacteria 7244
54 Ga0105245_10736681 3300009098 Bacteria 1021
55 Ga0105247_10000169 3300009101 Bacteria 64387
56 Ga0114129_10143730 3300009147 Bacteria 3268
57 Ga0105243_10022400 3300009148 Bacteria 4801
58 Ga0105243_10294483 3300009148 Bacteria 1468
59 Ga0105241_10014789 3300009174 Bacteria 5713
60 Ga0105242_10000017 3300009176 Bacteria 122190
61 Ga0105248_10000089 3300009177 Bacteria 102101
62 Ga0105248_10826342 3300009177 Bacteria 1046
63 Ga0105238_10000240 3300009551 Bacteria 61138
64 Ga0105238_10207294 3300009551 Unclassified 1936
65 Ga0105249_10030142 3300009553 Bacteria 4902
66 Ga0105239_10230867 3300010375 Bacteria 2076
67 Ga0157370_10010841 3300013104 Bacteria 9573
68 Ga0157369_10000037 3300013105 Bacteria 190395
69 Ga0157374_10001263 3300013296 Bacteria 21606
70 Ga0157378_10012832 3300013297 Bacteria 7334
71 Ga0157372_10000064 3300013307 Bacteria 114648
72 Ga0157375_10120375 3300013308 Bacteria 2734
73 Ga0163161_10030305 3300017792 Bacteria 3849
74 Ga0207656_10000168 3300025321 Bacteria 24193
75 Ga0207682_10000047 3300025893 Bacteria 51208
76 Ga0207710_10000103 3300025900 Bacteria 109033
77 Ga0207710_10051265 3300025900 Bacteria 1853
78 Ga0207685_10000001 3300025905 Bacteria 604473
79 Ga0207705_10234681 3300025909 Bacteria 1396
80 Ga0207660_10088593 3300025917 Bacteria 2289
81 Ga0207652_10000544 3300025921 Bacteria 38182
82 Ga0207694_10000067 3300025924 Bacteria 128108
83 Ga0207659_10000032 3300025926 Bacteria 119492
84 Ga0207687_10000023 3300025927 Bacteria 217098
85 Ga0207687_10372572 3300025927 Bacteria 1168
86 Ga0207700_10000009 3300025928 Bacteria 314953
87 Ga0207706_10000016 3300025933 Bacteria 170697
88 Ga0207686_10000016 3300025934 Bacteria 198779
89 Ga0207686_10000029 3300025934 Bacteria 160239
90 Ga0207704_10000004 3300025938 Bacteria 239295
91 Ga0207711_10000083 3300025941 Bacteria 102109
92 Ga0207661_10001101 3300025944 Bacteria 17973
93 Ga0207712_10085005 3300025961 Bacteria 2314
94 Ga0207668_10008762 3300025972 Bacteria 6046
95 Ga0207640_10001945 3300025981 Bacteria 11120
96 Ga0207640_10032925 3300025981 Bacteria 3218
97 Ga0207658_10058158 3300025986 Bacteria 2876
98 Ga0207677_10000444 3300026023 Bacteria 28037
99 Ga0207703_10000067 3300026035 Bacteria 125623
100 Ga0207639_10134607 3300026041 Bacteria 2050
101 Ga0207639_10270737 3300026041 Unclassified 1490
102 Ga0207702_10002492 3300026078 Bacteria 17387
103 Ga0207702_10011005 3300026078 Bacteria 7547
104 Ga0207648_10002078 3300026089 Bacteria 21809
105 Ga0207674_10197990 3300026116 Bacteria 1959
106 Ga0207683_10028894 3300026121 Bacteria 4798
107 Ga0268266_10000023 3300028379 Bacteria 501899
108 Ga0268266_10001671 3300028379 Bacteria 25564
109 Ga0268266_10066296 3300028379 Bacteria 3122
110 Ga0265319_1000044 3300028563 Bacteria 103641
111 Ga0265338_10000297 3300028800 Bacteria 89764
112 Ga0265331_10095273 3300031250 Bacteria 1373
113 Ga0395899_0012847 3300037312 Bacteria 6413
114 Ga0395900_0007709 3300037418 Bacteria 11102
115 Ga0395900_0097421 3300037418 Bacteria 3022
116 Ga0395900_0277285 3300037418 Bacteria 1670
117 Ga0395898_0477685 3300037466 Bacteria 1186
118 Ga0395898_0583683 3300037466 Bacteria 1060
119 Ga0395898_0610689 3300037466 Bacteria 1033
120 Ga0395901_0011178 3300038443 Bacteria 9097
121 Ga0395901_0347712 3300038443 Bacteria 1531
