F358846

General Info

Members Datasets Scaffolds Average Seq Length
247 180 494 397

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100024090|Ga0070704_1000240903
Length 438
Sequence LKLPILSGNLVLQPCFTFILIKLHMYEQATASAVTVNGSSPDDNVKSFHSVLQRMLAVDSKVSDLIFSPGRPPQVELTGELQSVPIPDLETLRPPQIKGMVDLMLAGNEQGLDTLDKKGSSDISYSVPGLCRFRVNIFRQRGTHAIVMRVIPTEPPNWKELDLPEAVMNVAQLKNGLVLVTGPTGSGKSTTLAAIIDLINATKKYHIVTIEDPIEFIHEHKLSTVHQRELHSDTPDFALALRAALRQAPKVILVGEMRDRETIEVALEAAETGHLVLSTLHTIDAAKTIDRIIGVFPKIEEAPIRTRLSQSFRRIISQRLMPKVGGGRIAAIEILVSNSRTREYIEKGEKEGRSITDAMNDQTFDAVLEDLIRTGQITRDVGLAYSSNANNLTLQISDMKQPRGDDPSDGQPQTVEQPSPLAAPRRNGDGPQIEGFEP

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
165 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
170 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.05
Rhizosphere 95.95
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100024090 3300005549 Bacteria 3989
2 LJQas_1000312 3300000549 Bacteria 8659
3 Ga0070683_100072533 3300005329 Bacteria 3214
4 Ga0070690_100015274 3300005330 Bacteria 4576
5 Ga0070666_10036432 3300005335 Bacteria 3266
6 Ga0068868_100228828 3300005338 Bacteria 1559
7 Ga0070671_100036075 3300005355 Bacteria 4099
8 Ga0070673_100107569 3300005364 Bacteria 2307
9 Ga0070659_100023184 3300005366 Bacteria 4746
10 Ga0070667_100074976 3300005367 Bacteria 2887
11 Ga0070694_100224685 3300005444 Bacteria 1410
12 Ga0070662_100032758 3300005457 Bacteria 3654
13 Ga0070662_100066514 3300005457 Bacteria 2644
14 Ga0070681_10017204 3300005458 Bacteria 7228
15 Ga0070681_10030039 3300005458 Bacteria 5453
16 Ga0070681_10098855 3300005458 Bacteria 2864
17 Ga0070681_10238846 3300005458 Bacteria 1731
18 Ga0070685_10039364 3300005466 Bacteria 2685
19 Ga0070706_100001673 3300005467 Bacteria 23083
20 Ga0070706_100043246 3300005467 Bacteria 4163
21 Ga0070707_100002096 3300005468 Bacteria 19111
22 Ga0070698_100006058 3300005471 Bacteria 13171
23 Ga0070699_100005887 3300005518 Bacteria 10713
24 Ga0070679_100036917 3300005530 Bacteria 4851
25 Ga0070679_100147376 3300005530 Bacteria 2331
26 Ga0070684_100107373 3300005535 Bacteria 2500
27 Ga0070697_100050405 3300005536 Bacteria 3379
28 Ga0068853_100015940 3300005539 Bacteria 6177
29 Ga0068855_100038440 3300005563 Bacteria 5687
30 Ga0068855_100104416 3300005563 Bacteria 3259
31 Ga0070664_100047806 3300005564 Bacteria 3615
32 Ga0070664_100055955 3300005564 Bacteria 3351
33 Ga0068857_100110144 3300005577 Bacteria 2474
34 Ga0068857_100118560 3300005577 Bacteria 2382
35 Ga0070702_100048662 3300005615 Bacteria 2414
36 Ga0068852_100123542 3300005616 Bacteria 2374
37 Ga0068851_10067073 3300005834 Bacteria 1850
38 Ga0068858_100038438 3300005842 Bacteria 4439
39 Ga0068860_100055559 3300005843 Bacteria 3764
40 Ga0068860_100308101 3300005843 Bacteria 1552
41 Ga0068862_100053197 3300005844 Bacteria 3465
42 Ga0097621_100119036 3300006237 Bacteria 2238
43 Ga0068871_100088588 3300006358 Bacteria 2575
44 Ga0075433_10129519 3300006852 Bacteria 2242
45 Ga0075434_100421384 3300006871 Bacteria 1356
46 Ga0105240_10007766 3300009093 Bacteria 15517
47 Ga0111539_10155859 3300009094 Bacteria 2673
48 Ga0105247_10008110 3300009101 Bacteria 6416
49 Ga0105247_10058075 3300009101 Bacteria 2393
50 Ga0105243_10153640 3300009148 Bacteria 1977
51 Ga0105239_10005671 3300010375 Bacteria 14587
52 Ga0157369_10001016 3300013105 Bacteria 35331
53 Ga0157369_10066500 3300013105 Bacteria 3877
54 Ga0157369_10080129 3300013105 Bacteria 3497
55 Ga0157378_10084488 3300013297 Bacteria 2874
56 Ga0157378_10159645 3300013297 Bacteria 2108
57 Ga0163162_10028076 3300013306 Bacteria 5566
58 Ga0163162_10077140 3300013306 Bacteria 3395
59 Ga0163162_10290629 3300013306 Bacteria 1766
60 Ga0157372_10035105 3300013307 Bacteria 5518
61 Ga0157372_10105313 3300013307 Bacteria 3226
62 Ga0157372_10170503 3300013307 Bacteria 2518
63 Ga0157375_10077124 3300013308 Bacteria 3361
64 Ga0163163_10187636 3300014325 Bacteria 2115
65 Ga0157376_10183520 3300014969 Bacteria 1914
66 Ga0163161_10032749 3300017792 Bacteria 3713
67 Ga0206353_10047721 3300020082 Bacteria 3805
68 Ga0213871_10021337 3300021441 Bacteria 1613
69 Ga0207710_10006978 3300025900 Bacteria 4802
70 Ga0207705_10083732 3300025909 Bacteria 2327
71 Ga0207684_10000459 3300025910 Bacteria 53056
72 Ga0207684_10088782 3300025910 Bacteria 2634
73 Ga0207707_10015351 3300025912 Bacteria 6669
74 Ga0207707_10112075 3300025912 Bacteria 2385
75 Ga0207707_10272404 3300025912 Bacteria 1467
76 Ga0207657_10032570 3300025919 Bacteria 4707
77 Ga0207649_10164331 3300025920 Bacteria 1541
78 Ga0207646_10001217 3300025922 Bacteria 32322
79 Ga0207687_10281390 3300025927 Bacteria 1333
80 Ga0207644_10195557 3300025931 Bacteria 1592
81 Ga0207706_10059277 3300025933 Bacteria 3371
82 Ga0207706_10096434 3300025933 Bacteria 2600
83 Ga0207686_10031888 3300025934 Bacteria 3132
84 Ga0207669_10213049 3300025937 Bacteria 1412
85 Ga0207679_10040071 3300025945 Bacteria 3351
86 Ga0207712_10005628 3300025961 Bacteria 7902
87 Ga0207712_10035150 3300025961 Unclassified 3402
88 Ga0207677_10114990 3300026023 Bacteria 2012
89 Ga0207703_10002834 3300026035 Bacteria 14789
90 Ga0207639_10091710 3300026041 Bacteria 2433
91 Ga0207702_10337938 3300026078 Bacteria 1438
92 Ga0207676_10011262 3300026095 Bacteria 6389
93 Ga0207674_10044653 3300026116 Bacteria 4564
94 Ga0207683_10091709 3300026121 Bacteria 2707
95 Ga0268265_10195435 3300028380 Bacteria 1750
96 Ga0268264_10073261 3300028381 Bacteria 2906
97 Ga0265326_10020337 3300028558 Bacteria 1903
98 Ga0265318_10042624 3300028577 Bacteria 1722
99 Ga0265338_10009483 3300028800 Bacteria 11597
100 Ga0265330_10039608 3300031235 Bacteria 2094
101 Ga0265325_10024355 3300031241 Bacteria 3294
102 Ga0265329_10018292 3300031242 Bacteria 2399
103 Ga0265327_10035400 3300031251 Bacteria 2760
104 Ga0265316_10005165 3300031344 Bacteria 12783
105 Ga0307408_100021242 3300031548 Bacteria 4391
106 Ga0265313_10007764 3300031595 Bacteria 7255
107 Ga0265314_10005089 3300031711 Bacteria 11976
108 Ga0265342_10089138 3300031712 Bacteria 1770
109 Ga0307405_10002968 3300031731 Bacteria 7664
110 Ga0307405_10014494 3300031731 Bacteria 4240
111 Ga0307405_10059241 3300031731 Bacteria 2412
112 Ga0307413_10001732 3300031824 Bacteria 8523
113 Ga0307410_10000515 3300031852 Bacteria 15695
114 Ga0307410_10060795 3300031852 Bacteria 2583
115 Ga0307410_10098550 3300031852 Bacteria 2091
116 Ga0307406_10011508 3300031901 Bacteria 5026
117 Ga0307406_10020498 3300031901 Bacteria 3894
118 Ga0307406_10053658 3300031901 Bacteria 2569
119 Ga0307407_10000827 3300031903 Bacteria 10272
120 Ga0307407_10001026 3300031903 Bacteria 9634
121 Ga0307407_10019718 3300031903 Bacteria 3439
122 Ga0307407_10025801 3300031903 Bacteria 3103
123 Ga0307412_10004876 3300031911 Bacteria 7495
124 Ga0307412_10012395 3300031911 Bacteria 4970
125 Ga0307412_10044064 3300031911 Bacteria 2910
126 Ga0307409_100000429 3300031995 Bacteria 17805
127 Ga0307409_100026120 3300031995 Bacteria 4113
128 Ga0307409_100164270 3300031995 Bacteria 1946
129 Ga0307416_100002922 3300032002 Bacteria 9956
130 Ga0307416_100093951 3300032002 Bacteria 2585
131 Ga0307416_100287847 3300032002 Bacteria 1624
132 Ga0307414_10008204 3300032004 Bacteria 5909
133 Ga0307411_10008424 3300032005 Bacteria 5341
134 Ga0307411_10030775 3300032005 Bacteria 3294
135 Ga0307415_100001779 3300032126 Bacteria 10544
136 Ga0307415_100002808 3300032126 Bacteria 8717
137 Ga0307415_100030001 3300032126 Bacteria 3483
138 Ga0373926_0037285 3300035083 Bacteria 1729
139 Ga0373943_0006470 3300035170 Bacteria 5261
140 Ga0373946_0011107 3300035171 Bacteria 3351
141 Ga0373935_0026461 3300035692 Bacteria 3580
142 Ga0373925_0004948 3300037068 Bacteria 10014
143 Ga0395900_0024419 3300037418 Bacteria 6190
144 Ga0395900_0054195 3300037418 Bacteria 4129
145 Ga0395898_0052889 3300037466 Bacteria 3967
146 Ga0395905_0173620 3300037471 Bacteria 2024
147 Ga0395905_0209374 3300037471 Bacteria 1827
148 Ga0395905_0325984 3300037471 Bacteria 1426
149 Ga0395901_0013387 3300038443 Bacteria 8336
150 Ga0395901_0028799 3300038443 Bacteria 5714
151 Ga0395901_0049628 3300038443 Bacteria 4361
152 Ga0395901_0185745 3300038443 Bacteria 2180
153 Ga0436360_0368484 3300039438 Bacteria 19872
154 Ga0436362_0268914 3300039453 Bacteria 3392
155 Ga0451577_0277132 3300042876 Bacteria 1519
156 Ga0466961_0052085 3300044693 Bacteria 2612
157 Ga0466961_0093550 3300044693 Bacteria 1897
158 Ga0466963_0080803 3300044694 Bacteria 2201
159 Ga0466970_0036564 3300044765 Bacteria 2602
160 Ga0466959_0023049 3300045049 Bacteria 4605
161 Ga0466959_0190048 3300045049 Bacteria 1433
162 Ga0466958_0001959 3300045836 Bacteria 10116
163 Ga0495592_0068189 3300046454 Bacteria 2597
164 Ga0495651_0012179 3300046462 Bacteria 6622
165 Ga0495653_0115762 3300046463 Bacteria 1918
166 Ga0495639_0061928 3300046475 Bacteria 1716
167 Ga0495664_0008728 3300046477 Bacteria 5659
168 Ga0495664_0034346 3300046477 Bacteria 2983
169 Ga0495608_0035958 3300046511 Bacteria 3336
170 Ga0495618_0039942 3300046514 Bacteria 2951
171 Ga0495628_0012872 3300046516 Bacteria 7044
172 Ga0495628_0047354 3300046516 Bacteria 3412
173 Ga0495630_0013327 3300046517 Bacteria 5984
174 Ga0495630_0052054 3300046517 Bacteria 3065
175 Ga0495652_0157644 3300046529 Bacteria 1766
176 Ga0495586_0008717 3300046535 Bacteria 5401
177 Ga0495586_0155018 3300046535 Bacteria 1290
178 Ga0495645_0109366 3300046543 Bacteria 1957
179 Ga0495667_0006360 3300046559 Bacteria 8011
180 Ga0495634_0003566 3300046642 Bacteria 12453
181 Ga0495635_0052759 3300046663 Bacteria 2801
182 Ga0495635_0101346 3300046663 Bacteria 1968
183 Ga0495635_0136595 3300046663 Bacteria 1671
184 Ga0495657_0078944 3300046675 Bacteria 2132
185 Ga0495599_0042963 3300046678 Bacteria 2837
186 Ga0495624_0100361 3300046690 Bacteria 1782
187 Ga0495600_0158201 3300046809 Bacteria 1465
188 Ga0495604_0046286 3300047317 Bacteria 3392
189 Ga0495674_0000851 3300047319 Bacteria 29144
190 Ga0495674_0158087 3300047319 Bacteria 1897
191 Ga0495680_0001735 3300047322 Bacteria 23159
192 Ga0495680_0009389 3300047322 Bacteria 8799
193 Ga0495684_0015551 3300047471 Bacteria 5858
194 Ga0495602_0055869 3300048088 Bacteria 3475
195 Ga0496100_0136250 3300048903 Bacteria 1735
196 Ga0496105_0041367 3300048908 Bacteria 3798
197 Ga0496106_0004813 3300048909 Bacteria 9989
198 Ga0496106_0054395 3300048909 Bacteria 3024
199 Ga0496107_0003580 3300048910 Bacteria 10409
200 Ga0496112_0006262 3300048915 Bacteria 10430
201 Ga0496112_0419080 3300048915 Bacteria 1278
202 Ga0496114_0069730 3300048917 Bacteria 2952
203 Ga0496114_0101230 3300048917 Bacteria 2460
204 Ga0496115_0013654 3300048918 Bacteria 6147
205 Ga0501031_0049779 3300049568 Bacteria 2730
206 Ga0501033_0040593 3300049570 Bacteria 3474
207 Ga0501036_0006927 3300049572 Bacteria 9216
208 Ga0501037_0067176 3300049573 Bacteria 2611
209 Ga0501037_0221823 3300049573 Bacteria 1330
210 Ga0501038_0075941 3300049574 Bacteria 2839
211 Ga0501039_0091382 3300049575 Bacteria 2372
212 Ga0501040_0003938 3300049576 Bacteria 9636
213 Ga0501041_0035793 3300049577 Bacteria 3008
214 Ga0501042_0001593 3300049578 Bacteria 13477
215 Ga0501043_0101597 3300049579 Bacteria 2260
216 Ga0501046_0078134 3300049580 Bacteria 2561
217 Ga0501048_0022409 3300049582 Bacteria 4620
218 Ga0501070_0261278 3300049586 Bacteria 1415
219 Ga0501071_0002787 3300049587 Bacteria 10742
220 Ga0501072_0010679 3300049588 Bacteria 6992
221 Ga0501072_0066370 3300049588 Bacteria 2846
222 Ga0501074_0047334 3300049590 Bacteria 3109
223 Ga0501075_0009643 3300049591 Bacteria 6761
224 Ga0501076_0008211 3300049592 Bacteria 7648
225 Ga0501077_0032414 3300049593 Bacteria 3325
226 Ga0501235_002205 3300049669 Bacteria 4189
227 Ga0501252_002898 3300049682 Bacteria 1734
228 Ga0501079_0008413 3300049741 Bacteria 7820
229 Ga0501080_0040206 3300049742 Bacteria 4362
230 Ga0501080_0062720 3300049742 Bacteria 3459
231 Ga0501081_0020045 3300049743 Bacteria 4457
232 Ga0501081_0275770 3300049743 Bacteria 1230
233 Ga0501270_000713 3300049767 Bacteria 2935
234 Ga0501273_000805 3300049770 Bacteria 2726
235 Ga0501035_0065921 3300049822 Bacteria 3214
236 Ga0501035_0257546 3300049822 Bacteria 1480
237 Ga0501045_0005012 3300049824 Bacteria 9180
238 nmdc:mga0n895_14281_c1 3300050512 Bacteria 7206
239 nmdc:mga0rr50_23504_c1 3300050513 Bacteria 4251
240 nmdc:mga0a205_142902_c1 3300050515 Bacteria 2293
241 Ga0495595_0026318 3300053084 Bacteria 2584
242 Ga0495595_0053407 3300053084 Bacteria 1877
243 Ga0495619_0198769 3300053085 Bacteria 1388
244 Ga0501084_0053835 3300054114 Bacteria 3366
245 Ga0501082_0003208 3300060353 Bacteria 14258
246 Ga0530510_0009633 3300061734 Bacteria 6776
247 Ga0530510_0050455 3300061734 Bacteria 3006
248 Ga0070704_100024090
249 LJQas_1000312
250 Ga0070683_100072533
251 Ga0070690_100015274
252 Ga0070666_10036432
253 Ga0068868_100228828
254 Ga0070671_100036075
255 Ga0070673_100107569
256 Ga0070659_100023184
257 Ga0070667_100074976
258 Ga0070694_100224685
259 Ga0070662_100032758
260 Ga0070662_100066514
261 Ga0070681_10017204
262 Ga0070681_10030039
263 Ga0070681_10098855
264 Ga0070681_10238846
265 Ga0070685_10039364
266 Ga0070706_100001673
267 Ga0070706_100043246
268 Ga0070707_100002096
269 Ga0070698_100006058
270 Ga0070699_100005887
271 Ga0070679_100036917
272 Ga0070679_100147376
273 Ga0070684_100107373
274 Ga0070697_100050405
275 Ga0068853_100015940
276 Ga0068855_100038440
277 Ga0068855_100104416
278 Ga0070664_100047806
279 Ga0070664_100055955
280 Ga0068857_100110144
281 Ga0068857_100118560
282 Ga0070702_100048662
283 Ga0068852_100123542
284 Ga0068851_10067073
285 Ga0068858_100038438
286 Ga0068860_100055559
287 Ga0068860_100308101
288 Ga0068862_100053197
289 Ga0097621_100119036
290 Ga0068871_100088588
291 Ga0075433_10129519
292 Ga0075434_100421384
293 Ga0105240_10007766
294 Ga0111539_10155859
295 Ga0105247_10008110
296 Ga0105247_10058075
297 Ga0105243_10153640
298 Ga0105239_10005671
299 Ga0157369_10001016
300 Ga0157369_10066500
301 Ga0157369_10080129
302 Ga0157378_10084488
303 Ga0157378_10159645
304 Ga0163162_10028076
305 Ga0163162_10077140
306 Ga0163162_10290629
307 Ga0157372_10035105
308 Ga0157372_10105313
309 Ga0157372_10170503
310 Ga0157375_10077124
311 Ga0163163_10187636
312 Ga0157376_10183520
313 Ga0163161_10032749
314 Ga0206353_10047721
315 Ga0213871_10021337
316 Ga0207710_10006978
317 Ga0207705_10083732
318 Ga0207684_10000459
319 Ga0207684_10088782
320 Ga0207707_10015351
321 Ga0207707_10112075
322 Ga0207707_10272404
323 Ga0207657_10032570
324 Ga0207649_10164331
325 Ga0207646_10001217
326 Ga0207687_10281390
327 Ga0207644_10195557
328 Ga0207706_10059277
329 Ga0207706_10096434
330 Ga0207686_10031888
331 Ga0207669_10213049
332 Ga0207679_10040071
333 Ga0207712_10005628
334 Ga0207712_10035150
335 Ga0207677_10114990
336 Ga0207703_10002834
337 Ga0207639_10091710
338 Ga0207702_10337938
339 Ga0207676_10011262
340 Ga0207674_10044653
341 Ga0207683_10091709
342 Ga0268265_10195435
343 Ga0268264_10073261
344 Ga0265326_10020337
345 Ga0265318_10042624
346 Ga0265338_10009483
347 Ga0265330_10039608
348 Ga0265325_10024355
349 Ga0265329_10018292
350 Ga0265327_10035400
351 Ga0265316_10005165
352 Ga0307408_100021242
353 Ga0265313_10007764
354 Ga0265314_10005089
355 Ga0265342_10089138
356 Ga0307405_10002968
357 Ga0307405_10014494
358 Ga0307405_10059241
359 Ga0307413_10001732
360 Ga0307410_10000515
361 Ga0307410_10060795
362 Ga0307410_10098550
363 Ga0307406_10011508
364 Ga0307406_10020498
365 Ga0307406_10053658
366 Ga0307407_10000827
367 Ga0307407_10001026
368 Ga0307407_10019718
369 Ga0307407_10025801
370 Ga0307412_10004876
371 Ga0307412_10012395
372 Ga0307412_10044064
373 Ga0307409_100000429
374 Ga0307409_100026120
375 Ga0307409_100164270
376 Ga0307416_100002922
377 Ga0307416_100093951
378 Ga0307416_100287847
379 Ga0307414_10008204
380 Ga0307411_10008424
381 Ga0307411_10030775
382 Ga0307415_100001779
383 Ga0307415_100002808
384 Ga0307415_100030001
385 Ga0373926_0037285
386 Ga0373943_0006470
387 Ga0373946_0011107
388 Ga0373935_0026461
389 Ga0373925_0004948
390 Ga0395900_0024419
391 Ga0395900_0054195
392 Ga0395898_0052889
393 Ga0395905_0173620
394 Ga0395905_0209374
395 Ga0395905_0325984
396 Ga0395901_0013387
397 Ga0395901_0028799
398 Ga0395901_0049628
399 Ga0395901_0185745
400 Ga0436360_0368484
401 Ga0436362_0268914
402 Ga0451577_0277132
403 Ga0466961_0052085
404 Ga0466961_0093550
405 Ga0466963_0080803
406 Ga0466970_0036564
407 Ga0466959_0023049
408 Ga0466959_0190048
409 Ga0466958_0001959
410 Ga0495592_0068189
411 Ga0495651_0012179
412 Ga0495653_0115762
413 Ga0495639_0061928
414 Ga0495664_0008728
415 Ga0495664_0034346
416 Ga0495608_0035958
417 Ga0495618_0039942
418 Ga0495628_0012872
419 Ga0495628_0047354
420 Ga0495630_0013327
421 Ga0495630_0052054
422 Ga0495652_0157644
423 Ga0495586_0008717
424 Ga0495586_0155018
425 Ga0495645_0109366
426 Ga0495667_0006360
427 Ga0495634_0003566
428 Ga0495635_0052759
429 Ga0495635_0101346
430 Ga0495635_0136595
431 Ga0495657_0078944
432 Ga0495599_0042963
433 Ga0495624_0100361
434 Ga0495600_0158201
435 Ga0495604_0046286
436 Ga0495674_0000851
437 Ga0495674_0158087
438 Ga0495680_0001735
439 Ga0495680_0009389
440 Ga0495684_0015551
441 Ga0495602_0055869
442 Ga0496100_0136250
443 Ga0496105_0041367
444 Ga0496106_0004813
445 Ga0496106_0054395
446 Ga0496107_0003580
447 Ga0496112_0006262
448 Ga0496112_0419080
449 Ga0496114_0069730
450 Ga0496114_0101230
451 Ga0496115_0013654
452 Ga0501031_0049779
453 Ga0501033_0040593
454 Ga0501036_0006927
455 Ga0501037_0067176
456 Ga0501037_0221823
457 Ga0501038_0075941
458 Ga0501039_0091382
459 Ga0501040_0003938
460 Ga0501041_0035793
461 Ga0501042_0001593
462 Ga0501043_0101597
463 Ga0501046_0078134
464 Ga0501048_0022409
465 Ga0501070_0261278
466 Ga0501071_0002787
467 Ga0501072_0010679
468 Ga0501072_0066370
469 Ga0501074_0047334
470 Ga0501075_0009643
471 Ga0501076_0008211
472 Ga0501077_0032414
473 Ga0501235_002205
474 Ga0501252_002898
475 Ga0501079_0008413
476 Ga0501080_0040206
477 Ga0501080_0062720
478 Ga0501081_0020045
479 Ga0501081_0275770
480 Ga0501270_000713
481 Ga0501273_000805
482 Ga0501035_0065921
483 Ga0501035_0257546
484 Ga0501045_0005012
485 nmdc:mga0n895_14281_c1
486 nmdc:mga0rr50_23504_c1
487 nmdc:mga0a205_142902_c1
488 Ga0495595_0026318
489 Ga0495595_0053407
490 Ga0495619_0198769
491 Ga0501084_0053835
492 Ga0501082_0003208
493 Ga0530510_0009633
494 Ga0530510_0050455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00437

T2SSE

Type II/IV secretion system protein

54

324

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jvv-assembly1.cif.gz_C-2 crystal structure of p. aeruginosa pilt with bound amp-pcp 0.9167 37 381
3jvu-assembly1.cif.gz_C-2 crystal structure of unliganded p. aeruginosa pilt 0.9141 35 379
2eyu-assembly2.cif.gz_B the crystal structure of the c-terminal domain of aquifex aeolicus pilt 0.9115 142 388
2eyu-assembly2.cif.gz_B the crystal structure of the c-terminal domain of aquifex aeolicus pilt 0.9045 142 388
6ojy-assembly1.cif.gz_B methylated pilt4 from geobacter metallireducens bound to sulfate: c3ocococ conformation 0.904 27 386
ID Description Score Start End Superfamily
3jvvC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9432 140 381 3.40.50.300
3jvvC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9317 140 381 3.40.50.300
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9033 32 138 3.30.450.90
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.895 32 138 3.30.450.90
af_Q2FY30_111_324_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8532 154 377 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V5WVS4-F1-model_v4 Twitching motility protein 0.9818 263 362
AF-A0A838THB8-F1-model_v4 Flp pilus assembly complex ATPase component TadA 0.9798 232 341 GO:0005524
GO:0016887
AF-A0A699WNI5-F1-model_v4 Bacterial type II secretion system protein E domain-containing protein 0.9684 235 357 GO:0016887
AF-T0ZN69-F1-model_v4 Twitching motility protein PilT 0.9677 230 389 GO:0016887
AF-A0A520QJQ3-F1-model_v4 Type IV pilus twitching motility protein PilT 0.9665 252 390 GO:0016887

Map