F358847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 247 | 172 | 248 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100304439|Ga0070704_1003044392 |
| Length | 239 |
| Sequence | LSARSRAGIRVSDQARAALEAVLAMLAEDPAAPSAVRDPERAWRVHVADSLTGLEVEALRAARRVADLGAGAGFPGLPVAVARPECRVDLIESVGRKCEFIRGAIQRAGIGNAEVVCGRSESWAAEPPPDGGREGYDAVTARAVGRLSTLAELASPLLVHGGVLVAWKGRRDAEEEAELGRASTRLAMEAEEVRWVGPYAGSRHRHLHVVRKTGPTPANLPRRPGMAKKRPPGAISPRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 93 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 94 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 95 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 96 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 132 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 133 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 134 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 141 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 145 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 146 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 161 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 163 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.24 |
| Nodule | 0 |
| Rhizoplane | 12.96 |
| Rhizosphere | 81.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10135645 | 3300003316 | Unclassified | 1691 |
| 2 | rootH1_10135645 | 3300003323 | Bacteria | 5855 |
| 3 | Ga0070683_100028190 | 3300005329 | Bacteria | 5073 |
| 4 | Ga0070670_100508092 | 3300005331 | Bacteria | 1072 |
| 5 | Ga0070666_10003848 | 3300005335 | Bacteria | 9107 |
| 6 | Ga0070666_10135453 | 3300005335 | Unclassified | 1713 |
| 7 | Ga0070680_100111059 | 3300005336 | Bacteria | 2282 |
| 8 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 9 | Ga0068868_100016667 | 3300005338 | Bacteria | 5463 |
| 10 | Ga0070689_100112301 | 3300005340 | Bacteria | 2169 |
| 11 | Ga0070691_10033839 | 3300005341 | Bacteria | 2405 |
| 12 | Ga0070675_100000015 | 3300005354 | Bacteria | 201080 |
| 13 | Ga0070688_100008093 | 3300005365 | Bacteria | 5694 |
| 14 | Ga0070659_100060046 | 3300005366 | Bacteria | 3003 |
| 15 | Ga0070667_100484117 | 3300005367 | Unclassified | 1133 |
| 16 | Ga0070714_100061733 | 3300005435 | Bacteria | 3220 |
| 17 | Ga0070713_100000014 | 3300005436 | Bacteria | 124804 |
| 18 | Ga0070711_100020732 | 3300005439 | Bacteria | 4240 |
| 19 | Ga0070678_100015997 | 3300005456 | Bacteria | 4782 |
| 20 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 21 | Ga0068867_100000518 | 3300005459 | Bacteria | 25679 |
| 22 | Ga0070685_10000028 | 3300005466 | Bacteria | 90128 |
| 23 | Ga0070685_10069795 | 3300005466 | Bacteria | 2079 |
| 24 | Ga0070679_100000812 | 3300005530 | Bacteria | 27087 |
| 25 | Ga0070684_100005423 | 3300005535 | Bacteria | 9772 |
| 26 | Ga0070684_100091719 | 3300005535 | Bacteria | 2703 |
| 27 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 28 | Ga0070665_100005793 | 3300005548 | Bacteria | 12678 |
| 29 | Ga0070665_100065830 | 3300005548 | Bacteria | 3634 |
| 30 | Ga0070665_100068856 | 3300005548 | Bacteria | 3548 |
| 31 | Ga0070704_100304439 | 3300005549 | Bacteria | 1329 |
| 32 | Ga0070704_100462174 | 3300005549 | Bacteria | 1095 |
| 33 | Ga0068855_100077537 | 3300005563 | Bacteria | 3856 |
| 34 | Ga0068855_100713629 | 3300005563 | Bacteria | 1072 |
| 35 | Ga0068857_100414441 | 3300005577 | Bacteria | 1255 |
| 36 | Ga0068854_100003092 | 3300005578 | Bacteria | 10364 |
| 37 | Ga0068856_100005266 | 3300005614 | Bacteria | 12756 |
| 38 | Ga0068856_100102162 | 3300005614 | Bacteria | 2860 |
| 39 | Ga0068851_10000347 | 3300005834 | Bacteria | 20830 |
| 40 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 41 | Ga0081455_10064359 | 3300005937 | Bacteria | 3070 |
| 42 | Ga0081538_10001487 | 3300005981 | Bacteria | 24067 |
| 43 | Ga0081538_10045876 | 3300005981 | Bacteria | 2703 |
| 44 | Ga0075364_10435494 | 3300006051 | Bacteria | 896 |
| 45 | Ga0075367_10134652 | 3300006178 | Bacteria | 1528 |
| 46 | Ga0075431_100187125 | 3300006847 | Bacteria | 2123 |
| 47 | Ga0075433_10368425 | 3300006852 | Bacteria | 1269 |
| 48 | Ga0075434_100048203 | 3300006871 | Bacteria | 4227 |
| 49 | Ga0068865_100000001 | 3300006881 | Bacteria | 288199 |
| 50 | Ga0075435_100156687 | 3300007076 | Bacteria | 1916 |
| 51 | Ga0105245_10000045 | 3300009098 | Bacteria | 134057 |
| 52 | Ga0105245_10000053 | 3300009098 | Bacteria | 125678 |
| 53 | Ga0105245_10013033 | 3300009098 | Bacteria | 7244 |
| 54 | Ga0105245_10736681 | 3300009098 | Bacteria | 1021 |
| 55 | Ga0105247_10000169 | 3300009101 | Bacteria | 64387 |
| 56 | Ga0114129_10143730 | 3300009147 | Bacteria | 3268 |
| 57 | Ga0105243_10022400 | 3300009148 | Bacteria | 4801 |
| 58 | Ga0105243_10294483 | 3300009148 | Bacteria | 1468 |
| 59 | Ga0105241_10014789 | 3300009174 | Bacteria | 5713 |
| 60 | Ga0105242_10000017 | 3300009176 | Bacteria | 122190 |
| 61 | Ga0105248_10000089 | 3300009177 | Bacteria | 102101 |
| 62 | Ga0105248_10826342 | 3300009177 | Bacteria | 1046 |
| 63 | Ga0105238_10000240 | 3300009551 | Bacteria | 61138 |
| 64 | Ga0105238_10207294 | 3300009551 | Unclassified | 1936 |
| 65 | Ga0105249_10030142 | 3300009553 | Bacteria | 4902 |
| 66 | Ga0105239_10230867 | 3300010375 | Bacteria | 2076 |
| 67 | Ga0157370_10010841 | 3300013104 | Bacteria | 9573 |
| 68 | Ga0157369_10000037 | 3300013105 | Bacteria | 190395 |
| 69 | Ga0157374_10001263 | 3300013296 | Bacteria | 21606 |
| 70 | Ga0157378_10012832 | 3300013297 | Bacteria | 7334 |
| 71 | Ga0157372_10000064 | 3300013307 | Bacteria | 114648 |
| 72 | Ga0157375_10120375 | 3300013308 | Bacteria | 2734 |
| 73 | Ga0163161_10030305 | 3300017792 | Bacteria | 3849 |
| 74 | Ga0207656_10000168 | 3300025321 | Bacteria | 24193 |
| 75 | Ga0207682_10000047 | 3300025893 | Bacteria | 51208 |
| 76 | Ga0207710_10000103 | 3300025900 | Bacteria | 109033 |
| 77 | Ga0207710_10051265 | 3300025900 | Bacteria | 1853 |
| 78 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 79 | Ga0207705_10234681 | 3300025909 | Bacteria | 1396 |
| 80 | Ga0207660_10088593 | 3300025917 | Bacteria | 2289 |
| 81 | Ga0207652_10000544 | 3300025921 | Bacteria | 38182 |
| 82 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 83 | Ga0207659_10000032 | 3300025926 | Bacteria | 119492 |
| 84 | Ga0207687_10000023 | 3300025927 | Bacteria | 217098 |
| 85 | Ga0207687_10372572 | 3300025927 | Bacteria | 1168 |
| 86 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 87 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 88 | Ga0207686_10000016 | 3300025934 | Bacteria | 198779 |
| 89 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 90 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 91 | Ga0207711_10000083 | 3300025941 | Bacteria | 102109 |
| 92 | Ga0207661_10001101 | 3300025944 | Bacteria | 17973 |
| 93 | Ga0207712_10085005 | 3300025961 | Bacteria | 2314 |
| 94 | Ga0207668_10008762 | 3300025972 | Bacteria | 6046 |
| 95 | Ga0207640_10001945 | 3300025981 | Bacteria | 11120 |
| 96 | Ga0207640_10032925 | 3300025981 | Bacteria | 3218 |
| 97 | Ga0207658_10058158 | 3300025986 | Bacteria | 2876 |
| 98 | Ga0207677_10000444 | 3300026023 | Bacteria | 28037 |
| 99 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 100 | Ga0207639_10134607 | 3300026041 | Bacteria | 2050 |
| 101 | Ga0207639_10270737 | 3300026041 | Unclassified | 1490 |
| 102 | Ga0207702_10002492 | 3300026078 | Bacteria | 17387 |
| 103 | Ga0207702_10011005 | 3300026078 | Bacteria | 7547 |
| 104 | Ga0207648_10002078 | 3300026089 | Bacteria | 21809 |
| 105 | Ga0207674_10197990 | 3300026116 | Bacteria | 1959 |
| 106 | Ga0207683_10028894 | 3300026121 | Bacteria | 4798 |
| 107 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 108 | Ga0268266_10001671 | 3300028379 | Bacteria | 25564 |
| 109 | Ga0268266_10066296 | 3300028379 | Bacteria | 3122 |
| 110 | Ga0265319_1000044 | 3300028563 | Bacteria | 103641 |
| 111 | Ga0265338_10000297 | 3300028800 | Bacteria | 89764 |
| 112 | Ga0265331_10095273 | 3300031250 | Bacteria | 1373 |
| 113 | Ga0395899_0012847 | 3300037312 | Bacteria | 6413 |
| 114 | Ga0395900_0007709 | 3300037418 | Bacteria | 11102 |
| 115 | Ga0395900_0097421 | 3300037418 | Bacteria | 3022 |
| 116 | Ga0395900_0277285 | 3300037418 | Bacteria | 1670 |
| 117 | Ga0395898_0477685 | 3300037466 | Bacteria | 1186 |
| 118 | Ga0395898_0583683 | 3300037466 | Bacteria | 1060 |
| 119 | Ga0395898_0610689 | 3300037466 | Bacteria | 1033 |
| 120 | Ga0395901_0011178 | 3300038443 | Bacteria | 9097 |
| 121 | Ga0395901_0347712 | 3300038443 | Bacteria | 1531 |
| 122 | Ga0451839_0199833 | 3300041496 | Bacteria | 1264 |
| 123 | Ga0451853_1584584 | 3300041512 | Bacteria | 2441 |
| 124 | Ga0451853_2291948 | 3300041512 | Bacteria | 1321 |
| 125 | Ga0466963_0000027 | 3300044694 | Bacteria | 48596 |
| 126 | Ga0466957_0004382 | 3300044842 | Bacteria | 7852 |
| 127 | Ga0495592_0000518 | 3300046454 | Bacteria | 27890 |
| 128 | Ga0495603_0001096 | 3300046455 | Bacteria | 15726 |
| 129 | Ga0495603_0037976 | 3300046455 | Bacteria | 2889 |
| 130 | Ga0495629_0043157 | 3300046459 | Bacteria | 3167 |
| 131 | Ga0495641_0018300 | 3300046461 | Bacteria | 3619 |
| 132 | Ga0495641_0086183 | 3300046461 | Bacteria | 1406 |
| 133 | Ga0495653_0032301 | 3300046463 | Bacteria | 4158 |
| 134 | Ga0495582_0000012 | 3300046473 | Bacteria | 112893 |
| 135 | Ga0495606_0000045 | 3300046507 | Bacteria | 212105 |
| 136 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 137 | Ga0495608_0004473 | 3300046511 | Bacteria | 9988 |
| 138 | Ga0495618_0000068 | 3300046514 | Bacteria | 74614 |
| 139 | Ga0495618_0159466 | 3300046514 | Bacteria | 1439 |
| 140 | Ga0495620_0000428 | 3300046515 | Bacteria | 28031 |
| 141 | Ga0495628_0081694 | 3300046516 | Bacteria | 2510 |
| 142 | Ga0495628_0106116 | 3300046516 | Bacteria | 2163 |
| 143 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 144 | Ga0495630_0013070 | 3300046517 | Bacteria | 6035 |
| 145 | Ga0495644_0000296 | 3300046523 | Bacteria | 23051 |
| 146 | Ga0495586_0003174 | 3300046535 | Bacteria | 8840 |
| 147 | Ga0495586_0468008 | 3300046535 | Bacteria | 727 |
| 148 | Ga0495587_0030486 | 3300046536 | Bacteria | 3270 |
| 149 | Ga0495621_0019960 | 3300046539 | Bacteria | 2194 |
| 150 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 151 | Ga0495647_0000013 | 3300046681 | Bacteria | 88029 |
| 152 | Ga0495647_0000059 | 3300046681 | Bacteria | 27437 |
| 153 | Ga0495647_0010331 | 3300046681 | Bacteria | 3177 |
| 154 | Ga0495658_0000024 | 3300046683 | Bacteria | 81300 |
| 155 | Ga0495669_0151392 | 3300046684 | Bacteria | 1098 |
| 156 | Ga0495613_0000159 | 3300046689 | Bacteria | 65969 |
| 157 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 158 | Ga0495624_0001178 | 3300046690 | Bacteria | 20710 |
| 159 | Ga0495624_0055104 | 3300046690 | Bacteria | 2506 |
| 160 | Ga0495670_0023653 | 3300046691 | Bacteria | 3032 |
| 161 | Ga0495600_0003198 | 3300046809 | Bacteria | 9590 |
| 162 | Ga0495600_0438827 | 3300046809 | Bacteria | 809 |
| 163 | Ga0495660_0193036 | 3300046810 | Unclassified | 977 |
| 164 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 165 | Ga0495672_0126325 | 3300047320 | Bacteria | 1352 |
| 166 | Ga0495676_0000091 | 3300047321 | Bacteria | 66575 |
| 167 | Ga0495676_0075994 | 3300047321 | Bacteria | 2566 |
| 168 | Ga0495676_0078380 | 3300047321 | Bacteria | 2516 |
| 169 | Ga0495676_0296596 | 3300047321 | Bacteria | 1091 |
| 170 | Ga0495680_0003127 | 3300047322 | Bacteria | 16492 |
| 171 | Ga0495673_0069290 | 3300047469 | Bacteria | 1488 |
| 172 | Ga0495686_0075173 | 3300047472 | Bacteria | 2072 |
| 173 | Ga0495593_0014096 | 3300047673 | Bacteria | 4550 |
| 174 | Ga0495593_0085652 | 3300047673 | Bacteria | 1626 |
| 175 | Ga0495602_0127560 | 3300048088 | Bacteria | 2035 |
| 176 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 177 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 178 | Ga0496102_0000054 | 3300048905 | Bacteria | 175565 |
| 179 | Ga0496102_0485064 | 3300048905 | Bacteria | 1158 |
| 180 | Ga0496102_0620175 | 3300048905 | Bacteria | 1005 |
| 181 | Ga0496103_0000079 | 3300048906 | Bacteria | 110624 |
| 182 | Ga0496104_0000063 | 3300048907 | Bacteria | 116618 |
| 183 | Ga0496104_0001123 | 3300048907 | Bacteria | 22922 |
| 184 | Ga0496104_0434679 | 3300048907 | Bacteria | 1224 |
| 185 | Ga0496105_0000041 | 3300048908 | Bacteria | 116618 |
| 186 | Ga0496105_0000209 | 3300048908 | Bacteria | 39293 |
| 187 | Ga0496105_0046303 | 3300048908 | Bacteria | 3590 |
| 188 | Ga0496106_0000048 | 3300048909 | Bacteria | 98233 |
| 189 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 190 | Ga0496107_0200299 | 3300048910 | Bacteria | 1484 |
| 191 | Ga0496108_0000024 | 3300048911 | Bacteria | 183389 |
| 192 | Ga0496109_0000033 | 3300048912 | Bacteria | 160496 |
| 193 | Ga0496109_0421284 | 3300048912 | Bacteria | 1261 |
| 194 | Ga0496110_0004903 | 3300048913 | Bacteria | 10440 |
| 195 | Ga0496110_0054047 | 3300048913 | Bacteria | 3532 |
| 196 | Ga0496110_0457437 | 3300048913 | Bacteria | 1163 |
| 197 | Ga0496110_0562729 | 3300048913 | Unclassified | 1036 |
| 198 | Ga0496111_0000004 | 3300048914 | Bacteria | 116115 |
| 199 | Ga0496111_0003219 | 3300048914 | Bacteria | 10075 |
| 200 | Ga0496111_0498675 | 3300048914 | Bacteria | 896 |
| 201 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 202 | Ga0496112_0007130 | 3300048915 | Bacteria | 9891 |
| 203 | Ga0496112_0325199 | 3300048915 | Bacteria | 1482 |
| 204 | Ga0496113_0000030 | 3300048916 | Bacteria | 60123 |
| 205 | Ga0496113_0121526 | 3300048916 | Bacteria | 2042 |
| 206 | Ga0496114_0014927 | 3300048917 | Bacteria | 6244 |
| 207 | Ga0496114_0107890 | 3300048917 | Bacteria | 2383 |
| 208 | Ga0496119_0003689 | 3300048922 | Bacteria | 15697 |
| 209 | Ga0496124_0188102 | 3300048927 | Unclassified | 1583 |
| 210 | Ga0501032_0123381 | 3300049569 | Unclassified | 1712 |
| 211 | Ga0501034_0012153 | 3300049571 | Bacteria | 8901 |
| 212 | Ga0501034_0903320 | 3300049571 | Unclassified | 771 |
| 213 | Ga0501039_0584694 | 3300049575 | Bacteria | 875 |
| 214 | Ga0501047_0602860 | 3300049581 | Bacteria | 920 |
| 215 | Ga0501048_0234222 | 3300049582 | Unclassified | 1303 |
| 216 | Ga0501067_0068392 | 3300049583 | Bacteria | 1966 |
| 217 | Ga0501068_0202879 | 3300049584 | Bacteria | 1258 |
| 218 | Ga0501068_0604147 | 3300049584 | Bacteria | 715 |
| 219 | Ga0501070_0132837 | 3300049586 | Bacteria | 2056 |
| 220 | Ga0501072_0039921 | 3300049588 | Bacteria | 3685 |
| 221 | Ga0501072_0091921 | 3300049588 | Bacteria | 2409 |
| 222 | Ga0501074_0073342 | 3300049590 | Bacteria | 2459 |
| 223 | Ga0501074_0435849 | 3300049590 | Bacteria | 929 |
| 224 | Ga0501075_0033971 | 3300049591 | Bacteria | 3796 |
| 225 | Ga0501076_0175067 | 3300049592 | Bacteria | 1749 |
| 226 | Ga0501076_0238283 | 3300049592 | Bacteria | 1488 |
| 227 | Ga0501076_0285959 | 3300049592 | Bacteria | 1351 |
| 228 | Ga0501081_0045811 | 3300049743 | Bacteria | 3004 |
| 229 | Ga0501081_0332852 | 3300049743 | Unclassified | 1117 |
| 230 | Ga0501044_0093001 | 3300049823 | Bacteria | 3041 |
| 231 | nmdc:mga03n38_42944_c1 | 3300050490 | Bacteria | 1979 |
| 232 | nmdc:mga00v17_235187_c1 | 3300050491 | Bacteria | 1187 |
| 233 | nmdc:mga00v17_461099_c1 | 3300050491 | Bacteria | 825 |
| 234 | nmdc:mga0yw44_106680_c1 | 3300050492 | Bacteria | 1791 |
| 235 | nmdc:mga0yw44_91951_c1 | 3300050492 | Bacteria | 1919 |
| 236 | nmdc:mga06z11_81203_c1 | 3300050494 | Bacteria | 1740 |
| 237 | nmdc:mga05p37_111317_c1 | 3300050507 | Bacteria | 3367 |
| 238 | nmdc:mga06r32_372403_c1 | 3300050510 | Unclassified | 1411 |
| 239 | nmdc:mga0n895_354165_c1 | 3300050512 | Bacteria | 1487 |
| 240 | nmdc:mga0rr50_269658_c1 | 3300050513 | Bacteria | 1418 |
| 241 | nmdc:mga0a205_133798_c1 | 3300050515 | Bacteria | 2380 |
| 242 | nmdc:mga0a205_9_c1 | 3300050515 | Bacteria | 55726 |
| 243 | Ga0495601_0009675 | 3300053077 | Bacteria | 5705 |
| 244 | Ga0495601_0087975 | 3300053077 | Bacteria | 1997 |
| 245 | Ga0495612_0006649 | 3300053078 | Bacteria | 4742 |
| 246 | Ga0495619_0000020 | 3300053085 | Bacteria | 201556 |
| 247 | Ga0495619_0171969 | 3300053085 | Bacteria | 1498 |
| 248 | Ga0501084_0581773 | 3300054114 | Bacteria | 946 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0438827 | Ga0495600_0438827_75_638 | 185 |
| 2 | 3300046684 | Ga0495669_0151392 | Ga0495669_0151392_75_659 | 193 |
| 3 | 3300048917 | Ga0496114_0014927 | Ga0496114_0014927_5637_6221 | 193 |
| 4 | 3300049571 | Ga0501034_0903320 | Ga0501034_0903320_85_666 | 193 |
| 5 | 3300049584 | Ga0501068_0604147 | Ga0501068_0604147_24_605 | 193 |
| 6 | 3300005535 | Ga0070684_100091719 | Ga0070684_1000917194 | 194 |
| 7 | 3300046454 | Ga0495592_0000518 | Ga0495592_0000518_20594_21217 | 196 |
| 8 | 3300046690 | Ga0495624_0001178 | Ga0495624_0001178_19481_20161 | 199 |
| 9 | 3300005563 | Ga0068855_100713629 | Ga0068855_1007136291 | 203 |
| 10 | 3300041496 | Ga0451839_0199833 | Ga0451839_0199833_507_1133 | 203 |
| 11 | 3300041512 | Ga0451853_1584584 | Ga0451853_1584584_239_865 | 203 |
| 12 | 3300049592 | Ga0501076_0175067 | Ga0501076_0175067_41_652 | 203 |
| 13 | 3300025961 | Ga0207712_10085005 | Ga0207712_100850053 | 204 |
| 14 | 3300050515 | nmdc:mga0a205_9_c1 | nmdc:mga0a205_9_c1_39478_40095 | 204 |
| 15 | 3300050492 | nmdc:mga0yw44_106680_c1 | nmdc:mga0yw44_106680_c1_358_1065 | 205 |
| 16 | 3300005336 | Ga0070680_100111059 | Ga0070680_1001110591 | 206 |
| 17 | 3300005530 | Ga0070679_100000812 | Ga0070679_10000081212 | 206 |
| 18 | 3300046455 | Ga0495603_0037976 | Ga0495603_0037976_2170_2793 | 206 |
| 19 | 3300046473 | Ga0495582_0000012 | Ga0495582_0000012_99566_100189 | 206 |
| 20 | 3300046514 | Ga0495618_0000068 | Ga0495618_0000068_8212_8835 | 206 |
| 21 | 3300046517 | Ga0495630_0013070 | Ga0495630_0013070_745_1368 | 206 |
| 22 | 3300046535 | Ga0495586_0468008 | Ga0495586_0468008_48_671 | 206 |
| 23 | 3300046539 | Ga0495621_0019960 | Ga0495621_0019960_700_1323 | 206 |
| 24 | 3300046681 | Ga0495647_0010331 | Ga0495647_0010331_1889_2512 | 206 |
| 25 | 3300046683 | Ga0495658_0000024 | Ga0495658_0000024_12716_13339 | 206 |
| 26 | 3300046689 | Ga0495613_0000159 | Ga0495613_0000159_21040_21663 | 206 |
| 27 | 3300046809 | Ga0495600_0003198 | Ga0495600_0003198_8231_8854 | 206 |
| 28 | 3300048905 | Ga0496102_0620175 | Ga0496102_0620175_326_949 | 206 |
| 29 | 3300048916 | Ga0496113_0121526 | Ga0496113_0121526_661_1284 | 206 |
| 30 | 3300047321 | Ga0495676_0296596 | Ga0495676_0296596_289_915 | 207 |
| 31 | 3300048907 | Ga0496104_0434679 | Ga0496104_0434679_172_822 | 207 |
| 32 | 3300048908 | Ga0496105_0046303 | Ga0496105_0046303_2702_3352 | 207 |
| 33 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_706545_707171 | 207 |
| 34 | 3300049569 | Ga0501032_0123381 | Ga0501032_0123381_990_1622 | 207 |
| 35 | 3300049571 | Ga0501034_0012153 | Ga0501034_0012153_6790_7422 | 207 |
| 36 | 3300049581 | Ga0501047_0602860 | Ga0501047_0602860_71_703 | 207 |
| 37 | 3300049823 | Ga0501044_0093001 | Ga0501044_0093001_1084_1716 | 207 |
| 38 | 3300005614 | Ga0068856_100102162 | Ga0068856_1001021625 | 209 |
| 39 | 3300026078 | Ga0207702_10011005 | Ga0207702_1001100510 | 209 |
| 40 | 3300006852 | Ga0075433_10368425 | Ga0075433_103684252 | 210 |
| 41 | 3300007076 | Ga0075435_100156687 | Ga0075435_1001566873 | 210 |
| 42 | 3300037312 | Ga0395899_0012847 | Ga0395899_0012847_4487_5137 | 210 |
| 43 | 3300037418 | Ga0395900_0007709 | Ga0395900_0007709_1738_2388 | 210 |
| 44 | 3300038443 | Ga0395901_0011178 | Ga0395901_0011178_6763_7413 | 210 |
| 45 | 3300046514 | Ga0495618_0159466 | Ga0495618_0159466_40_672 | 210 |
| 46 | 3300048905 | Ga0496102_0485064 | Ga0496102_0485064_271_927 | 210 |
| 47 | 3300049590 | Ga0501074_0435849 | Ga0501074_0435849_122_754 | 210 |
| 48 | 3300050512 | nmdc:mga0n895_354165_c1 | nmdc:mga0n895_354165_c1_427_1083 | 210 |
| 49 | 3300050513 | nmdc:mga0rr50_269658_c1 | nmdc:mga0rr50_269658_c1_671_1327 | 210 |
| 50 | 3300050515 | nmdc:mga0a205_133798_c1 | nmdc:mga0a205_133798_c1_564_1220 | 210 |
| 51 | 3300006847 | Ga0075431_100187125 | Ga0075431_1001871251 | 211 |
| 52 | 3300048913 | Ga0496110_0004903 | Ga0496110_0004903_9595_10275 | 211 |
| 53 | 3300048914 | Ga0496111_0000004 | Ga0496111_0000004_71244_71924 | 211 |
| 54 | 3300050510 | nmdc:mga06r32_372403_c1 | nmdc:mga06r32_372403_c1_25_699 | 211 |
| 55 | 3300009148 | Ga0105243_10294483 | Ga0105243_102944832 | 212 |
| 56 | 3300048917 | Ga0496114_0107890 | Ga0496114_0107890_194_874 | 213 |
| 57 | 3300049590 | Ga0501074_0073342 | Ga0501074_0073342_589_1296 | 213 |
| 58 | 3300049575 | Ga0501039_0584694 | Ga0501039_0584694_83_772 | 215 |
| 59 | 3300049582 | Ga0501048_0234222 | Ga0501048_0234222_13_702 | 215 |
| 60 | 3300049584 | Ga0501068_0202879 | Ga0501068_0202879_173_862 | 215 |
| 61 | 3300049588 | Ga0501072_0039921 | Ga0501072_0039921_49_738 | 215 |
| 62 | 3300049592 | Ga0501076_0238283 | Ga0501076_0238283_414_1103 | 215 |
| 63 | 3300046681 | Ga0495647_0000013 | Ga0495647_0000013_53243_53953 | 216 |
| 64 | 3300037418 | Ga0395900_0097421 | Ga0395900_0097421_1734_2411 | 217 |
| 65 | 3300038443 | Ga0395901_0347712 | Ga0395901_0347712_142_819 | 217 |
| 66 | 3300005329 | Ga0070683_100028190 | Ga0070683_1000281908 | 219 |
| 67 | 3300005354 | Ga0070675_100000015 | Ga0070675_10000001527 | 219 |
| 68 | 3300005535 | Ga0070684_100005423 | Ga0070684_1000054234 | 219 |
| 69 | 3300005548 | Ga0070665_100000120 | Ga0070665_10000012060 | 219 |
| 70 | 3300005577 | Ga0068857_100414441 | Ga0068857_1004144412 | 219 |
| 71 | 3300005842 | Ga0068858_100000035 | Ga0068858_10000003558 | 219 |
| 72 | 3300013297 | Ga0157378_10012832 | Ga0157378_100128327 | 219 |
| 73 | 3300025926 | Ga0207659_10000032 | Ga0207659_100000326 | 219 |
| 74 | 3300025927 | Ga0207687_10372572 | Ga0207687_103725722 | 219 |
| 75 | 3300025944 | Ga0207661_10001101 | Ga0207661_1000110117 | 219 |
| 76 | 3300026035 | Ga0207703_10000067 | Ga0207703_1000006791 | 219 |
| 77 | 3300026116 | Ga0207674_10197990 | Ga0207674_101979902 | 219 |
| 78 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023420 | 219 |
| 79 | 3300047321 | Ga0495676_0075994 | Ga0495676_0075994_15_674 | 219 |
| 80 | 3300048915 | Ga0496112_0325199 | Ga0496112_0325199_239_928 | 219 |
| 81 | 3300009101 | Ga0105247_10000169 | Ga0105247_1000016922 | 220 |
| 82 | 3300037418 | Ga0395900_0277285 | Ga0395900_0277285_627_1304 | 220 |
| 83 | 3300037466 | Ga0395898_0477685 | Ga0395898_0477685_107_784 | 220 |
| 84 | 3300037466 | Ga0395898_0583683 | Ga0395898_0583683_365_1042 | 220 |
| 85 | 3300037466 | Ga0395898_0610689 | Ga0395898_0610689_169_846 | 220 |
| 86 | 3300047321 | Ga0495676_0078380 | Ga0495676_0078380_13_723 | 221 |
| 87 | 3300048912 | Ga0496109_0421284 | Ga0496109_0421284_291_971 | 221 |
| 88 | 3300048914 | Ga0496111_0003219 | Ga0496111_0003219_5296_5976 | 221 |
| 89 | 3300049583 | Ga0501067_0068392 | Ga0501067_0068392_710_1387 | 221 |
| 90 | 3300046523 | Ga0495644_0000296 | Ga0495644_0000296_1496_2176 | 223 |
| 91 | 3300050492 | nmdc:mga0yw44_91951_c1 | nmdc:mga0yw44_91951_c1_31_714 | 223 |
| 92 | 3300005981 | Ga0081538_10001487 | Ga0081538_1000148722 | 224 |
| 93 | 3300046455 | Ga0495603_0001096 | Ga0495603_0001096_14598_15275 | 224 |
| 94 | 3300049586 | Ga0501070_0132837 | Ga0501070_0132837_649_1338 | 224 |
| 95 | 3300048088 | Ga0495602_0127560 | Ga0495602_0127560_1226_1915 | 225 |
| 96 | 3300003316 | rootH1_10135645 | rootH1_101356452 | 226 |
| 97 | 3300005331 | Ga0070670_100508092 | Ga0070670_1005080922 | 226 |
| 98 | 3300005335 | Ga0070666_10003848 | Ga0070666_1000384810 | 226 |
| 99 | 3300005335 | Ga0070666_10135453 | Ga0070666_101354532 | 226 |
| 100 | 3300005337 | Ga0070682_100000029 | Ga0070682_100000029115 | 226 |
| 101 | 3300005338 | Ga0068868_100016667 | Ga0068868_1000166677 | 226 |
| 102 | 3300005340 | Ga0070689_100112301 | Ga0070689_1001123012 | 226 |
| 103 | 3300005341 | Ga0070691_10033839 | Ga0070691_100338393 | 226 |
| 104 | 3300005365 | Ga0070688_100008093 | Ga0070688_1000080932 | 226 |
| 105 | 3300005366 | Ga0070659_100060046 | Ga0070659_1000600463 | 226 |
| 106 | 3300005367 | Ga0070667_100484117 | Ga0070667_1004841172 | 226 |
| 107 | 3300005435 | Ga0070714_100061733 | Ga0070714_1000617333 | 226 |
| 108 | 3300005436 | Ga0070713_100000014 | Ga0070713_10000001426 | 226 |
| 109 | 3300005439 | Ga0070711_100020732 | Ga0070711_1000207325 | 226 |
| 110 | 3300005456 | Ga0070678_100015997 | Ga0070678_1000159975 | 226 |
| 111 | 3300005457 | Ga0070662_100000008 | Ga0070662_100000008146 | 226 |
| 112 | 3300005459 | Ga0068867_100000518 | Ga0068867_10000051820 | 226 |
| 113 | 3300005466 | Ga0070685_10000028 | Ga0070685_1000002820 | 226 |
| 114 | 3300005466 | Ga0070685_10069795 | Ga0070685_100697952 | 226 |
| 115 | 3300005548 | Ga0070665_100005793 | Ga0070665_1000057938 | 226 |
| 116 | 3300005548 | Ga0070665_100065830 | Ga0070665_1000658305 | 226 |
| 117 | 3300005548 | Ga0070665_100068856 | Ga0070665_1000688566 | 226 |
| 118 | 3300005549 | Ga0070704_100304439 | Ga0070704_1003044392 | 226 |
| 119 | 3300005549 | Ga0070704_100462174 | Ga0070704_1004621741 | 226 |
| 120 | 3300005563 | Ga0068855_100077537 | Ga0068855_1000775373 | 226 |
| 121 | 3300005578 | Ga0068854_100003092 | Ga0068854_1000030922 | 226 |
| 122 | 3300005614 | Ga0068856_100005266 | Ga0068856_10000526613 | 226 |
| 123 | 3300005834 | Ga0068851_10000347 | Ga0068851_100003479 | 226 |
| 124 | 3300005937 | Ga0081455_10064359 | Ga0081455_100643592 | 226 |
| 125 | 3300005981 | Ga0081538_10045876 | Ga0081538_100458763 | 226 |
| 126 | 3300006051 | Ga0075364_10435494 | Ga0075364_104354942 | 226 |
| 127 | 3300006178 | Ga0075367_10134652 | Ga0075367_101346522 | 226 |
| 128 | 3300006871 | Ga0075434_100048203 | Ga0075434_1000482035 | 226 |
| 129 | 3300006881 | Ga0068865_100000001 | Ga0068865_100000001254 | 226 |
| 130 | 3300009098 | Ga0105245_10000045 | Ga0105245_1000004561 | 226 |
| 131 | 3300009098 | Ga0105245_10000053 | Ga0105245_1000005312 | 226 |
| 132 | 3300009098 | Ga0105245_10013033 | Ga0105245_100130339 | 226 |
| 133 | 3300009098 | Ga0105245_10736681 | Ga0105245_107366812 | 226 |
| 134 | 3300009147 | Ga0114129_10143730 | Ga0114129_101437303 | 226 |
| 135 | 3300009148 | Ga0105243_10022400 | Ga0105243_100224007 | 226 |
| 136 | 3300009174 | Ga0105241_10014789 | Ga0105241_100147898 | 226 |
| 137 | 3300009176 | Ga0105242_10000017 | Ga0105242_1000001711 | 226 |
| 138 | 3300009177 | Ga0105248_10000089 | Ga0105248_1000008928 | 226 |
| 139 | 3300009177 | Ga0105248_10826342 | Ga0105248_108263422 | 226 |
| 140 | 3300009551 | Ga0105238_10000240 | Ga0105238_100002403 | 226 |
| 141 | 3300009551 | Ga0105238_10207294 | Ga0105238_102072943 | 226 |
| 142 | 3300009553 | Ga0105249_10030142 | Ga0105249_100301426 | 226 |
| 143 | 3300010375 | Ga0105239_10230867 | Ga0105239_102308673 | 226 |
| 144 | 3300013104 | Ga0157370_10010841 | Ga0157370_1001084110 | 226 |
| 145 | 3300013105 | Ga0157369_10000037 | Ga0157369_1000003770 | 226 |
| 146 | 3300013296 | Ga0157374_10001263 | Ga0157374_100012634 | 226 |
| 147 | 3300013307 | Ga0157372_10000064 | Ga0157372_1000006445 | 226 |
| 148 | 3300013308 | Ga0157375_10120375 | Ga0157375_101203753 | 226 |
| 149 | 3300017792 | Ga0163161_10030305 | Ga0163161_100303056 | 226 |
| 150 | 3300025321 | Ga0207656_10000168 | Ga0207656_1000016822 | 226 |
| 151 | 3300025893 | Ga0207682_10000047 | Ga0207682_1000004733 | 226 |
| 152 | 3300025900 | Ga0207710_10000103 | Ga0207710_1000010345 | 226 |
| 153 | 3300025900 | Ga0207710_10051265 | Ga0207710_100512652 | 226 |
| 154 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001379 | 226 |
| 155 | 3300025909 | Ga0207705_10234681 | Ga0207705_102346812 | 226 |
| 156 | 3300025917 | Ga0207660_10088593 | Ga0207660_100885932 | 226 |
| 157 | 3300025921 | Ga0207652_10000544 | Ga0207652_1000054430 | 226 |
| 158 | 3300025924 | Ga0207694_10000067 | Ga0207694_1000006767 | 226 |
| 159 | 3300025927 | Ga0207687_10000023 | Ga0207687_1000002361 | 226 |
| 160 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009101 | 226 |
| 161 | 3300025933 | Ga0207706_10000016 | Ga0207706_1000001629 | 226 |
| 162 | 3300025934 | Ga0207686_10000016 | Ga0207686_1000001610 | 226 |
| 163 | 3300025934 | Ga0207686_10000029 | Ga0207686_10000029145 | 226 |
| 164 | 3300025938 | Ga0207704_10000004 | Ga0207704_1000000441 | 226 |
| 165 | 3300025941 | Ga0207711_10000083 | Ga0207711_1000008328 | 226 |
| 166 | 3300025972 | Ga0207668_10008762 | Ga0207668_100087625 | 226 |
| 167 | 3300025981 | Ga0207640_10001945 | Ga0207640_100019454 | 226 |
| 168 | 3300025981 | Ga0207640_10032925 | Ga0207640_100329252 | 226 |
| 169 | 3300025986 | Ga0207658_10058158 | Ga0207658_100581584 | 226 |
| 170 | 3300026023 | Ga0207677_10000444 | Ga0207677_100004445 | 226 |
| 171 | 3300026041 | Ga0207639_10134607 | Ga0207639_101346073 | 226 |
| 172 | 3300026041 | Ga0207639_10270737 | Ga0207639_102707372 | 226 |
| 173 | 3300026078 | Ga0207702_10002492 | Ga0207702_1000249213 | 226 |
| 174 | 3300026089 | Ga0207648_10002078 | Ga0207648_100020783 | 226 |
| 175 | 3300026121 | Ga0207683_10028894 | Ga0207683_100288945 | 226 |
| 176 | 3300028379 | Ga0268266_10001671 | Ga0268266_1000167111 | 226 |
| 177 | 3300028379 | Ga0268266_10066296 | Ga0268266_100662963 | 226 |
| 178 | 3300028563 | Ga0265319_1000044 | Ga0265319_100004431 | 226 |
| 179 | 3300028800 | Ga0265338_10000297 | Ga0265338_1000029731 | 226 |
| 180 | 3300031250 | Ga0265331_10095273 | Ga0265331_100952732 | 226 |
| 181 | 3300041512 | Ga0451853_2291948 | Ga0451853_2291948_549_1247 | 226 |
| 182 | 3300044694 | Ga0466963_0000027 | Ga0466963_0000027_37334_38053 | 226 |
| 183 | 3300044842 | Ga0466957_0004382 | Ga0466957_0004382_366_1046 | 226 |
| 184 | 3300046459 | Ga0495629_0043157 | Ga0495629_0043157_606_1286 | 226 |
| 185 | 3300046461 | Ga0495641_0018300 | Ga0495641_0018300_991_1671 | 226 |
| 186 | 3300046461 | Ga0495641_0086183 | Ga0495641_0086183_659_1369 | 226 |
| 187 | 3300046463 | Ga0495653_0032301 | Ga0495653_0032301_2629_3336 | 226 |
| 188 | 3300046507 | Ga0495606_0000045 | Ga0495606_0000045_164113_164793 | 226 |
| 189 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_110621_111301 | 226 |
| 190 | 3300046511 | Ga0495608_0004473 | Ga0495608_0004473_829_1539 | 226 |
| 191 | 3300046515 | Ga0495620_0000428 | Ga0495620_0000428_11421_12137 | 226 |
| 192 | 3300046516 | Ga0495628_0081694 | Ga0495628_0081694_1723_2433 | 226 |
| 193 | 3300046516 | Ga0495628_0106116 | Ga0495628_0106116_1296_1976 | 226 |
| 194 | 3300046517 | Ga0495630_0000007 | Ga0495630_0000007_362044_362724 | 226 |
| 195 | 3300046535 | Ga0495586_0003174 | Ga0495586_0003174_7444_8154 | 226 |
| 196 | 3300046536 | Ga0495587_0030486 | Ga0495587_0030486_878_1561 | 226 |
| 197 | 3300046559 | Ga0495667_0000015 | Ga0495667_0000015_141418_142101 | 226 |
| 198 | 3300046681 | Ga0495647_0000059 | Ga0495647_0000059_9886_10566 | 226 |
| 199 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_59878_60588 | 226 |
| 200 | 3300046690 | Ga0495624_0055104 | Ga0495624_0055104_1766_2476 | 226 |
| 201 | 3300046691 | Ga0495670_0023653 | Ga0495670_0023653_2238_2921 | 226 |
| 202 | 3300046810 | Ga0495660_0193036 | Ga0495660_0193036_106_786 | 226 |
| 203 | 3300047317 | Ga0495604_0000033 | Ga0495604_0000033_92_775 | 226 |
| 204 | 3300047320 | Ga0495672_0126325 | Ga0495672_0126325_38_718 | 226 |
| 205 | 3300047321 | Ga0495676_0000091 | Ga0495676_0000091_45627_46337 | 226 |
| 206 | 3300047322 | Ga0495680_0003127 | Ga0495680_0003127_11202_11885 | 226 |
| 207 | 3300047469 | Ga0495673_0069290 | Ga0495673_0069290_217_927 | 226 |
| 208 | 3300047472 | Ga0495686_0075173 | Ga0495686_0075173_77_757 | 226 |
| 209 | 3300047673 | Ga0495593_0014096 | Ga0495593_0014096_408_1088 | 226 |
| 210 | 3300047673 | Ga0495593_0085652 | Ga0495593_0085652_778_1488 | 226 |
| 211 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_319257_319973 | 226 |
| 212 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_319257_319973 | 226 |
| 213 | 3300048905 | Ga0496102_0000054 | Ga0496102_0000054_101195_101875 | 226 |
| 214 | 3300048906 | Ga0496103_0000079 | Ga0496103_0000079_8763_9443 | 226 |
| 215 | 3300048907 | Ga0496104_0000063 | Ga0496104_0000063_58053_58733 | 226 |
| 216 | 3300048907 | Ga0496104_0001123 | Ga0496104_0001123_11705_12385 | 226 |
| 217 | 3300048908 | Ga0496105_0000041 | Ga0496105_0000041_57886_58566 | 226 |
| 218 | 3300048908 | Ga0496105_0000209 | Ga0496105_0000209_32923_33603 | 226 |
| 219 | 3300048909 | Ga0496106_0000048 | Ga0496106_0000048_40833_41549 | 226 |
| 220 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_210317_211033 | 226 |
| 221 | 3300048910 | Ga0496107_0200299 | Ga0496107_0200299_93_776 | 226 |
| 222 | 3300048911 | Ga0496108_0000024 | Ga0496108_0000024_110897_111577 | 226 |
| 223 | 3300048912 | Ga0496109_0000033 | Ga0496109_0000033_88004_88684 | 226 |
| 224 | 3300048913 | Ga0496110_0054047 | Ga0496110_0054047_716_1432 | 226 |
| 225 | 3300048913 | Ga0496110_0457437 | Ga0496110_0457437_402_1082 | 226 |
| 226 | 3300048913 | Ga0496110_0562729 | Ga0496110_0562729_321_1001 | 226 |
| 227 | 3300048914 | Ga0496111_0498675 | Ga0496111_0498675_110_790 | 226 |
| 228 | 3300048915 | Ga0496112_0007130 | Ga0496112_0007130_42_722 | 226 |
| 229 | 3300048916 | Ga0496113_0000030 | Ga0496113_0000030_51061_51741 | 226 |
| 230 | 3300048922 | Ga0496119_0003689 | Ga0496119_0003689_5125_5805 | 226 |
| 231 | 3300048927 | Ga0496124_0188102 | Ga0496124_0188102_585_1265 | 226 |
| 232 | 3300049588 | Ga0501072_0091921 | Ga0501072_0091921_1188_1895 | 226 |
| 233 | 3300049591 | Ga0501075_0033971 | Ga0501075_0033971_657_1364 | 226 |
| 234 | 3300049592 | Ga0501076_0285959 | Ga0501076_0285959_626_1333 | 226 |
| 235 | 3300049743 | Ga0501081_0045811 | Ga0501081_0045811_228_935 | 226 |
| 236 | 3300049743 | Ga0501081_0332852 | Ga0501081_0332852_397_1080 | 226 |
| 237 | 3300050490 | nmdc:mga03n38_42944_c1 | nmdc:mga03n38_42944_c1_1109_1813 | 226 |
| 238 | 3300050491 | nmdc:mga00v17_235187_c1 | nmdc:mga00v17_235187_c1_121_831 | 226 |
| 239 | 3300050491 | nmdc:mga00v17_461099_c1 | nmdc:mga00v17_461099_c1_87_791 | 226 |
| 240 | 3300050494 | nmdc:mga06z11_81203_c1 | nmdc:mga06z11_81203_c1_757_1461 | 226 |
| 241 | 3300050507 | nmdc:mga05p37_111317_c1 | nmdc:mga05p37_111317_c1_1517_2236 | 226 |
| 242 | 3300053077 | Ga0495601_0009675 | Ga0495601_0009675_4970_5650 | 226 |
| 243 | 3300053077 | Ga0495601_0087975 | Ga0495601_0087975_794_1474 | 226 |
| 244 | 3300053078 | Ga0495612_0006649 | Ga0495612_0006649_3943_4623 | 226 |
| 245 | 3300053085 | Ga0495619_0000020 | Ga0495619_0000020_123947_124627 | 226 |
| 246 | 3300053085 | Ga0495619_0171969 | Ga0495619_0171969_236_925 | 226 |
| 247 | 3300054114 | Ga0501084_0581773 | Ga0501084_0581773_19_726 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g8a-assembly3.cif.gz_C | t. thermophilus 16s rrna g527 methyltransferase in complex with adohcy in space group p61 | 0.9423 | 43 | 224 |
| 1xdz-assembly1.cif.gz_A | crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg | 0.9302 | 9 | 224 |
| 3g8b-assembly1.cif.gz_A | t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 | 0.9198 | 15 | 224 |
| 1xdz-assembly1.cif.gz_A | crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg | 0.887 | 9 | 224 |
| 1jsx-assembly1.cif.gz_A | crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) | 0.8794 | 9 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6LW08_103_253_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9369 | 84 | 224 | 3.40.50.150 |
| af_I1JZW8_31_274_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9247 | 2 | 224 | 3.40.50.150 |
| af_I1JZW8_31_274_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.909 | 2 | 224 | 3.40.50.150 |
| af_Q67VB2_1_103_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9033 | 31 | 119 | 3.40.50.150 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.901 | 61 | 120 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G3DVR2-F1-model_v4 | deleted | 0.949 | 9 | 226 |
|
| AF-A0A023X799-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.9476 | 9 | 225 |
GO:0005829
GO:0070043 |
| AF-A0A355FQ94-F1-model_v4 | 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG | 0.9473 | 71 | 224 |
GO:0005829
GO:0070043 |
| AF-A0A1J3EL56-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G | 0.9469 | 61 | 224 |
GO:0005829
GO:0070043 |
| AF-A0A7V9PMI1-F1-model_v4 | Glucose-inhibited division protein B | 0.9467 | 10 | 167 |
GO:0005829
GO:0070043 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar