F358843
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 247 | 192 | 246 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100283667|Ga0070665_1002836672 |
| Length | 235 |
| Sequence | MAAASSGALWKLLGTLYTAHPWHGISPGENVPAELLCFIEVVPSDTAKYEIDKVSGYLKLDRPQKYSNICPAMYGFIPQTLCGERVAALSSEATGTELVGDGDPLDICILTERPISHGNLLVDCRPIGGFRMLDQGEADDKIIAVLKGDSAYGHCRSVGEIPPAVLDRLRHYFLTYKQPPGVTACTSTITDVYDREVAFEVISRSLADYHERFGSLETLLTEALHFMLGKEEAPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 114 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 115 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 116 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 118 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 119 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 120 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 121 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 123 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 125 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 135 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 139 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 140 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 141 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 142 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 143 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 144 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 145 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 146 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 147 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 97.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000031 | 3300000532 | Bacteria | 9181 |
| 2 | Ga0065707_10116773 | 3300005295 | Bacteria | 2228 |
| 3 | Ga0065707_10178764 | 3300005295 | Bacteria | 1429 |
| 4 | Ga0070658_10007568 | 3300005327 | Bacteria | 8766 |
| 5 | Ga0070676_10004186 | 3300005328 | Bacteria | 7574 |
| 6 | Ga0070676_10081841 | 3300005328 | Bacteria | 1960 |
| 7 | Ga0070690_100000455 | 3300005330 | Bacteria | 20596 |
| 8 | Ga0070666_10028170 | 3300005335 | Bacteria | 3684 |
| 9 | Ga0070666_10296349 | 3300005335 | Bacteria | 1151 |
| 10 | Ga0070680_100182321 | 3300005336 | Bacteria | 1768 |
| 11 | Ga0070680_100395272 | 3300005336 | Bacteria | 1178 |
| 12 | Ga0070682_100000749 | 3300005337 | Bacteria | 19374 |
| 13 | Ga0068868_100000855 | 3300005338 | Bacteria | 20680 |
| 14 | Ga0070689_100000665 | 3300005340 | Bacteria | 20788 |
| 15 | Ga0070689_100061985 | 3300005340 | Bacteria | 2909 |
| 16 | Ga0070691_10000653 | 3300005341 | Bacteria | 13422 |
| 17 | Ga0070687_100000628 | 3300005343 | Bacteria | 11691 |
| 18 | Ga0070692_10000818 | 3300005345 | Bacteria | 10376 |
| 19 | Ga0070668_100251652 | 3300005347 | Bacteria | 1467 |
| 20 | Ga0070688_100027213 | 3300005365 | Bacteria | 3405 |
| 21 | Ga0070667_100051758 | 3300005367 | Bacteria | 3463 |
| 22 | Ga0070667_100401479 | 3300005367 | Unclassified | 1248 |
| 23 | Ga0070709_10238486 | 3300005434 | Bacteria | 1305 |
| 24 | Ga0070713_100002703 | 3300005436 | Bacteria | 11567 |
| 25 | Ga0070701_10000790 | 3300005438 | Bacteria | 11324 |
| 26 | Ga0070705_100457571 | 3300005440 | Bacteria | 959 |
| 27 | Ga0070700_100000345 | 3300005441 | Bacteria | 23964 |
| 28 | Ga0070694_100000942 | 3300005444 | Bacteria | 16439 |
| 29 | Ga0070708_100327134 | 3300005445 | Bacteria | 1444 |
| 30 | Ga0068867_100000396 | 3300005459 | Bacteria | 29178 |
| 31 | Ga0070679_100003049 | 3300005530 | Bacteria | 15314 |
| 32 | Ga0070697_100426279 | 3300005536 | Bacteria | 1153 |
| 33 | Ga0068853_100063900 | 3300005539 | Bacteria | 3190 |
| 34 | Ga0070672_100270074 | 3300005543 | Bacteria | 1436 |
| 35 | Ga0070686_100001357 | 3300005544 | Bacteria | 13844 |
| 36 | Ga0070686_100468025 | 3300005544 | Bacteria | 972 |
| 37 | Ga0070695_100001609 | 3300005545 | Bacteria | 12648 |
| 38 | Ga0070696_100208444 | 3300005546 | Bacteria | 1462 |
| 39 | Ga0070696_100566916 | 3300005546 | Bacteria | 912 |
| 40 | Ga0070693_100000009 | 3300005547 | Bacteria | 77783 |
| 41 | Ga0070665_100000688 | 3300005548 | Bacteria | 45153 |
| 42 | Ga0070665_100283667 | 3300005548 | Bacteria | 1658 |
| 43 | Ga0070704_100000091 | 3300005549 | Bacteria | 31281 |
| 44 | Ga0068855_100003912 | 3300005563 | Bacteria | 18180 |
| 45 | Ga0068854_100081250 | 3300005578 | Bacteria | 2393 |
| 46 | Ga0068856_100570106 | 3300005614 | Bacteria | 1153 |
| 47 | Ga0068856_101354460 | 3300005614 | Unclassified | 726 |
| 48 | Ga0070702_100000066 | 3300005615 | Bacteria | 29418 |
| 49 | Ga0070702_100240461 | 3300005615 | Bacteria | 1222 |