122 Ga0451839_0199833 3300041496 Bacteria 1264
123 Ga0451853_1584584 3300041512 Bacteria 2441
124 Ga0451853_2291948 3300041512 Bacteria 1321
125 Ga0466963_0000027 3300044694 Bacteria 48596
126 Ga0466957_0004382 3300044842 Bacteria 7852
127 Ga0495592_0000518 3300046454 Bacteria 27890
128 Ga0495603_0001096 3300046455 Bacteria 15726
129 Ga0495603_0037976 3300046455 Bacteria 2889
130 Ga0495629_0043157 3300046459 Bacteria 3167
131 Ga0495641_0018300 3300046461 Bacteria 3619
132 Ga0495641_0086183 3300046461 Bacteria 1406
133 Ga0495653_0032301 3300046463 Bacteria 4158
134 Ga0495582_0000012 3300046473 Bacteria 112893
135 Ga0495606_0000045 3300046507 Bacteria 212105
136 Ga0495608_0000001 3300046511 Bacteria 411278
137 Ga0495608_0004473 3300046511 Bacteria 9988
138 Ga0495618_0000068 3300046514 Bacteria 74614
139 Ga0495618_0159466 3300046514 Bacteria 1439
140 Ga0495620_0000428 3300046515 Bacteria 28031
141 Ga0495628_0081694 3300046516 Bacteria 2510
142 Ga0495628_0106116 3300046516 Bacteria 2163
143 Ga0495630_0000007 3300046517 Bacteria 376915
144 Ga0495630_0013070 3300046517 Bacteria 6035
145 Ga0495644_0000296 3300046523 Bacteria 23051
146 Ga0495586_0003174 3300046535 Bacteria 8840
147 Ga0495586_0468008 3300046535 Bacteria 727
148 Ga0495587_0030486 3300046536 Bacteria 3270
149 Ga0495621_0019960 3300046539 Bacteria 2194
150 Ga0495667_0000015 3300046559 Bacteria 200377
151 Ga0495647_0000013 3300046681 Bacteria 88029
152 Ga0495647_0000059 3300046681 Bacteria 27437
153 Ga0495647_0010331 3300046681 Bacteria 3177
154 Ga0495658_0000024 3300046683 Bacteria 81300
155 Ga0495669_0151392 3300046684 Bacteria 1098
156 Ga0495613_0000159 3300046689 Bacteria 65969
157 Ga0495624_0000013 3300046690 Bacteria 115278
158 Ga0495624_0001178 3300046690 Bacteria 20710
159 Ga0495624_0055104 3300046690 Bacteria 2506
160 Ga0495670_0023653 3300046691 Bacteria 3032
161 Ga0495600_0003198 3300046809 Bacteria 9590
162 Ga0495600_0438827 3300046809 Bacteria 809
163 Ga0495660_0193036 3300046810 Unclassified 977
164 Ga0495604_0000033 3300047317 Bacteria 134810
165 Ga0495672_0126325 3300047320 Bacteria 1352
166 Ga0495676_0000091 3300047321 Bacteria 66575
167 Ga0495676_0075994 3300047321 Bacteria 2566
168 Ga0495676_0078380 3300047321 Bacteria 2516
169 Ga0495676_0296596 3300047321 Bacteria 1091
170 Ga0495680_0003127 3300047322 Bacteria 16492
171 Ga0495673_0069290 3300047469 Bacteria 1488
172 Ga0495686_0075173 3300047472 Bacteria 2072
173 Ga0495593_0014096 3300047673 Bacteria 4550
174 Ga0495593_0085652 3300047673 Bacteria 1626
175 Ga0495602_0127560 3300048088 Bacteria 2035
176 Ga0496100_0000003 3300048903 Bacteria 360802
177 Ga0496101_0000003 3300048904 Bacteria 406565
178 Ga0496102_0000054 3300048905 Bacteria 175565
179 Ga0496102_0485064 3300048905 Bacteria 1158
180 Ga0496102_0620175 3300048905 Bacteria 1005
181 Ga0496103_0000079 3300048906 Bacteria 110624
182 Ga0496104_0000063 3300048907 Bacteria 116618
183 Ga0496104_0001123 3300048907 Bacteria 22922
184 Ga0496104_0434679 3300048907 Bacteria 1224
185 Ga0496105_0000041 3300048908 Bacteria 116618
186 Ga0496105_0000209 3300048908 Bacteria 39293
187 Ga0496105_0046303 3300048908 Bacteria 3590
188 Ga0496106_0000048 3300048909 Bacteria 98233
189 Ga0496107_0000008 3300048910 Bacteria 251874
190 Ga0496107_0200299 3300048910 Bacteria 1484
191 Ga0496108_0000024 3300048911 Bacteria 183389
192 Ga0496109_0000033 3300048912 Bacteria 160496
193 Ga0496109_0421284 3300048912 Bacteria 1261
194 Ga0496110_0004903 3300048913 Bacteria 10440
195 Ga0496110_0054047 3300048913 Bacteria 3532
196 Ga0496110_0457437 3300048913 Bacteria 1163
197 Ga0496110_0562729 3300048913 Unclassified 1036
198 Ga0496111_0000004 3300048914 Bacteria 116115
199 Ga0496111_0003219 3300048914 Bacteria 10075
200 Ga0496111_0498675 3300048914 Bacteria 896
201 Ga0496112_0000002 3300048915 Bacteria 782039
202 Ga0496112_0007130 3300048915 Bacteria 9891
203 Ga0496112_0325199 3300048915 Bacteria 1482
204 Ga0496113_0000030 3300048916 Bacteria 60123
205 Ga0496113_0121526 3300048916 Bacteria 2042
206 Ga0496114_0014927 3300048917 Bacteria 6244
207 Ga0496114_0107890 3300048917 Bacteria 2383
208 Ga0496119_0003689 3300048922 Bacteria 15697
209 Ga0496124_0188102 3300048927 Unclassified 1583
210 Ga0501032_0123381 3300049569 Unclassified 1712
211 Ga0501034_0012153 3300049571 Bacteria 8901
212 Ga0501034_0903320 3300049571 Unclassified 771
213 Ga0501039_0584694 3300049575 Bacteria 875
214 Ga0501047_0602860 3300049581 Bacteria 920
215 Ga0501048_0234222 3300049582 Unclassified 1303
216 Ga0501067_0068392 3300049583 Bacteria 1966
217 Ga0501068_0202879 3300049584 Bacteria 1258
218 Ga0501068_0604147 3300049584 Bacteria 715
219 Ga0501070_0132837 3300049586 Bacteria 2056
220 Ga0501072_0039921 3300049588 Bacteria 3685
221 Ga0501072_0091921 3300049588 Bacteria 2409
222 Ga0501074_0073342 3300049590 Bacteria 2459
223 Ga0501074_0435849 3300049590 Bacteria 929
224 Ga0501075_0033971 3300049591 Bacteria 3796
225 Ga0501076_0175067 3300049592 Bacteria 1749
226 Ga0501076_0238283 3300049592 Bacteria 1488
227 Ga0501076_0285959 3300049592 Bacteria 1351
228 Ga0501081_0045811 3300049743 Bacteria 3004
229 Ga0501081_0332852 3300049743 Unclassified 1117
230 Ga0501044_0093001 3300049823 Bacteria 3041
231 nmdc:mga03n38_42944_c1 3300050490 Bacteria 1979
232 nmdc:mga00v17_235187_c1 3300050491 Bacteria 1187
233 nmdc:mga00v17_461099_c1 3300050491 Bacteria 825
234 nmdc:mga0yw44_106680_c1 3300050492 Bacteria 1791
235 nmdc:mga0yw44_91951_c1 3300050492 Bacteria 1919
236 nmdc:mga06z11_81203_c1 3300050494 Bacteria 1740
237 nmdc:mga05p37_111317_c1 3300050507 Bacteria 3367
238 nmdc:mga06r32_372403_c1 3300050510 Unclassified 1411
239 nmdc:mga0n895_354165_c1 3300050512 Bacteria 1487
240 nmdc:mga0rr50_269658_c1 3300050513 Bacteria 1418
241 nmdc:mga0a205_133798_c1 3300050515 Bacteria 2380
242 nmdc:mga0a205_9_c1 3300050515 Bacteria 55726
243 Ga0495601_0009675 3300053077 Bacteria 5705
244 Ga0495601_0087975 3300053077 Bacteria 1997
245 Ga0495612_0006649 3300053078 Bacteria 4742
246 Ga0495619_0000020 3300053085 Bacteria 201556
247 Ga0495619_0171969 3300053085 Bacteria 1498
248 Ga0501084_0581773 3300054114 Bacteria 946

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0438827 Ga0495600_0438827_75_638 185
2 3300046684 Ga0495669_0151392 Ga0495669_0151392_75_659 193
3 3300048917 Ga0496114_0014927 Ga0496114_0014927_5637_6221 193
4 3300049571 Ga0501034_0903320 Ga0501034_0903320_85_666 193
5 3300049584 Ga0501068_0604147 Ga0501068_0604147_24_605 193
6 3300005535 Ga0070684_100091719 Ga0070684_1000917194 194
7 3300046454 Ga0495592_0000518 Ga0495592_0000518_20594_21217 196
8 3300046690 Ga0495624_0001178 Ga0495624_0001178_19481_20161 199
9 3300005563 Ga0068855_100713629 Ga0068855_1007136291 203
10 3300041496 Ga0451839_0199833 Ga0451839_0199833_507_1133 203
11 3300041512 Ga0451853_1584584 Ga0451853_1584584_239_865 203
12 3300049592 Ga0501076_0175067 Ga0501076_0175067_41_652 203
13 3300025961 Ga0207712_10085005 Ga0207712_100850053 204
14 3300050515 nmdc:mga0a205_9_c1 nmdc:mga0a205_9_c1_39478_40095 204
15 3300050492 nmdc:mga0yw44_106680_c1 nmdc:mga0yw44_106680_c1_358_1065 205
16 3300005336 Ga0070680_100111059 Ga0070680_1001110591 206
17 3300005530 Ga0070679_100000812 Ga0070679_10000081212 206
18 3300046455 Ga0495603_0037976 Ga0495603_0037976_2170_2793 206
19 3300046473 Ga0495582_0000012 Ga0495582_0000012_99566_100189 206
20 3300046514 Ga0495618_0000068 Ga0495618_0000068_8212_8835 206
21 3300046517 Ga0495630_0013070 Ga0495630_0013070_745_1368 206
22 3300046535 Ga0495586_0468008 Ga0495586_0468008_48_671 206
23 3300046539 Ga0495621_0019960 Ga0495621_0019960_700_1323 206
24 3300046681 Ga0495647_0010331 Ga0495647_0010331_1889_2512 206
25 3300046683 Ga0495658_0000024 Ga0495658_0000024_12716_13339 206
26 3300046689 Ga0495613_0000159 Ga0495613_0000159_21040_21663 206
27 3300046809 Ga0495600_0003198 Ga0495600_0003198_8231_8854 206
28 3300048905 Ga0496102_0620175 Ga0496102_0620175_326_949 206
29 3300048916 Ga0496113_0121526 Ga0496113_0121526_661_1284 206
30 3300047321 Ga0495676_0296596 Ga0495676_0296596_289_915 207
31 3300048907 Ga0496104_0434679 Ga0496104_0434679_172_822 207
32 3300048908 Ga0496105_0046303 Ga0496105_0046303_2702_3352 207
33 3300048915 Ga0496112_0000002 Ga0496112_0000002_706545_707171 207
34 3300049569 Ga0501032_0123381 Ga0501032_0123381_990_1622 207
35 3300049571 Ga0501034_0012153 Ga0501034_0012153_6790_7422 207
36 3300049581 Ga0501047_0602860 Ga0501047_0602860_71_703 207
37 3300049823 Ga0501044_0093001 Ga0501044_0093001_1084_1716 207
38 3300005614 Ga0068856_100102162 Ga0068856_1001021625 209
39 3300026078 Ga0207702_10011005 Ga0207702_1001100510 209
40 3300006852 Ga0075433_10368425 Ga0075433_103684252 210
41 3300007076 Ga0075435_100156687 Ga0075435_1001566873 210
42 3300037312 Ga0395899_0012847 Ga0395899_0012847_4487_5137 210
43 3300037418 Ga0395900_0007709 Ga0395900_0007709_1738_2388 210
44 3300038443 Ga0395901_0011178 Ga0395901_0011178_6763_7413 210
45 3300046514 Ga0495618_0159466 Ga0495618_0159466_40_672 210
46 3300048905 Ga0496102_0485064 Ga0496102_0485064_271_927 210
47 3300049590 Ga0501074_0435849 Ga0501074_0435849_122_754 210
48 3300050512 nmdc:mga0n895_354165_c1 nmdc:mga0n895_354165_c1_427_1083 210
49 3300050513 nmdc:mga0rr50_269658_c1 nmdc:mga0rr50_269658_c1_671_1327 210
50 3300050515 nmdc:mga0a205_133798_c1 nmdc:mga0a205_133798_c1_564_1220 210
51 3300006847 Ga0075431_100187125 Ga0075431_1001871251 211
52 3300048913 Ga0496110_0004903 Ga0496110_0004903_9595_10275 211
53 3300048914 Ga0496111_0000004 Ga0496111_0000004_71244_71924 211
54 3300050510 nmdc:mga06r32_372403_c1 nmdc:mga06r32_372403_c1_25_699 211
55 3300009148 Ga0105243_10294483 Ga0105243_102944832 212
56 3300048917 Ga0496114_0107890 Ga0496114_0107890_194_874 213
57 3300049590 Ga0501074_0073342 Ga0501074_0073342_589_1296 213
58 3300049575 Ga0501039_0584694 Ga0501039_0584694_83_772 215
59 3300049582 Ga0501048_0234222 Ga0501048_0234222_13_702 215
60 3300049584 Ga0501068_0202879 Ga0501068_0202879_173_862 215
61 3300049588 Ga0501072_0039921 Ga0501072_0039921_49_738 215
62 3300049592 Ga0501076_0238283 Ga0501076_0238283_414_1103 215
63 3300046681 Ga0495647_0000013 Ga0495647_0000013_53243_53953 216
64 3300037418 Ga0395900_0097421 Ga0395900_0097421_1734_2411 217
65 3300038443 Ga0395901_0347712 Ga0395901_0347712_142_819 217
66 3300005329 Ga0070683_100028190 Ga0070683_1000281908 219
67 3300005354 Ga0070675_100000015 Ga0070675_10000001527 219
68 3300005535 Ga0070684_100005423 Ga0070684_1000054234 219
69 3300005548 Ga0070665_100000120 Ga0070665_10000012060 219
70 3300005577 Ga0068857_100414441 Ga0068857_1004144412 219
71 3300005842 Ga0068858_100000035 Ga0068858_10000003558 219
72 3300013297 Ga0157378_10012832 Ga0157378_100128327 219
73 3300025926 Ga0207659_10000032 Ga0207659_100000326 219
74 3300025927 Ga0207687_10372572 Ga0207687_103725722 219
75 3300025944 Ga0207661_10001101 Ga0207661_1000110117 219
76 3300026035 Ga0207703_10000067 Ga0207703_1000006791 219
77 3300026116 Ga0207674_10197990 Ga0207674_101979902 219
78 3300028379 Ga0268266_10000023 Ga0268266_10000023420 219
79 3300047321 Ga0495676_0075994 Ga0495676_0075994_15_674 219
80 3300048915 Ga0496112_0325199 Ga0496112_0325199_239_928 219
81 3300009101 Ga0105247_10000169 Ga0105247_1000016922 220
82 3300037418 Ga0395900_0277285 Ga0395900_0277285_627_1304 220
83 3300037466 Ga0395898_0477685 Ga0395898_0477685_107_784 220
84 3300037466 Ga0395898_0583683 Ga0395898_0583683_365_1042 220
85 3300037466 Ga0395898_0610689 Ga0395898_0610689_169_846 220
86 3300047321 Ga0495676_0078380 Ga0495676_0078380_13_723 221
87 3300048912 Ga0496109_0421284 Ga0496109_0421284_291_971 221
88 3300048914 Ga0496111_0003219 Ga0496111_0003219_5296_5976 221
89 3300049583 Ga0501067_0068392 Ga0501067_0068392_710_1387 221
90 3300046523 Ga0495644_0000296 Ga0495644_0000296_1496_2176 223
91 3300050492 nmdc:mga0yw44_91951_c1 nmdc:mga0yw44_91951_c1_31_714 223
92 3300005981 Ga0081538_10001487 Ga0081538_1000148722 224
93 3300046455 Ga0495603_0001096 Ga0495603_0001096_14598_15275 224
94 3300049586 Ga0501070_0132837 Ga0501070_0132837_649_1338 224
95 3300048088 Ga0495602_0127560 Ga0495602_0127560_1226_1915 225
96 3300003316 rootH1_10135645 rootH1_101356452 226
97 3300005331 Ga0070670_100508092 Ga0070670_1005080922 226
98 3300005335 Ga0070666_10003848 Ga0070666_1000384810 226
99 3300005335 Ga0070666_10135453 Ga0070666_101354532 226
100 3300005337 Ga0070682_100000029 Ga0070682_100000029115 226
101 3300005338 Ga0068868_100016667 Ga0068868_1000166677 226
102 3300005340 Ga0070689_100112301 Ga0070689_1001123012 226
103 3300005341 Ga0070691_10033839 Ga0070691_100338393 226
104 3300005365 Ga0070688_100008093 Ga0070688_1000080932 226
105 3300005366 Ga0070659_100060046 Ga0070659_1000600463 226
106 3300005367 Ga0070667_100484117 Ga0070667_1004841172 226
107 3300005435 Ga0070714_100061733 Ga0070714_1000617333 226
108 3300005436 Ga0070713_100000014 Ga0070713_10000001426 226
109 3300005439 Ga0070711_100020732 Ga0070711_1000207325 226
110 3300005456 Ga0070678_100015997 Ga0070678_1000159975 226
111 3300005457 Ga0070662_100000008 Ga0070662_100000008146 226
112 3300005459 Ga0068867_100000518 Ga0068867_10000051820 226
113 3300005466 Ga0070685_10000028 Ga0070685_1000002820 226
114 3300005466 Ga0070685_10069795 Ga0070685_100697952 226
115 3300005548 Ga0070665_100005793 Ga0070665_1000057938 226
116 3300005548 Ga0070665_100065830 Ga0070665_1000658305 226
117 3300005548 Ga0070665_100068856 Ga0070665_1000688566 226
118 3300005549 Ga0070704_100304439 Ga0070704_1003044392 226
119 3300005549 Ga0070704_100462174 Ga0070704_1004621741 226
120 3300005563 Ga0068855_100077537 Ga0068855_1000775373 226
121 3300005578 Ga0068854_100003092 Ga0068854_1000030922 226
122 3300005614 Ga0068856_100005266 Ga0068856_10000526613 226
123 3300005834 Ga0068851_10000347 Ga0068851_100003479 226
124 3300005937 Ga0081455_10064359 Ga0081455_100643592 226
125 3300005981 Ga0081538_10045876 Ga0081538_100458763 226
126 3300006051 Ga0075364_10435494 Ga0075364_104354942 226
127 3300006178 Ga0075367_10134652 Ga0075367_101346522 226
128 3300006871 Ga0075434_100048203 Ga0075434_1000482035 226
129 3300006881 Ga0068865_100000001 Ga0068865_100000001254 226
130 3300009098 Ga0105245_10000045 Ga0105245_1000004561 226
131 3300009098 Ga0105245_10000053 Ga0105245_1000005312 226
132 3300009098 Ga0105245_10013033 Ga0105245_100130339 226
133 3300009098 Ga0105245_10736681 Ga0105245_107366812 226
134 3300009147 Ga0114129_10143730 Ga0114129_101437303 226
135 3300009148 Ga0105243_10022400 Ga0105243_100224007 226
136 3300009174 Ga0105241_10014789 Ga0105241_100147898 226
137 3300009176 Ga0105242_10000017 Ga0105242_1000001711 226
138 3300009177 Ga0105248_10000089 Ga0105248_1000008928 226
139 3300009177 Ga0105248_10826342 Ga0105248_108263422 226
140 3300009551 Ga0105238_10000240 Ga0105238_100002403 226
141 3300009551 Ga0105238_10207294 Ga0105238_102072943 226
142 3300009553 Ga0105249_10030142 Ga0105249_100301426 226
143 3300010375 Ga0105239_10230867 Ga0105239_102308673 226
144 3300013104 Ga0157370_10010841 Ga0157370_1001084110 226
145 3300013105 Ga0157369_10000037 Ga0157369_1000003770 226
146 3300013296 Ga0157374_10001263 Ga0157374_100012634 226
147 3300013307 Ga0157372_10000064 Ga0157372_1000006445 226
148 3300013308 Ga0157375_10120375 Ga0157375_101203753 226
149 3300017792 Ga0163161_10030305 Ga0163161_100303056 226
150 3300025321 Ga0207656_10000168 Ga0207656_1000016822 226
151 3300025893 Ga0207682_10000047 Ga0207682_1000004733 226
152 3300025900 Ga0207710_10000103 Ga0207710_1000010345 226
153 3300025900 Ga0207710_10051265 Ga0207710_100512652 226
154 3300025905 Ga0207685_10000001 Ga0207685_10000001379 226
155 3300025909 Ga0207705_10234681 Ga0207705_102346812 226
156 3300025917 Ga0207660_10088593 Ga0207660_100885932 226
157 3300025921 Ga0207652_10000544 Ga0207652_1000054430 226
158 3300025924 Ga0207694_10000067 Ga0207694_1000006767 226
159 3300025927 Ga0207687_10000023 Ga0207687_1000002361 226
160 3300025928 Ga0207700_10000009 Ga0207700_10000009101 226
161 3300025933 Ga0207706_10000016 Ga0207706_1000001629 226
162 3300025934 Ga0207686_10000016 Ga0207686_1000001610 226
163 3300025934 Ga0207686_10000029 Ga0207686_10000029145 226
164 3300025938 Ga0207704_10000004 Ga0207704_1000000441 226
165 3300025941 Ga0207711_10000083 Ga0207711_1000008328 226
166 3300025972 Ga0207668_10008762 Ga0207668_100087625 226
167 3300025981 Ga0207640_10001945 Ga0207640_100019454 226
168 3300025981 Ga0207640_10032925 Ga0207640_100329252 226
169 3300025986 Ga0207658_10058158 Ga0207658_100581584 226
170 3300026023 Ga0207677_10000444 Ga0207677_100004445 226
171 3300026041 Ga0207639_10134607 Ga0207639_101346073 226
172 3300026041 Ga0207639_10270737 Ga0207639_102707372 226
173 3300026078 Ga0207702_10002492 Ga0207702_1000249213 226
174 3300026089 Ga0207648_10002078 Ga0207648_100020783 226
175 3300026121 Ga0207683_10028894 Ga0207683_100288945 226
176 3300028379 Ga0268266_10001671 Ga0268266_1000167111 226
177 3300028379 Ga0268266_10066296 Ga0268266_100662963 226
178 3300028563 Ga0265319_1000044 Ga0265319_100004431 226
179 3300028800 Ga0265338_10000297 Ga0265338_1000029731 226
180 3300031250 Ga0265331_10095273 Ga0265331_100952732 226
181 3300041512 Ga0451853_2291948 Ga0451853_2291948_549_1247 226
182 3300044694 Ga0466963_0000027 Ga0466963_0000027_37334_38053 226
183 3300044842 Ga0466957_0004382 Ga0466957_0004382_366_1046 226
184 3300046459 Ga0495629_0043157 Ga0495629_0043157_606_1286 226
185 3300046461 Ga0495641_0018300 Ga0495641_0018300_991_1671 226
186 3300046461 Ga0495641_0086183 Ga0495641_0086183_659_1369 226
187 3300046463 Ga0495653_0032301 Ga0495653_0032301_2629_3336 226
188 3300046507 Ga0495606_0000045 Ga0495606_0000045_164113_164793 226
189 3300046511 Ga0495608_0000001 Ga0495608_0000001_110621_111301 226
190 3300046511 Ga0495608_0004473 Ga0495608_0004473_829_1539 226
191 3300046515 Ga0495620_0000428 Ga0495620_0000428_11421_12137 226
192 3300046516 Ga0495628_0081694 Ga0495628_0081694_1723_2433 226
193 3300046516 Ga0495628_0106116 Ga0495628_0106116_1296_1976 226
194 3300046517 Ga0495630_0000007 Ga0495630_0000007_362044_362724 226
195 3300046535 Ga0495586_0003174 Ga0495586_0003174_7444_8154 226
196 3300046536 Ga0495587_0030486 Ga0495587_0030486_878_1561 226
197 3300046559 Ga0495667_0000015 Ga0495667_0000015_141418_142101 226
198 3300046681 Ga0495647_0000059 Ga0495647_0000059_9886_10566 226
199 3300046690 Ga0495624_0000013 Ga0495624_0000013_59878_60588 226
200 3300046690 Ga0495624_0055104 Ga0495624_0055104_1766_2476 226
201 3300046691 Ga0495670_0023653 Ga0495670_0023653_2238_2921 226
202 3300046810 Ga0495660_0193036 Ga0495660_0193036_106_786 226
203 3300047317 Ga0495604_0000033 Ga0495604_0000033_92_775 226
204 3300047320 Ga0495672_0126325 Ga0495672_0126325_38_718 226
205 3300047321 Ga0495676_0000091 Ga0495676_0000091_45627_46337 226
206 3300047322 Ga0495680_0003127 Ga0495680_0003127_11202_11885 226
207 3300047469 Ga0495673_0069290 Ga0495673_0069290_217_927 226
208 3300047472 Ga0495686_0075173 Ga0495686_0075173_77_757 226
209 3300047673 Ga0495593_0014096 Ga0495593_0014096_408_1088 226
210 3300047673 Ga0495593_0085652 Ga0495593_0085652_778_1488 226
211 3300048903 Ga0496100_0000003 Ga0496100_0000003_319257_319973 226
212 3300048904 Ga0496101_0000003 Ga0496101_0000003_319257_319973 226
213 3300048905 Ga0496102_0000054 Ga0496102_0000054_101195_101875 226
214 3300048906 Ga0496103_0000079 Ga0496103_0000079_8763_9443 226
215 3300048907 Ga0496104_0000063 Ga0496104_0000063_58053_58733 226
216 3300048907 Ga0496104_0001123 Ga0496104_0001123_11705_12385 226
217 3300048908 Ga0496105_0000041 Ga0496105_0000041_57886_58566 226
218 3300048908 Ga0496105_0000209 Ga0496105_0000209_32923_33603 226
219 3300048909 Ga0496106_0000048 Ga0496106_0000048_40833_41549 226
220 3300048910 Ga0496107_0000008 Ga0496107_0000008_210317_211033 226
221 3300048910 Ga0496107_0200299 Ga0496107_0200299_93_776 226
222 3300048911 Ga0496108_0000024 Ga0496108_0000024_110897_111577 226
223 3300048912 Ga0496109_0000033 Ga0496109_0000033_88004_88684 226
224 3300048913 Ga0496110_0054047 Ga0496110_0054047_716_1432 226
225 3300048913 Ga0496110_0457437 Ga0496110_0457437_402_1082 226
226 3300048913 Ga0496110_0562729 Ga0496110_0562729_321_1001 226
227 3300048914 Ga0496111_0498675 Ga0496111_0498675_110_790 226
228 3300048915 Ga0496112_0007130 Ga0496112_0007130_42_722 226
229 3300048916 Ga0496113_0000030 Ga0496113_0000030_51061_51741 226
230 3300048922 Ga0496119_0003689 Ga0496119_0003689_5125_5805 226
231 3300048927 Ga0496124_0188102 Ga0496124_0188102_585_1265 226
232 3300049588 Ga0501072_0091921 Ga0501072_0091921_1188_1895 226
233 3300049591 Ga0501075_0033971 Ga0501075_0033971_657_1364 226
234 3300049592 Ga0501076_0285959 Ga0501076_0285959_626_1333 226
235 3300049743 Ga0501081_0045811 Ga0501081_0045811_228_935 226
236 3300049743 Ga0501081_0332852 Ga0501081_0332852_397_1080 226
237 3300050490 nmdc:mga03n38_42944_c1 nmdc:mga03n38_42944_c1_1109_1813 226
238 3300050491 nmdc:mga00v17_235187_c1 nmdc:mga00v17_235187_c1_121_831 226
239 3300050491 nmdc:mga00v17_461099_c1 nmdc:mga00v17_461099_c1_87_791 226
240 3300050494 nmdc:mga06z11_81203_c1 nmdc:mga06z11_81203_c1_757_1461 226
241 3300050507 nmdc:mga05p37_111317_c1 nmdc:mga05p37_111317_c1_1517_2236 226
242 3300053077 Ga0495601_0009675 Ga0495601_0009675_4970_5650 226
243 3300053077 Ga0495601_0087975 Ga0495601_0087975_794_1474 226
244 3300053078 Ga0495612_0006649 Ga0495612_0006649_3943_4623 226
245 3300053085 Ga0495619_0000020 Ga0495619_0000020_123947_124627 226
246 3300053085 Ga0495619_0171969 Ga0495619_0171969_236_925 226
247 3300054114 Ga0501084_0581773 Ga0501084_0581773_19_726 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

29

207

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g8a-assembly3.cif.gz_C t. thermophilus 16s rrna g527 methyltransferase in complex with adohcy in space group p61 0.9423 43 224
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.9302 9 224
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.9198 15 224
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.887 9 224
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.8794 9 207
ID Description Score Start End Superfamily
af_A0A1D6LW08_103_253_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9369 84 224 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9247 2 224 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.909 2 224 3.40.50.150
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9033 31 119 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.901 61 120 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7G3DVR2-F1-model_v4 deleted 0.949 9 226
AF-A0A023X799-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9476 9 225 GO:0005829
GO:0070043
AF-A0A355FQ94-F1-model_v4 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG 0.9473 71 224 GO:0005829
GO:0070043
AF-A0A1J3EL56-F1-model_v4 Ribosomal RNA small subunit methyltransferase G 0.9469 61 224 GO:0005829
GO:0070043
AF-A0A7V9PMI1-F1-model_v4 Glucose-inhibited division protein B 0.9467 10 167 GO:0005829
GO:0070043

Feature Viewer

pLDDT pTM Quality
91.43 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map