| 50 | Ga0068859_100003675 | 3300005617 | Bacteria | 15626 |
| 51 | Ga0068866_10000144 | 3300005718 | Bacteria | 32128 |
| 52 | Ga0068861_100000231 | 3300005719 | Bacteria | 30386 |
| 53 | Ga0068870_10040978 | 3300005840 | Bacteria | 2404 |
| 54 | Ga0068863_100447384 | 3300005841 | Bacteria | 1268 |
| 55 | Ga0068858_100000921 | 3300005842 | Bacteria | 30521 |
| 56 | Ga0068860_100002180 | 3300005843 | Bacteria | 20596 |
| 57 | Ga0068860_100121085 | 3300005843 | Bacteria | 2506 |
| 58 | Ga0068860_101373512 | 3300005843 | Archaea | 728 |
| 59 | Ga0070717_10000048 | 3300006028 | Bacteria | 104474 |
| 60 | Ga0070716_100650489 | 3300006173 | Bacteria | 799 |
| 61 | Ga0097621_100000596 | 3300006237 | Bacteria | 25478 |
| 62 | Ga0068871_100000495 | 3300006358 | Bacteria | 26957 |
| 63 | Ga0075428_100001109 | 3300006844 | Bacteria | 28681 |
| 64 | Ga0075428_100002006 | 3300006844 | Bacteria | 21940 |
| 65 | Ga0075428_100020231 | 3300006844 | Bacteria | 7371 |
| 66 | Ga0075430_100001623 | 3300006846 | Bacteria | 18369 |
| 67 | Ga0075431_100494341 | 3300006847 | Bacteria | 1215 |
| 68 | Ga0075433_10009402 | 3300006852 | Bacteria | 7810 |
| 69 | Ga0075433_10193798 | 3300006852 | Bacteria | 1808 |
| 70 | Ga0075434_100000549 | 3300006871 | Bacteria | 28671 |
| 71 | Ga0075434_100249530 | 3300006871 | Bacteria | 1794 |
| 72 | Ga0075434_100957889 | 3300006871 | Bacteria | 870 |
| 73 | Ga0075429_100001595 | 3300006880 | Bacteria | 18685 |
| 74 | Ga0075429_100013850 | 3300006880 | Bacteria | 6992 |
| 75 | Ga0068865_100001943 | 3300006881 | Bacteria | 12178 |
| 76 | Ga0075436_100001086 | 3300006914 | Bacteria | 18322 |
| 77 | Ga0097620_100003675 | 3300006931 | Bacteria | 15626 |
| 78 | Ga0075435_100009910 | 3300007076 | Bacteria | 6939 |
| 79 | Ga0105250_10042720 | 3300009092 | Bacteria | 1816 |
| 80 | Ga0111539_10000006 | 3300009094 | Bacteria | 463720 |
| 81 | Ga0111539_10003904 | 3300009094 | Bacteria | 19606 |
| 82 | Ga0111539_10225338 | 3300009094 | Bacteria | 2183 |
| 83 | Ga0105245_10000830 | 3300009098 | Bacteria | 28117 |
| 84 | Ga0114129_10002499 | 3300009147 | Bacteria | 25510 |
| 85 | Ga0114129_10507541 | 3300009147 | Unclassified | 1574 |
| 86 | Ga0105243_10000809 | 3300009148 | Bacteria | 29781 |
| 87 | Ga0105242_10000501 | 3300009176 | Bacteria | 30909 |
| 88 | Ga0105248_10326522 | 3300009177 | Bacteria | 1728 |
| 89 | Ga0105248_11268702 | 3300009177 | Unclassified | 833 |
| 90 | Ga0105238_10034090 | 3300009551 | Bacteria | 5181 |
| 91 | Ga0105249_10001520 | 3300009553 | Bacteria | 20347 |
| 92 | Ga0157378_10011388 | 3300013297 | Bacteria | 7786 |
| 93 | Ga0157378_10484634 | 3300013297 | Unclassified | 1233 |
| 94 | Ga0157372_11233763 | 3300013307 | Bacteria | 864 |
| 95 | Ga0157380_10042247 | 3300014326 | Bacteria | 3563 |
| 96 | Ga0157376_10002985 | 3300014969 | Bacteria | 11599 |
| 97 | Ga0213873_10000003 | 3300021358 | Bacteria | 973849 |
| 98 | Ga0213876_10000003 | 3300021384 | Bacteria | 973849 |
| 99 | Ga0207653_10021677 | 3300025885 | Bacteria | 2038 |
| 100 | Ga0207642_10000370 | 3300025899 | Bacteria | 13564 |
| 101 | Ga0207647_10142497 | 3300025904 | Bacteria | 1404 |
| 102 | Ga0207645_10116878 | 3300025907 | Bacteria | 1729 |
| 103 | Ga0207645_10166756 | 3300025907 | Bacteria | 1442 |
| 104 | Ga0207645_10380833 | 3300025907 | Bacteria | 947 |
| 105 | Ga0207643_10156789 | 3300025908 | Bacteria | 1368 |
| 106 | Ga0207705_10029773 | 3300025909 | Bacteria | 3892 |
| 107 | Ga0207660_10001746 | 3300025917 | Bacteria | 14558 |
| 108 | Ga0207662_10000129 | 3300025918 | Bacteria | 36284 |
| 109 | Ga0207657_10473932 | 3300025919 | Bacteria | 982 |
| 110 | Ga0207687_10002926 | 3300025927 | Bacteria | 11597 |
| 111 | Ga0207687_10258888 | 3300025927 | Unclassified | 1386 |
| 112 | Ga0207700_10013402 | 3300025928 | Bacteria | 5333 |
| 113 | Ga0207686_10001808 | 3300025934 | Bacteria | 11886 |
| 114 | Ga0207704_10003728 | 3300025938 | Bacteria | 6936 |
| 115 | Ga0207665_10456890 | 3300025939 | Bacteria | 981 |
| 116 | Ga0207691_10280943 | 3300025940 | Bacteria | 1432 |
| 117 | Ga0207711_10239862 | 3300025941 | Bacteria | 1662 |
| 118 | Ga0207689_10000544 | 3300025942 | Bacteria | 35849 |
| 119 | Ga0207689_10196699 | 3300025942 | Bacteria | 1664 |
| 120 | Ga0207667_10013608 | 3300025949 | Bacteria | 9299 |
| 121 | Ga0207712_10006172 | 3300025961 | Bacteria | 7550 |
| 122 | Ga0207640_10089708 | 3300025981 | Bacteria | 2125 |
| 123 | Ga0207658_10318098 | 3300025986 | Archaea | 1346 |
| 124 | Ga0207703_10005033 | 3300026035 | Bacteria | 10717 |
| 125 | Ga0207639_10112500 | 3300026041 | Bacteria | 2222 |
| 126 | Ga0207708_10000417 | 3300026075 | Bacteria | 33347 |
| 127 | Ga0207708_10091818 | 3300026075 | Bacteria | 2342 |
| 128 | Ga0207702_11270366 | 3300026078 | Unclassified | 730 |
| 129 | Ga0207641_10303082 | 3300026088 | Bacteria | 1510 |
| 130 | Ga0207648_10000135 | 3300026089 | Bacteria | 73544 |
| 131 | Ga0207676_10198464 | 3300026095 | Bacteria | 1771 |
| 132 | Ga0207675_100000999 | 3300026118 | Bacteria | 27989 |
| 133 | Ga0207428_10000007 | 3300027907 | Bacteria | 463715 |
| 134 | Ga0207428_10002931 | 3300027907 | Bacteria | 16910 |
| 135 | Ga0207428_10024432 | 3300027907 | Bacteria | 5074 |
| 136 | Ga0268266_10000684 | 3300028379 | Bacteria | 45767 |
| 137 | Ga0268265_10003508 | 3300028380 | Bacteria | 11222 |
| 138 | Ga0268265_10464885 | 3300028380 | Unclassified | 1185 |
| 139 | Ga0268264_10002949 | 3300028381 | Bacteria | 14779 |
| 140 | Ga0268264_10024272 | 3300028381 | Bacteria | 4950 |
| 141 | Ga0265316_10365510 | 3300031344 | Unclassified | 1043 |
| 142 | Ga0307509_10070110 | 3300031507 | Bacteria | 3662 |
| 143 | Ga0307408_100244643 | 3300031548 | Bacteria | 1476 |
| 144 | Ga0307409_100430934 | 3300031995 | Bacteria | 1268 |
| 145 | Ga0373930_0016109 | 3300034816 | Bacteria | 1410 |
| 146 | Ga0373948_0008953 | 3300034817 | Bacteria | 1716 |
| 147 | Ga0373950_0006976 | 3300034818 | Bacteria | 1740 |
| 148 | Ga0373959_0044266 | 3300034820 | Bacteria | 944 |
| 149 | Ga0373926_0002058 | 3300035083 | Bacteria | 6334 |
| 150 | Ga0373928_0015824 | 3300035084 | Bacteria | 1538 |
| 151 | Ga0373944_0001231 | 3300035089 | Bacteria | 6423 |
| 152 | Ga0373949_0001774 | 3300035090 | Bacteria | 5941 |
| 153 | Ga0373951_0004164 | 3300035091 | Bacteria | 3456 |
| 154 | Ga0373952_0026442 | 3300035092 | Bacteria | 1261 |
| 155 | Ga0373936_0003283 | 3300035113 | Bacteria | 6063 |
| 156 | Ga0373936_0013995 | 3300035113 | Unclassified | 3064 |
| 157 | Ga0373939_0004495 | 3300035114 | Bacteria | 3303 |
| 158 | Ga0373941_0006853 | 3300035115 | Bacteria | 2763 |
| 159 | Ga0373945_0001248 | 3300035116 | Bacteria | 7734 |
| 160 | Ga0373954_0035763 | 3300035118 | Bacteria | 2304 |
| 161 | Ga0373943_0001683 | 3300035170 | Bacteria | 10039 |
| 162 | Ga0373943_0009619 | 3300035170 | Bacteria | 4333 |
| 163 | Ga0373946_0002413 | 3300035171 | Bacteria | 6607 |
| 164 | Ga0373946_0031543 | 3300035171 | Bacteria | 2123 |
| 165 | Ga0373942_0000743 | 3300035207 | Bacteria | 8994 |
| 166 | Ga0373924_0186892 | 3300035410 | Unclassified | 912 |
| 167 | Ga0373931_0000635 | 3300035691 | Bacteria | 14600 |
| 168 | Ga0373931_0002692 | 3300035691 | Bacteria | 7908 |
| 169 | Ga0373931_0066710 | 3300035691 | Unclassified | 1953 |
| 170 | Ga0373935_0010331 | 3300035692 | Bacteria | 5598 |
| 171 | Ga0373935_0019773 | 3300035692 | Bacteria | 4108 |
| 172 | Ga0373927_0010855 | 3300035695 | Bacteria | 6067 |
| 173 | Ga0373947_0007412 | 3300035725 | Bacteria | 6352 |
| 174 | Ga0373947_0013930 | 3300035725 | Bacteria | 4610 |
| 175 | Ga0373937_0277081 | 3300036401 | Unclassified | 1583 |
| 176 | Ga0373937_1438341 | 3300036401 | Unclassified | 637 |
| 177 | Ga0373925_0004033 | 3300037068 | Bacteria | 11153 |
| 178 | Ga0373925_0018726 | 3300037068 | Bacteria | 5031 |
| 179 | Ga0400486_21331 | 3300038742 | Bacteria | 1422 |
| 180 | Ga0436365_1186993 | 3300039437 | Bacteria | 180001 |
| 181 | Ga0436362_1234996 | 3300039453 | Bacteria | 292548 |
| 182 | Ga0439453_0009601 | 3300041408 | Unclassified | 1579 |
| 183 | Ga0439443_004645 | 3300042003 | Unclassified | 1800 |
| 184 | Ga0439434_0097533 | 3300042435 | Unclassified | 945 |
| 185 | Ga0451577_0621449 | 3300042876 | Bacteria | 980 |
| 186 | Ga0466963_0100573 | 3300044694 | Bacteria | 1979 |
| 187 | Ga0451576_0010370 | 3300045051 | Bacteria | 10697 |
| 188 | Ga0451576_0025729 | 3300045051 | Bacteria | 6339 |
| 189 | Ga0451576_0196588 | 3300045051 | Bacteria | 2106 |
| 190 | Ga0495603_0146126 | 3300046455 | Unclassified | 1374 |
| 191 | Ga0495580_0009998 | 3300046472 | Bacteria | 7417 |
| 192 | Ga0495582_0037940 | 3300046473 | Unclassified | 2650 |
| 193 | Ga0495639_0001879 | 3300046475 | Bacteria | 9307 |
| 194 | Ga0495594_0095255 | 3300046499 | Unclassified | 1671 |
| 195 | Ga0495630_0107778 | 3300046517 | Unclassified | 2110 |
| 196 | Ga0495644_0098500 | 3300046523 | Bacteria | 1106 |
| 197 | Ga0495666_0006208 | 3300046526 | Bacteria | 6015 |
| 198 | Ga0495652_0077990 | 3300046529 | Bacteria | 2744 |
| 199 | Ga0495665_0028411 | 3300046531 | Unclassified | 2999 |
| 200 | Ga0495586_0002704 | 3300046535 | Bacteria | 9587 |
| 201 | Ga0495598_0088147 | 3300046537 | Bacteria | 1007 |
| 202 | Ga0495659_0100314 | 3300046664 | Bacteria | 1121 |
| 203 | Ga0495588_0012870 | 3300046674 | Bacteria | 3968 |
| 204 | Ga0495599_0125265 | 3300046678 | Unclassified | 1597 |
| 205 | Ga0495647_0000337 | 3300046681 | Bacteria | 13175 |
| 206 | Ga0495658_0002650 | 3300046683 | Bacteria | 8997 |
| 207 | Ga0495581_0016637 | 3300047315 | Bacteria | 4275 |
| 208 | Ga0495676_0021039 | 3300047321 | Bacteria | 5709 |
| 209 | Ga0495602_0196580 | 3300048088 | Unclassified | 1542 |
| 210 | Ga0496106_0637638 | 3300048909 | Bacteria | 852 |
| 211 | Ga0501031_0092445 | 3300049568 | Bacteria | 1974 |
| 212 | Ga0501039_0750084 | 3300049575 | Bacteria | 762 |
| 213 | Ga0501040_0051434 | 3300049576 | Bacteria | 2818 |
| 214 | Ga0501040_0130817 | 3300049576 | Bacteria | 1765 |
| 215 | Ga0501046_0206906 | 3300049580 | Bacteria | 1458 |
| 216 | Ga0501070_0669676 | 3300049586 | Bacteria | 823 |
| 217 | Ga0501072_0032890 | 3300049588 | Bacteria | 4062 |
| 218 | Ga0501072_0279418 | 3300049588 | Bacteria | 1328 |
| 219 | Ga0501073_0013663 | 3300049589 | Bacteria | 5907 |
| 220 | Ga0501075_0484339 | 3300049591 | Bacteria | 944 |
| 221 | Ga0501076_0585723 | 3300049592 | Bacteria | 920 |
| 222 | Ga0501077_0144763 | 3300049593 | Bacteria | 1508 |
| 223 | Ga0501077_0498607 | 3300049593 | Bacteria | 781 |
| 224 | Ga0501079_0390938 | 3300049741 | Unclassified | 1091 |
| 225 | Ga0501083_0032741 | 3300049744 | Bacteria | 3563 |
| 226 | Ga0501045_0277790 | 3300049824 | Bacteria | 1247 |
| 227 | nmdc:mga05p37_834_c1 | 3300050507 | Bacteria | 34530 |
| 228 | nmdc:mga09592_2751_c1 | 3300050508 | Bacteria | 14213 |
| 229 | nmdc:mga09592_9326_c1 | 3300050508 | Bacteria | 7980 |
| 230 | nmdc:mga0qj67_400_c1 | 3300050509 | Bacteria | 29888 |
| 231 | nmdc:mga06r32_358885_c1 | 3300050510 | Bacteria | 1441 |
| 232 | nmdc:mga06r32_454357_c1 | 3300050510 | Bacteria | 1260 |
| 233 | nmdc:mga08y16_11_c1 | 3300050511 | Bacteria | 463712 |
| 234 | nmdc:mga08y16_19326_c1 | 3300050511 | Bacteria | 7181 |
| 235 | nmdc:mga08y16_822328_c1 | 3300050511 | Bacteria | 920 |
| 236 | nmdc:mga0n895_222865_c1 | 3300050512 | Bacteria | 1914 |
| 237 | nmdc:mga0n895_34018_c1 | 3300050512 | Bacteria | 4903 |
| 238 | nmdc:mga0rr50_43005_c1 | 3300050513 | Bacteria | 3303 |
| 239 | nmdc:mga08x19_1311_c1 | 3300050514 | Bacteria | 15443 |
| 240 | nmdc:mga08x19_491178_c1 | 3300050514 | Bacteria | 866 |
| 241 | nmdc:mga0a205_131073_c1 | 3300050515 | Bacteria | 2407 |
| 242 | nmdc:mga0a205_46108_c1 | 3300050515 | Bacteria | 4204 |
| 243 | Ga0495655_0000080 | 3300053083 | Bacteria | 18417 |
| 244 | Ga0495655_0014175 | 3300053083 | Bacteria | 1666 |
| 245 | Ga0590071_010125 | 3300059421 | Bacteria | 2208 |
| 246 | Ga0501082_0143989 | 3300060353 | Bacteria | 2069 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0130817 | Ga0501040_0130817_450_983 | 175 |
| 2 | 3300049592 | Ga0501076_0585723 | Ga0501076_0585723_230_763 | 175 |
| 3 | 3300036401 | Ga0373937_1438341 | Ga0373937_1438341_37_609 | 182 |
| 4 | 3300034818 | Ga0373950_0006976 | Ga0373950_0006976_319_900 | 185 |
| 5 | 3300049575 | Ga0501039_0750084 | Ga0501039_0750084_158_721 | 185 |
| 6 | 3300049741 | Ga0501079_0390938 | Ga0501079_0390938_279_842 | 185 |
| 7 | 3300049744 | Ga0501083_0032741 | Ga0501083_0032741_15_599 | 188 |
| 8 | 3300005336 | Ga0070680_100395272 | Ga0070680_1003952722 | 192 |
| 9 | 3300006846 | Ga0075430_100001623 | Ga0075430_10000162318 | 192 |
| 10 | 3300026075 | Ga0207708_10091818 | Ga0207708_100918184 | 192 |
| 11 | 3300031548 | Ga0307408_100244643 | Ga0307408_1002446431 | 192 |
| 12 | 3300041408 | Ga0439453_0009601 | Ga0439453_0009601_922_1521 | 192 |
| 13 | 3300042003 | Ga0439443_004645 | Ga0439443_004645_1176_1775 | 192 |
| 14 | 3300042435 | Ga0439434_0097533 | Ga0439434_0097533_81_680 | 192 |
| 15 | 3300050509 | nmdc:mga0qj67_400_c1 | nmdc:mga0qj67_400_c1_19890_20489 | 192 |
| 16 | 3300053083 | Ga0495655_0000080 | Ga0495655_0000080_2989_3591 | 194 |
| 17 | 3300005544 | Ga0070686_100468025 | Ga0070686_1004680251 | 195 |
| 18 | 3300006844 | Ga0075428_100002006 | Ga0075428_1000020067 | 195 |
| 19 | 3300006880 | Ga0075429_100013850 | Ga0075429_1000138505 | 195 |
| 20 | 3300009094 | Ga0111539_10003904 | Ga0111539_1000390414 | 195 |
| 21 | 3300013307 | Ga0157372_11233763 | Ga0157372_112337632 | 195 |
| 22 | 3300027907 | Ga0207428_10002931 | Ga0207428_1000293110 | 195 |
| 23 | 3300049588 | Ga0501072_0279418 | Ga0501072_0279418_423_1034 | 195 |
| 24 | 3300050508 | nmdc:mga09592_9326_c1 | nmdc:mga09592_9326_c1_6882_7493 | 195 |
| 25 | 3300050511 | nmdc:mga08y16_19326_c1 | nmdc:mga08y16_19326_c1_4508_5119 | 195 |
| 26 | 3300005436 | Ga0070713_100002703 | Ga0070713_1000027036 | 196 |
| 27 | 3300006028 | Ga0070717_10000048 | Ga0070717_1000004884 | 196 |
| 28 | 3300006844 | Ga0075428_100020231 | Ga0075428_1000202315 | 196 |
| 29 | 3300025928 | Ga0207700_10013402 | Ga0207700_100134022 | 196 |
| 30 | 3300049568 | Ga0501031_0092445 | Ga0501031_0092445_1020_1634 | 196 |
| 31 | 3300049576 | Ga0501040_0051434 | Ga0501040_0051434_550_1164 | 196 |
| 32 | 3300049580 | Ga0501046_0206906 | Ga0501046_0206906_137_751 | 196 |
| 33 | 3300049586 | Ga0501070_0669676 | Ga0501070_0669676_110_724 | 196 |
| 34 | 3300049588 | Ga0501072_0032890 | Ga0501072_0032890_716_1330 | 196 |
| 35 | 3300049593 | Ga0501077_0498607 | Ga0501077_0498607_77_691 | 196 |
| 36 | 3300050510 | nmdc:mga06r32_358885_c1 | nmdc:mga06r32_358885_c1_345_953 | 196 |
| 37 | 3300050511 | nmdc:mga08y16_822328_c1 | nmdc:mga08y16_822328_c1_260_874 | 196 |
| 38 | 3300059421 | Ga0590071_010125 | Ga0590071_010125_568_1182 | 196 |
| 39 | 3300060353 | Ga0501082_0143989 | Ga0501082_0143989_703_1317 | 196 |
| 40 | 3300005295 | Ga0065707_10116773 | Ga0065707_101167733 | 197 |
| 41 | 3300005336 | Ga0070680_100182321 | Ga0070680_1001823213 | 197 |
| 42 | 3300009094 | Ga0111539_10000006 | Ga0111539_10000006110 | 197 |
| 43 | 3300027907 | Ga0207428_10000007 | Ga0207428_10000007110 | 197 |
| 44 | 3300050511 | nmdc:mga08y16_11_c1 | nmdc:mga08y16_11_c1_317396_318007 | 197 |
| 45 | 3300005295 | Ga0065707_10178764 | Ga0065707_101787643 | 198 |
| 46 | 3300006844 | Ga0075428_100001109 | Ga0075428_1000011098 | 198 |
| 47 | 3300006847 | Ga0075431_100494341 | Ga0075431_1004943413 | 198 |
| 48 | 3300006871 | Ga0075434_100249530 | Ga0075434_1002495303 | 198 |
| 49 | 3300006880 | Ga0075429_100001595 | Ga0075429_1000015958 | 198 |
| 50 | 3300009147 | Ga0114129_10002499 | Ga0114129_1000249926 | 198 |
| 51 | 3300027907 | Ga0207428_10024432 | Ga0207428_100244324 | 198 |
| 52 | 3300031995 | Ga0307409_100430934 | Ga0307409_1004309342 | 198 |
| 53 | 3300034816 | Ga0373930_0016109 | Ga0373930_0016109_151_771 | 198 |
| 54 | 3300034817 | Ga0373948_0008953 | Ga0373948_0008953_253_873 | 198 |
| 55 | 3300035084 | Ga0373928_0015824 | Ga0373928_0015824_635_1255 | 198 |
| 56 | 3300035090 | Ga0373949_0001774 | Ga0373949_0001774_1088_1708 | 198 |
| 57 | 3300035091 | Ga0373951_0004164 | Ga0373951_0004164_2323_2943 | 198 |
| 58 | 3300035114 | Ga0373939_0004495 | Ga0373939_0004495_829_1449 | 198 |
| 59 | 3300035115 | Ga0373941_0006853 | Ga0373941_0006853_973_1593 | 198 |
| 60 | 3300035207 | Ga0373942_0000743 | Ga0373942_0000743_5531_6151 | 198 |
| 61 | 3300035691 | Ga0373931_0000635 | Ga0373931_0000635_2207_2827 | 198 |
| 62 | 3300045051 | Ga0451576_0010370 | Ga0451576_0010370_6305_6925 | 198 |
| 63 | 3300045051 | Ga0451576_0196588 | Ga0451576_0196588_1076_1696 | 198 |
| 64 | 3300046664 | Ga0495659_0100314 | Ga0495659_0100314_26_646 | 198 |
| 65 | 3300049589 | Ga0501073_0013663 | Ga0501073_0013663_3586_4200 | 198 |
| 66 | 3300049591 | Ga0501075_0484339 | Ga0501075_0484339_107_727 | 198 |
| 67 | 3300049593 | Ga0501077_0144763 | Ga0501077_0144763_767_1381 | 198 |
| 68 | 3300049824 | Ga0501045_0277790 | Ga0501045_0277790_186_806 | 198 |
| 69 | 3300050507 | nmdc:mga05p37_834_c1 | nmdc:mga05p37_834_c1_32340_32960 | 198 |
| 70 | 3300050508 | nmdc:mga09592_2751_c1 | nmdc:mga09592_2751_c1_2697_3317 | 198 |
| 71 | 3300050510 | nmdc:mga06r32_454357_c1 | nmdc:mga06r32_454357_c1_570_1190 | 198 |
| 72 | 3300050512 | nmdc:mga0n895_222865_c1 | nmdc:mga0n895_222865_c1_906_1526 | 198 |
| 73 | 3300053083 | Ga0495655_0014175 | Ga0495655_0014175_770_1384 | 198 |
| 74 | 3300005328 | Ga0070676_10081841 | Ga0070676_100818414 | 199 |
| 75 | 3300005330 | Ga0070690_100000455 | Ga0070690_10000045517 | 199 |
| 76 | 3300005335 | Ga0070666_10296349 | Ga0070666_102963492 | 199 |
| 77 | 3300005337 | Ga0070682_100000749 | Ga0070682_10000074910 | 199 |
| 78 | 3300005338 | Ga0068868_100000855 | Ga0068868_10000085513 | 199 |
| 79 | 3300005340 | Ga0070689_100000665 | Ga0070689_10000066517 | 199 |
| 80 | 3300005340 | Ga0070689_100061985 | Ga0070689_1000619856 | 199 |
| 81 | 3300005341 | Ga0070691_10000653 | Ga0070691_100006534 | 199 |
| 82 | 3300005343 | Ga0070687_100000628 | Ga0070687_1000006283 | 199 |
| 83 | 3300005345 | Ga0070692_10000818 | Ga0070692_1000081818 | 199 |
| 84 | 3300005365 | Ga0070688_100027213 | Ga0070688_1000272133 | 199 |
| 85 | 3300005438 | Ga0070701_10000790 | Ga0070701_1000079017 | 199 |
| 86 | 3300005441 | Ga0070700_100000345 | Ga0070700_1000003459 | 199 |
| 87 | 3300005444 | Ga0070694_100000942 | Ga0070694_1000009426 | 199 |
| 88 | 3300005459 | Ga0068867_100000396 | Ga0068867_10000039619 | 199 |
| 89 | 3300005530 | Ga0070679_100003049 | Ga0070679_1000030495 | 199 |
| 90 | 3300005536 | Ga0070697_100426279 | Ga0070697_1004262792 | 199 |
| 91 | 3300005539 | Ga0068853_100063900 | Ga0068853_1000639002 | 199 |
| 92 | 3300005543 | Ga0070672_100270074 | Ga0070672_1002700743 | 199 |
| 93 | 3300005544 | Ga0070686_100001357 | Ga0070686_10000135712 | 199 |
| 94 | 3300005545 | Ga0070695_100001609 | Ga0070695_1000016093 | 199 |
| 95 | 3300005546 | Ga0070696_100208444 | Ga0070696_1002084442 | 199 |
| 96 | 3300005547 | Ga0070693_100000009 | Ga0070693_10000000967 | 199 |
| 97 | 3300005549 | Ga0070704_100000091 | Ga0070704_10000009117 | 199 |
| 98 | 3300005563 | Ga0068855_100003912 | Ga0068855_10000391218 | 199 |
| 99 | 3300005578 | Ga0068854_100081250 | Ga0068854_1000812503 | 199 |
| 100 | 3300005614 | Ga0068856_100570106 | Ga0068856_1005701061 | 199 |
| 101 | 3300005615 | Ga0070702_100000066 | Ga0070702_10000006617 | 199 |
| 102 | 3300005615 | Ga0070702_100240461 | Ga0070702_1002404612 | 199 |
| 103 | 3300005617 | Ga0068859_100003675 | Ga0068859_1000036756 | 199 |
| 104 | 3300005718 | Ga0068866_10000144 | Ga0068866_1000014418 | 199 |
| 105 | 3300005719 | Ga0068861_100000231 | Ga0068861_10000023119 | 199 |
| 106 | 3300005840 | Ga0068870_10040978 | Ga0068870_100409785 | 199 |
| 107 | 3300005842 | Ga0068858_100000921 | Ga0068858_10000092119 | 199 |
| 108 | 3300005843 | Ga0068860_100002180 | Ga0068860_10000218018 | 199 |
| 109 | 3300005843 | Ga0068860_100121085 | Ga0068860_1001210854 | 199 |
| 110 | 3300006173 | Ga0070716_100650489 | Ga0070716_1006504891 | 199 |
| 111 | 3300006237 | Ga0097621_100000596 | Ga0097621_10000059621 | 199 |
| 112 | 3300006358 | Ga0068871_100000495 | Ga0068871_10000049526 | 199 |
| 113 | 3300006852 | Ga0075433_10009402 | Ga0075433_100094029 | 199 |
| 114 | 3300006871 | Ga0075434_100000549 | Ga0075434_1000005495 | 199 |
| 115 | 3300006881 | Ga0068865_100001943 | Ga0068865_10000194319 | 199 |
| 116 | 3300006914 | Ga0075436_100001086 | Ga0075436_1000010863 | 199 |
| 117 | 3300006931 | Ga0097620_100003675 | Ga0097620_1000036756 | 199 |
| 118 | 3300007076 | Ga0075435_100009910 | Ga0075435_1000099103 | 199 |
| 119 | 3300009092 | Ga0105250_10042720 | Ga0105250_100427202 | 199 |
| 120 | 3300009094 | Ga0111539_10225338 | Ga0111539_102253383 | 199 |
| 121 | 3300009098 | Ga0105245_10000830 | Ga0105245_1000083018 | 199 |
| 122 | 3300009148 | Ga0105243_10000809 | Ga0105243_1000080920 | 199 |
| 123 | 3300009176 | Ga0105242_10000501 | Ga0105242_1000050122 | 199 |
| 124 | 3300009177 | Ga0105248_10326522 | Ga0105248_103265222 | 199 |
| 125 | 3300009553 | Ga0105249_10001520 | Ga0105249_1000152012 | 199 |
| 126 | 3300013297 | Ga0157378_10011388 | Ga0157378_1001138812 | 199 |
| 127 | 3300014326 | Ga0157380_10042247 | Ga0157380_100422474 | 199 |
| 128 | 3300014969 | Ga0157376_10002985 | Ga0157376_100029854 | 199 |
| 129 | 3300021358 | Ga0213873_10000003 | Ga0213873_10000003540 | 199 |
| 130 | 3300021384 | Ga0213876_10000003 | Ga0213876_10000003328 | 199 |
| 131 | 3300025885 | Ga0207653_10021677 | Ga0207653_100216773 | 199 |
| 132 | 3300025899 | Ga0207642_10000370 | Ga0207642_1000037018 | 199 |
| 133 | 3300025904 | Ga0207647_10142497 | Ga0207647_101424973 | 199 |
| 134 | 3300025907 | Ga0207645_10380833 | Ga0207645_103808332 | 199 |
| 135 | 3300025908 | Ga0207643_10156789 | Ga0207643_101567892 | 199 |
| 136 | 3300025917 | Ga0207660_10001746 | Ga0207660_100017469 | 199 |
| 137 | 3300025918 | Ga0207662_10000129 | Ga0207662_1000012941 | 199 |
| 138 | 3300025919 | Ga0207657_10473932 | Ga0207657_104739322 | 199 |
| 139 | 3300025927 | Ga0207687_10002926 | Ga0207687_1000292619 | 199 |
| 140 | 3300025934 | Ga0207686_10001808 | Ga0207686_1000180820 | 199 |
| 141 | 3300025938 | Ga0207704_10003728 | Ga0207704_100037283 | 199 |
| 142 | 3300025939 | Ga0207665_10456890 | Ga0207665_104568902 | 199 |
| 143 | 3300025940 | Ga0207691_10280943 | Ga0207691_102809433 | 199 |
| 144 | 3300025941 | Ga0207711_10239862 | Ga0207711_102398622 | 199 |
| 145 | 3300025942 | Ga0207689_10000544 | Ga0207689_1000054418 | 199 |
| 146 | 3300025949 | Ga0207667_10013608 | Ga0207667_100136088 | 199 |
| 147 | 3300025961 | Ga0207712_10006172 | Ga0207712_1000617212 | 199 |
| 148 | 3300025981 | Ga0207640_10089708 | Ga0207640_100897083 | 199 |
| 149 | 3300026035 | Ga0207703_10005033 | Ga0207703_100050337 | 199 |
| 150 | 3300026041 | Ga0207639_10112500 | Ga0207639_101125002 | 199 |
| 151 | 3300026075 | Ga0207708_10000417 | Ga0207708_1000041724 | 199 |
| 152 | 3300026089 | Ga0207648_10000135 | Ga0207648_1000013518 | 199 |
| 153 | 3300026095 | Ga0207676_10198464 | Ga0207676_101984644 | 199 |
| 154 | 3300026118 | Ga0207675_100000999 | Ga0207675_10000099918 | 199 |
| 155 | 3300028380 | Ga0268265_10003508 | Ga0268265_100035083 | 199 |
| 156 | 3300028381 | Ga0268264_10002949 | Ga0268264_100029498 | 199 |
| 157 | 3300028381 | Ga0268264_10024272 | Ga0268264_100242728 | 199 |
| 158 | 3300034820 | Ga0373959_0044266 | Ga0373959_0044266_293_916 | 199 |
| 159 | 3300035083 | Ga0373926_0002058 | Ga0373926_0002058_3173_3796 | 199 |
| 160 | 3300035089 | Ga0373944_0001231 | Ga0373944_0001231_3980_4603 | 199 |
| 161 | 3300035092 | Ga0373952_0026442 | Ga0373952_0026442_68_691 | 199 |
| 162 | 3300035113 | Ga0373936_0003283 | Ga0373936_0003283_3196_3819 | 199 |
| 163 | 3300035113 | Ga0373936_0013995 | Ga0373936_0013995_638_1261 | 199 |
| 164 | 3300035116 | Ga0373945_0001248 | Ga0373945_0001248_3255_3878 | 199 |
| 165 | 3300035170 | Ga0373943_0001683 | Ga0373943_0001683_3227_3850 | 199 |
| 166 | 3300035170 | Ga0373943_0009619 | Ga0373943_0009619_2589_3212 | 199 |
| 167 | 3300035171 | Ga0373946_0002413 | Ga0373946_0002413_2931_3554 | 199 |
| 168 | 3300035171 | Ga0373946_0031543 | Ga0373946_0031543_660_1283 | 199 |
| 169 | 3300035410 | Ga0373924_0186892 | Ga0373924_0186892_144_767 | 199 |
| 170 | 3300035691 | Ga0373931_0002692 | Ga0373931_0002692_1322_1945 | 199 |
| 171 | 3300035691 | Ga0373931_0066710 | Ga0373931_0066710_826_1449 | 199 |
| 172 | 3300035692 | Ga0373935_0010331 | Ga0373935_0010331_4313_4936 | 199 |
| 173 | 3300035692 | Ga0373935_0019773 | Ga0373935_0019773_2241_2864 | 199 |
| 174 | 3300035695 | Ga0373927_0010855 | Ga0373927_0010855_1731_2354 | 199 |
| 175 | 3300035725 | Ga0373947_0007412 | Ga0373947_0007412_4484_5107 | 199 |
| 176 | 3300035725 | Ga0373947_0013930 | Ga0373947_0013930_1246_1869 | 199 |
| 177 | 3300037068 | Ga0373925_0004033 | Ga0373925_0004033_1021_1644 | 199 |
| 178 | 3300037068 | Ga0373925_0018726 | Ga0373925_0018726_3128_3751 | 199 |
| 179 | 3300039437 | Ga0436365_1186993 | Ga0436365_1186993_143534_144151 | 199 |
| 180 | 3300039453 | Ga0436362_1234996 | Ga0436362_1234996_67270_67887 | 199 |
| 181 | 3300042876 | Ga0451577_0621449 | Ga0451577_0621449_150_773 | 199 |
| 182 | 3300045051 | Ga0451576_0025729 | Ga0451576_0025729_1679_2302 | 199 |
| 183 | 3300046455 | Ga0495603_0146126 | Ga0495603_0146126_243_866 | 199 |
| 184 | 3300046472 | Ga0495580_0009998 | Ga0495580_0009998_1281_1904 | 199 |
| 185 | 3300046473 | Ga0495582_0037940 | Ga0495582_0037940_659_1282 | 199 |
| 186 | 3300046475 | Ga0495639_0001879 | Ga0495639_0001879_6089_6712 | 199 |
| 187 | 3300046499 | Ga0495594_0095255 | Ga0495594_0095255_716_1339 | 199 |
| 188 | 3300046517 | Ga0495630_0107778 | Ga0495630_0107778_1137_1760 | 199 |
| 189 | 3300046523 | Ga0495644_0098500 | Ga0495644_0098500_161_784 | 199 |
| 190 | 3300046526 | Ga0495666_0006208 | Ga0495666_0006208_2204_2827 | 199 |
| 191 | 3300046531 | Ga0495665_0028411 | Ga0495665_0028411_596_1219 | 199 |
| 192 | 3300046535 | Ga0495586_0002704 | Ga0495586_0002704_1304_1927 | 199 |
| 193 | 3300046537 | Ga0495598_0088147 | Ga0495598_0088147_261_884 | 199 |
| 194 | 3300046674 | Ga0495588_0012870 | Ga0495588_0012870_824_1447 | 199 |
| 195 | 3300046681 | Ga0495647_0000337 | Ga0495647_0000337_3506_4129 | 199 |
| 196 | 3300046683 | Ga0495658_0002650 | Ga0495658_0002650_4637_5260 | 199 |
| 197 | 3300047315 | Ga0495581_0016637 | Ga0495581_0016637_2221_2844 | 199 |
| 198 | 3300047321 | Ga0495676_0021039 | Ga0495676_0021039_1245_1868 | 199 |
| 199 | 3300048909 | Ga0496106_0637638 | Ga0496106_0637638_99_722 | 199 |
| 200 | 3300050512 | nmdc:mga0n895_34018_c1 | nmdc:mga0n895_34018_c1_1551_2174 | 199 |
| 201 | 3300050513 | nmdc:mga0rr50_43005_c1 | nmdc:mga0rr50_43005_c1_1924_2547 | 199 |
| 202 | 3300050514 | nmdc:mga08x19_1311_c1 | nmdc:mga08x19_1311_c1_12328_12951 | 199 |
| 203 | 3300050515 | nmdc:mga0a205_46108_c1 | nmdc:mga0a205_46108_c1_596_1219 | 199 |
| 204 | iso_pu_bacteria | 2911138879 | 2911143363 | 199 |
| 205 | 3300006871 | Ga0075434_100957889 | Ga0075434_1009578892 | 200 |
| 206 | 3300025942 | Ga0207689_10196699 | Ga0207689_101966991 | 200 |
| 207 | 3300005841 | Ga0068863_100447384 | Ga0068863_1004473841 | 204 |
| 208 | 3300026088 | Ga0207641_10303082 | Ga0207641_103030822 | 204 |
| 209 | 3300005367 | Ga0070667_100401479 | Ga0070667_1004014792 | 205 |
| 210 | 3300005843 | Ga0068860_101373512 | Ga0068860_1013735121 | 205 |
| 211 | 3300025907 | Ga0207645_10166756 | Ga0207645_101667562 | 205 |
| 212 | 3300025986 | Ga0207658_10318098 | Ga0207658_103180981 | 205 |
| 213 | 3300031344 | Ga0265316_10365510 | Ga0265316_103655102 | 205 |
| 214 | 3300046678 | Ga0495599_0125265 | Ga0495599_0125265_518_1135 | 205 |
| 215 | 3300005440 | Ga0070705_100457571 | Ga0070705_1004575711 | 206 |
| 216 | 3300005546 | Ga0070696_100566916 | Ga0070696_1005669161 | 206 |
| 217 | 3300005614 | Ga0068856_101354460 | Ga0068856_1013544601 | 207 |
| 218 | 3300026078 | Ga0207702_11270366 | Ga0207702_112703661 | 207 |
| 219 | 3300005367 | Ga0070667_100051758 | Ga0070667_1000517583 | 208 |
| 220 | 3300028380 | Ga0268265_10464885 | Ga0268265_104648852 | 210 |
| 221 | 3300031507 | Ga0307509_10070110 | Ga0307509_100701103 | 213 |
| 222 | 3300005445 | Ga0070708_100327134 | Ga0070708_1003271342 | 214 |
| 223 | 3300035118 | Ga0373954_0035763 | Ga0373954_0035763_1356_2048 | 214 |
| 224 | 3300036401 | Ga0373937_0277081 | Ga0373937_0277081_753_1445 | 214 |
| 225 | 3300046529 | Ga0495652_0077990 | Ga0495652_0077990_867_1559 | 214 |
| 226 | 3300048088 | Ga0495602_0196580 | Ga0495602_0196580_330_1022 | 214 |
| 227 | 3300005327 | Ga0070658_10007568 | Ga0070658_100075686 | 215 |
| 228 | 3300005328 | Ga0070676_10004186 | Ga0070676_100041863 | 215 |
| 229 | 3300005335 | Ga0070666_10028170 | Ga0070666_100281702 | 215 |
| 230 | 3300005347 | Ga0070668_100251652 | Ga0070668_1002516521 | 215 |
| 231 | 3300005548 | Ga0070665_100000688 | Ga0070665_1000006889 | 215 |
| 232 | 3300005548 | Ga0070665_100283667 | Ga0070665_1002836672 | 215 |
| 233 | 3300009177 | Ga0105248_11268702 | Ga0105248_112687021 | 215 |
| 234 | 3300009551 | Ga0105238_10034090 | Ga0105238_100340901 | 215 |
| 235 | 3300013297 | Ga0157378_10484634 | Ga0157378_104846342 | 215 |
| 236 | 3300025907 | Ga0207645_10116878 | Ga0207645_101168782 | 215 |
| 237 | 3300025909 | Ga0207705_10029773 | Ga0207705_100297732 | 215 |
| 238 | 3300025927 | Ga0207687_10258888 | Ga0207687_102588882 | 215 |
| 239 | 3300028379 | Ga0268266_10000684 | Ga0268266_1000068433 | 215 |
| 240 | 3300000532 | CNAas_1000031 | CNAas_10000317 | 216 |
| 241 | 3300005434 | Ga0070709_10238486 | Ga0070709_102384862 | 216 |
| 242 | 3300006852 | Ga0075433_10193798 | Ga0075433_101937982 | 216 |
| 243 | 3300009147 | Ga0114129_10507541 | Ga0114129_105075412 | 216 |
| 244 | 3300038742 | Ga0400486_21331 | Ga0400486_21331_160_831 | 216 |
| 245 | 3300044694 | Ga0466963_0100573 | Ga0466963_0100573_294_983 | 216 |
| 246 | 3300050514 | nmdc:mga08x19_491178_c1 | nmdc:mga08x19_491178_c1_149_835 | 216 |
| 247 | 3300050515 | nmdc:mga0a205_131073_c1 | nmdc:mga0a205_131073_c1_1073_1759 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6we5-assembly1.cif.gz_C | crystal structure of an inorganic pyrophosphatase from chlamydia trachomatis d/uw-3/cx | 0.942 | 15 | 209 |
| 3q5v-assembly1.cif.gz_A | the structure of inorganic pyrophosphatase from thermococcus thioreducens in complex with magnesium and sulfate | 0.9311 | 15 | 210 |
| 1twl-assembly1.cif.gz_A | inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 | 0.9257 | 15 | 208 |
| 3q46-assembly1.cif.gz_A | magnesium activated inorganic pyrophosphatase from thermococcus thioreducens bound to hydrolyzed product at 0.99 angstrom resolution | 0.9228 | 16 | 211 |
| 3r6e-assembly1.cif.gz_B | the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate | 0.9217 | 15 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9326 | 16 | 210 | 3.90.80.10 |
| af_A0A1D6HHJ7_152_313_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9162 | 29 | 208 | 3.90.80.10 |
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9125 | 16 | 210 | 3.90.80.10 |
| af_A0A0R0EZ04_29_196_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9019 | 15 | 201 | 3.90.80.10 |
| 2prdA00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8968 | 15 | 205 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A0FEW2-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9821 | 118 | 207 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A356R824-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.978 | 67 | 215 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A2V8QDL1-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9763 | 75 | 210 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A2V8QDL1-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9693 | 75 | 210 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A059X7K2-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9644 | 44 | 210 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar