F358843

General Info

Members Datasets Scaffolds Average Seq Length
247 192 246 208

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100283667|Ga0070665_1002836672
Length 235
Sequence MAAASSGALWKLLGTLYTAHPWHGISPGENVPAELLCFIEVVPSDTAKYEIDKVSGYLKLDRPQKYSNICPAMYGFIPQTLCGERVAALSSEATGTELVGDGDPLDICILTERPISHGNLLVDCRPIGGFRMLDQGEADDKIIAVLKGDSAYGHCRSVGEIPPAVLDRLRHYFLTYKQPPGVTACTSTITDVYDREVAFEVISRSLADYHERFGSLETLLTEALHFMLGKEEAPA

Samples

Sample ID Description Type Environment
1 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
142 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000031 3300000532 Bacteria 9181
2 Ga0065707_10116773 3300005295 Bacteria 2228
3 Ga0065707_10178764 3300005295 Bacteria 1429
4 Ga0070658_10007568 3300005327 Bacteria 8766
5 Ga0070676_10004186 3300005328 Bacteria 7574
6 Ga0070676_10081841 3300005328 Bacteria 1960
7 Ga0070690_100000455 3300005330 Bacteria 20596
8 Ga0070666_10028170 3300005335 Bacteria 3684
9 Ga0070666_10296349 3300005335 Bacteria 1151
10 Ga0070680_100182321 3300005336 Bacteria 1768
11 Ga0070680_100395272 3300005336 Bacteria 1178
12 Ga0070682_100000749 3300005337 Bacteria 19374
13 Ga0068868_100000855 3300005338 Bacteria 20680
14 Ga0070689_100000665 3300005340 Bacteria 20788
15 Ga0070689_100061985 3300005340 Bacteria 2909
16 Ga0070691_10000653 3300005341 Bacteria 13422
17 Ga0070687_100000628 3300005343 Bacteria 11691
18 Ga0070692_10000818 3300005345 Bacteria 10376
19 Ga0070668_100251652 3300005347 Bacteria 1467
20 Ga0070688_100027213 3300005365 Bacteria 3405
21 Ga0070667_100051758 3300005367 Bacteria 3463
22 Ga0070667_100401479 3300005367 Unclassified 1248
23 Ga0070709_10238486 3300005434 Bacteria 1305
24 Ga0070713_100002703 3300005436 Bacteria 11567
25 Ga0070701_10000790 3300005438 Bacteria 11324
26 Ga0070705_100457571 3300005440 Bacteria 959
27 Ga0070700_100000345 3300005441 Bacteria 23964
28 Ga0070694_100000942 3300005444 Bacteria 16439
29 Ga0070708_100327134 3300005445 Bacteria 1444
30 Ga0068867_100000396 3300005459 Bacteria 29178
31 Ga0070679_100003049 3300005530 Bacteria 15314
32 Ga0070697_100426279 3300005536 Bacteria 1153
33 Ga0068853_100063900 3300005539 Bacteria 3190
34 Ga0070672_100270074 3300005543 Bacteria 1436
35 Ga0070686_100001357 3300005544 Bacteria 13844
36 Ga0070686_100468025 3300005544 Bacteria 972
37 Ga0070695_100001609 3300005545 Bacteria 12648
38 Ga0070696_100208444 3300005546 Bacteria 1462
39 Ga0070696_100566916 3300005546 Bacteria 912
40 Ga0070693_100000009 3300005547 Bacteria 77783
41 Ga0070665_100000688 3300005548 Bacteria 45153
42 Ga0070665_100283667 3300005548 Bacteria 1658
43 Ga0070704_100000091 3300005549 Bacteria 31281
44 Ga0068855_100003912 3300005563 Bacteria 18180
45 Ga0068854_100081250 3300005578 Bacteria 2393
46 Ga0068856_100570106 3300005614 Bacteria 1153
47 Ga0068856_101354460 3300005614 Unclassified 726
48 Ga0070702_100000066 3300005615 Bacteria 29418
49 Ga0070702_100240461 3300005615 Bacteria 1222
50 Ga0068859_100003675 3300005617 Bacteria 15626
51 Ga0068866_10000144 3300005718 Bacteria 32128
52 Ga0068861_100000231 3300005719 Bacteria 30386
53 Ga0068870_10040978 3300005840 Bacteria 2404
54 Ga0068863_100447384 3300005841 Bacteria 1268
55 Ga0068858_100000921 3300005842 Bacteria 30521
56 Ga0068860_100002180 3300005843 Bacteria 20596
57 Ga0068860_100121085 3300005843 Bacteria 2506
58 Ga0068860_101373512 3300005843 Archaea 728
59 Ga0070717_10000048 3300006028 Bacteria 104474
60 Ga0070716_100650489 3300006173 Bacteria 799
61 Ga0097621_100000596 3300006237 Bacteria 25478
62 Ga0068871_100000495 3300006358 Bacteria 26957
63 Ga0075428_100001109 3300006844 Bacteria 28681
64 Ga0075428_100002006 3300006844 Bacteria 21940
65 Ga0075428_100020231 3300006844 Bacteria 7371
66 Ga0075430_100001623 3300006846 Bacteria 18369
67 Ga0075431_100494341 3300006847 Bacteria 1215
68 Ga0075433_10009402 3300006852 Bacteria 7810
69 Ga0075433_10193798 3300006852 Bacteria 1808
70 Ga0075434_100000549 3300006871 Bacteria 28671
71 Ga0075434_100249530 3300006871 Bacteria 1794
72 Ga0075434_100957889 3300006871 Bacteria 870
73 Ga0075429_100001595 3300006880 Bacteria 18685
74 Ga0075429_100013850 3300006880 Bacteria 6992
75 Ga0068865_100001943 3300006881 Bacteria 12178
76 Ga0075436_100001086 3300006914 Bacteria 18322
77 Ga0097620_100003675 3300006931 Bacteria 15626
78 Ga0075435_100009910 3300007076 Bacteria 6939
79 Ga0105250_10042720 3300009092 Bacteria 1816
80 Ga0111539_10000006 3300009094 Bacteria 463720
81 Ga0111539_10003904 3300009094 Bacteria 19606
82 Ga0111539_10225338 3300009094 Bacteria 2183
83 Ga0105245_10000830 3300009098 Bacteria 28117
84 Ga0114129_10002499 3300009147 Bacteria 25510
85 Ga0114129_10507541 3300009147 Unclassified 1574
86 Ga0105243_10000809 3300009148 Bacteria 29781
87 Ga0105242_10000501 3300009176 Bacteria 30909
88 Ga0105248_10326522 3300009177 Bacteria 1728
89 Ga0105248_11268702 3300009177 Unclassified 833
90 Ga0105238_10034090 3300009551 Bacteria 5181
91 Ga0105249_10001520 3300009553 Bacteria 20347
92 Ga0157378_10011388 3300013297 Bacteria 7786
93 Ga0157378_10484634 3300013297 Unclassified 1233
94 Ga0157372_11233763 3300013307 Bacteria 864
95 Ga0157380_10042247 3300014326 Bacteria 3563
96 Ga0157376_10002985 3300014969 Bacteria 11599
97 Ga0213873_10000003 3300021358 Bacteria 973849
98 Ga0213876_10000003 3300021384 Bacteria 973849
99 Ga0207653_10021677 3300025885 Bacteria 2038
100 Ga0207642_10000370 3300025899 Bacteria 13564
101 Ga0207647_10142497 3300025904 Bacteria 1404
102 Ga0207645_10116878 3300025907 Bacteria 1729
103 Ga0207645_10166756 3300025907 Bacteria 1442
104 Ga0207645_10380833 3300025907 Bacteria 947
105 Ga0207643_10156789 3300025908 Bacteria 1368
106 Ga0207705_10029773 3300025909 Bacteria 3892
107 Ga0207660_10001746 3300025917 Bacteria 14558
108 Ga0207662_10000129 3300025918 Bacteria 36284
109 Ga0207657_10473932 3300025919 Bacteria 982
110 Ga0207687_10002926 3300025927 Bacteria 11597
111 Ga0207687_10258888 3300025927 Unclassified 1386
112 Ga0207700_10013402 3300025928 Bacteria 5333
113 Ga0207686_10001808 3300025934 Bacteria 11886
114 Ga0207704_10003728 3300025938 Bacteria 6936
115 Ga0207665_10456890 3300025939 Bacteria 981
116 Ga0207691_10280943 3300025940 Bacteria 1432
117 Ga0207711_10239862 3300025941 Bacteria 1662
118 Ga0207689_10000544 3300025942 Bacteria 35849
119 Ga0207689_10196699 3300025942 Bacteria 1664
120 Ga0207667_10013608 3300025949 Bacteria 9299
121 Ga0207712_10006172 3300025961 Bacteria 7550
122 Ga0207640_10089708 3300025981 Bacteria 2125
123 Ga0207658_10318098 3300025986 Archaea 1346
124 Ga0207703_10005033 3300026035 Bacteria 10717
125 Ga0207639_10112500 3300026041 Bacteria 2222
126 Ga0207708_10000417 3300026075 Bacteria 33347
127 Ga0207708_10091818 3300026075 Bacteria 2342
128 Ga0207702_11270366 3300026078 Unclassified 730
129 Ga0207641_10303082 3300026088 Bacteria 1510
130 Ga0207648_10000135 3300026089 Bacteria 73544
131 Ga0207676_10198464 3300026095 Bacteria 1771
132 Ga0207675_100000999 3300026118 Bacteria 27989
133 Ga0207428_10000007 3300027907 Bacteria 463715
134 Ga0207428_10002931 3300027907 Bacteria 16910
135 Ga0207428_10024432 3300027907 Bacteria 5074
136 Ga0268266_10000684 3300028379 Bacteria 45767
137 Ga0268265_10003508 3300028380 Bacteria 11222
138 Ga0268265_10464885 3300028380 Unclassified 1185
139 Ga0268264_10002949 3300028381 Bacteria 14779
140 Ga0268264_10024272 3300028381 Bacteria 4950
141 Ga0265316_10365510 3300031344 Unclassified 1043
142 Ga0307509_10070110 3300031507 Bacteria 3662
143 Ga0307408_100244643 3300031548 Bacteria 1476
144 Ga0307409_100430934 3300031995 Bacteria 1268
145 Ga0373930_0016109 3300034816 Bacteria 1410
146 Ga0373948_0008953 3300034817 Bacteria 1716
147 Ga0373950_0006976 3300034818 Bacteria 1740
148 Ga0373959_0044266 3300034820 Bacteria 944
149 Ga0373926_0002058 3300035083 Bacteria 6334
150 Ga0373928_0015824 3300035084 Bacteria 1538
151 Ga0373944_0001231 3300035089 Bacteria 6423
152 Ga0373949_0001774 3300035090 Bacteria 5941
153 Ga0373951_0004164 3300035091 Bacteria 3456
154 Ga0373952_0026442 3300035092 Bacteria 1261
155 Ga0373936_0003283 3300035113 Bacteria 6063
156 Ga0373936_0013995 3300035113 Unclassified 3064
157 Ga0373939_0004495 3300035114 Bacteria 3303
158 Ga0373941_0006853 3300035115 Bacteria 2763
159 Ga0373945_0001248 3300035116 Bacteria 7734
160 Ga0373954_0035763 3300035118 Bacteria 2304
161 Ga0373943_0001683 3300035170 Bacteria 10039
162 Ga0373943_0009619 3300035170 Bacteria 4333
163 Ga0373946_0002413 3300035171 Bacteria 6607
164 Ga0373946_0031543 3300035171 Bacteria 2123
165 Ga0373942_0000743 3300035207 Bacteria 8994
166 Ga0373924_0186892 3300035410 Unclassified 912
167 Ga0373931_0000635 3300035691 Bacteria 14600
168 Ga0373931_0002692 3300035691 Bacteria 7908
169 Ga0373931_0066710 3300035691 Unclassified 1953
170 Ga0373935_0010331 3300035692 Bacteria 5598
171 Ga0373935_0019773 3300035692 Bacteria 4108
172 Ga0373927_0010855 3300035695 Bacteria 6067
173 Ga0373947_0007412 3300035725 Bacteria 6352
174 Ga0373947_0013930 3300035725 Bacteria 4610
175 Ga0373937_0277081 3300036401 Unclassified 1583
176 Ga0373937_1438341 3300036401 Unclassified 637
177 Ga0373925_0004033 3300037068 Bacteria 11153
178 Ga0373925_0018726 3300037068 Bacteria 5031
179 Ga0400486_21331 3300038742 Bacteria 1422
180 Ga0436365_1186993 3300039437 Bacteria 180001
181 Ga0436362_1234996 3300039453 Bacteria 292548
182 Ga0439453_0009601 3300041408 Unclassified 1579
183 Ga0439443_004645 3300042003 Unclassified 1800
184 Ga0439434_0097533 3300042435 Unclassified 945
185 Ga0451577_0621449 3300042876 Bacteria 980
186 Ga0466963_0100573 3300044694 Bacteria 1979
187 Ga0451576_0010370 3300045051 Bacteria 10697
188 Ga0451576_0025729 3300045051 Bacteria 6339
189 Ga0451576_0196588 3300045051 Bacteria 2106
190 Ga0495603_0146126 3300046455 Unclassified 1374
191 Ga0495580_0009998 3300046472 Bacteria 7417
192 Ga0495582_0037940 3300046473 Unclassified 2650
193 Ga0495639_0001879 3300046475 Bacteria 9307
194 Ga0495594_0095255 3300046499 Unclassified 1671
195 Ga0495630_0107778 3300046517 Unclassified 2110
196 Ga0495644_0098500 3300046523 Bacteria 1106
197 Ga0495666_0006208 3300046526 Bacteria 6015
198 Ga0495652_0077990 3300046529 Bacteria 2744
199 Ga0495665_0028411 3300046531 Unclassified 2999
200 Ga0495586_0002704 3300046535 Bacteria 9587
201 Ga0495598_0088147 3300046537 Bacteria 1007
202 Ga0495659_0100314 3300046664 Bacteria 1121
203 Ga0495588_0012870 3300046674 Bacteria 3968
204 Ga0495599_0125265 3300046678 Unclassified 1597
205 Ga0495647_0000337 3300046681 Bacteria 13175
206 Ga0495658_0002650 3300046683 Bacteria 8997
207 Ga0495581_0016637 3300047315 Bacteria 4275
208 Ga0495676_0021039 3300047321 Bacteria 5709
209 Ga0495602_0196580 3300048088 Unclassified 1542
210 Ga0496106_0637638 3300048909 Bacteria 852
211 Ga0501031_0092445 3300049568 Bacteria 1974
212 Ga0501039_0750084 3300049575 Bacteria 762
213 Ga0501040_0051434 3300049576 Bacteria 2818
214 Ga0501040_0130817 3300049576 Bacteria 1765
215 Ga0501046_0206906 3300049580 Bacteria 1458
216 Ga0501070_0669676 3300049586 Bacteria 823
217 Ga0501072_0032890 3300049588 Bacteria 4062
218 Ga0501072_0279418 3300049588 Bacteria 1328
219 Ga0501073_0013663 3300049589 Bacteria 5907
220 Ga0501075_0484339 3300049591 Bacteria 944
221 Ga0501076_0585723 3300049592 Bacteria 920
222 Ga0501077_0144763 3300049593 Bacteria 1508
223 Ga0501077_0498607 3300049593 Bacteria 781
224 Ga0501079_0390938 3300049741 Unclassified 1091
225 Ga0501083_0032741 3300049744 Bacteria 3563
226 Ga0501045_0277790 3300049824 Bacteria 1247
227 nmdc:mga05p37_834_c1 3300050507 Bacteria 34530
228 nmdc:mga09592_2751_c1 3300050508 Bacteria 14213
229 nmdc:mga09592_9326_c1 3300050508 Bacteria 7980
230 nmdc:mga0qj67_400_c1 3300050509 Bacteria 29888
231 nmdc:mga06r32_358885_c1 3300050510 Bacteria 1441
232 nmdc:mga06r32_454357_c1 3300050510 Bacteria 1260
233 nmdc:mga08y16_11_c1 3300050511 Bacteria 463712
234 nmdc:mga08y16_19326_c1 3300050511 Bacteria 7181
235 nmdc:mga08y16_822328_c1 3300050511 Bacteria 920
236 nmdc:mga0n895_222865_c1 3300050512 Bacteria 1914
237 nmdc:mga0n895_34018_c1 3300050512 Bacteria 4903
238 nmdc:mga0rr50_43005_c1 3300050513 Bacteria 3303
239 nmdc:mga08x19_1311_c1 3300050514 Bacteria 15443
240 nmdc:mga08x19_491178_c1 3300050514 Bacteria 866
241 nmdc:mga0a205_131073_c1 3300050515 Bacteria 2407
242 nmdc:mga0a205_46108_c1 3300050515 Bacteria 4204
243 Ga0495655_0000080 3300053083 Bacteria 18417
244 Ga0495655_0014175 3300053083 Bacteria 1666
245 Ga0590071_010125 3300059421 Bacteria 2208
246 Ga0501082_0143989 3300060353 Bacteria 2069

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0130817 Ga0501040_0130817_450_983 175
2 3300049592 Ga0501076_0585723 Ga0501076_0585723_230_763 175
3 3300036401 Ga0373937_1438341 Ga0373937_1438341_37_609 182
4 3300034818 Ga0373950_0006976 Ga0373950_0006976_319_900 185
5 3300049575 Ga0501039_0750084 Ga0501039_0750084_158_721 185
6 3300049741 Ga0501079_0390938 Ga0501079_0390938_279_842 185
7 3300049744 Ga0501083_0032741 Ga0501083_0032741_15_599 188
8 3300005336 Ga0070680_100395272 Ga0070680_1003952722 192
9 3300006846 Ga0075430_100001623 Ga0075430_10000162318 192
10 3300026075 Ga0207708_10091818 Ga0207708_100918184 192
11 3300031548 Ga0307408_100244643 Ga0307408_1002446431 192
12 3300041408 Ga0439453_0009601 Ga0439453_0009601_922_1521 192
13 3300042003 Ga0439443_004645 Ga0439443_004645_1176_1775 192
14 3300042435 Ga0439434_0097533 Ga0439434_0097533_81_680 192
15 3300050509 nmdc:mga0qj67_400_c1 nmdc:mga0qj67_400_c1_19890_20489 192
16 3300053083 Ga0495655_0000080 Ga0495655_0000080_2989_3591 194
17 3300005544 Ga0070686_100468025 Ga0070686_1004680251 195
18 3300006844 Ga0075428_100002006 Ga0075428_1000020067 195
19 3300006880 Ga0075429_100013850 Ga0075429_1000138505 195
20 3300009094 Ga0111539_10003904 Ga0111539_1000390414 195
21 3300013307 Ga0157372_11233763 Ga0157372_112337632 195
22 3300027907 Ga0207428_10002931 Ga0207428_1000293110 195
23 3300049588 Ga0501072_0279418 Ga0501072_0279418_423_1034 195
24 3300050508 nmdc:mga09592_9326_c1 nmdc:mga09592_9326_c1_6882_7493 195
25 3300050511 nmdc:mga08y16_19326_c1 nmdc:mga08y16_19326_c1_4508_5119 195
26 3300005436 Ga0070713_100002703 Ga0070713_1000027036 196
27 3300006028 Ga0070717_10000048 Ga0070717_1000004884 196
28 3300006844 Ga0075428_100020231 Ga0075428_1000202315 196
29 3300025928 Ga0207700_10013402 Ga0207700_100134022 196
30 3300049568 Ga0501031_0092445 Ga0501031_0092445_1020_1634 196
31 3300049576 Ga0501040_0051434 Ga0501040_0051434_550_1164 196
32 3300049580 Ga0501046_0206906 Ga0501046_0206906_137_751 196
33 3300049586 Ga0501070_0669676 Ga0501070_0669676_110_724 196
34 3300049588 Ga0501072_0032890 Ga0501072_0032890_716_1330 196
35 3300049593 Ga0501077_0498607 Ga0501077_0498607_77_691 196
36 3300050510 nmdc:mga06r32_358885_c1 nmdc:mga06r32_358885_c1_345_953 196
37 3300050511 nmdc:mga08y16_822328_c1 nmdc:mga08y16_822328_c1_260_874 196
38 3300059421 Ga0590071_010125 Ga0590071_010125_568_1182 196
39 3300060353 Ga0501082_0143989 Ga0501082_0143989_703_1317 196
40 3300005295 Ga0065707_10116773 Ga0065707_101167733 197
41 3300005336 Ga0070680_100182321 Ga0070680_1001823213 197
42 3300009094 Ga0111539_10000006 Ga0111539_10000006110 197
43 3300027907 Ga0207428_10000007 Ga0207428_10000007110 197
44 3300050511 nmdc:mga08y16_11_c1 nmdc:mga08y16_11_c1_317396_318007 197
45 3300005295 Ga0065707_10178764 Ga0065707_101787643 198
46 3300006844 Ga0075428_100001109 Ga0075428_1000011098 198
47 3300006847 Ga0075431_100494341 Ga0075431_1004943413 198
48 3300006871 Ga0075434_100249530 Ga0075434_1002495303 198
49 3300006880 Ga0075429_100001595 Ga0075429_1000015958 198
50 3300009147 Ga0114129_10002499 Ga0114129_1000249926 198
51 3300027907 Ga0207428_10024432 Ga0207428_100244324 198
52 3300031995 Ga0307409_100430934 Ga0307409_1004309342 198
53 3300034816 Ga0373930_0016109 Ga0373930_0016109_151_771 198
54 3300034817 Ga0373948_0008953 Ga0373948_0008953_253_873 198
55 3300035084 Ga0373928_0015824 Ga0373928_0015824_635_1255 198
56 3300035090 Ga0373949_0001774 Ga0373949_0001774_1088_1708 198
57 3300035091 Ga0373951_0004164 Ga0373951_0004164_2323_2943 198
58 3300035114 Ga0373939_0004495 Ga0373939_0004495_829_1449 198
59 3300035115 Ga0373941_0006853 Ga0373941_0006853_973_1593 198
60 3300035207 Ga0373942_0000743 Ga0373942_0000743_5531_6151 198
61 3300035691 Ga0373931_0000635 Ga0373931_0000635_2207_2827 198
62 3300045051 Ga0451576_0010370 Ga0451576_0010370_6305_6925 198
63 3300045051 Ga0451576_0196588 Ga0451576_0196588_1076_1696 198
64 3300046664 Ga0495659_0100314 Ga0495659_0100314_26_646 198
65 3300049589 Ga0501073_0013663 Ga0501073_0013663_3586_4200 198
66 3300049591 Ga0501075_0484339 Ga0501075_0484339_107_727 198
67 3300049593 Ga0501077_0144763 Ga0501077_0144763_767_1381 198
68 3300049824 Ga0501045_0277790 Ga0501045_0277790_186_806 198
69 3300050507 nmdc:mga05p37_834_c1 nmdc:mga05p37_834_c1_32340_32960 198
70 3300050508 nmdc:mga09592_2751_c1 nmdc:mga09592_2751_c1_2697_3317 198
71 3300050510 nmdc:mga06r32_454357_c1 nmdc:mga06r32_454357_c1_570_1190 198
72 3300050512 nmdc:mga0n895_222865_c1 nmdc:mga0n895_222865_c1_906_1526 198
73 3300053083 Ga0495655_0014175 Ga0495655_0014175_770_1384 198
74 3300005328 Ga0070676_10081841 Ga0070676_100818414 199
75 3300005330 Ga0070690_100000455 Ga0070690_10000045517 199
76 3300005335 Ga0070666_10296349 Ga0070666_102963492 199
77 3300005337 Ga0070682_100000749 Ga0070682_10000074910 199
78 3300005338 Ga0068868_100000855 Ga0068868_10000085513 199
79 3300005340 Ga0070689_100000665 Ga0070689_10000066517 199
80 3300005340 Ga0070689_100061985 Ga0070689_1000619856 199
81 3300005341 Ga0070691_10000653 Ga0070691_100006534 199
82 3300005343 Ga0070687_100000628 Ga0070687_1000006283 199
83 3300005345 Ga0070692_10000818 Ga0070692_1000081818 199
84 3300005365 Ga0070688_100027213 Ga0070688_1000272133 199
85 3300005438 Ga0070701_10000790 Ga0070701_1000079017 199
86 3300005441 Ga0070700_100000345 Ga0070700_1000003459 199
87 3300005444 Ga0070694_100000942 Ga0070694_1000009426 199
88 3300005459 Ga0068867_100000396 Ga0068867_10000039619 199
89 3300005530 Ga0070679_100003049 Ga0070679_1000030495 199
90 3300005536 Ga0070697_100426279 Ga0070697_1004262792 199
91 3300005539 Ga0068853_100063900 Ga0068853_1000639002 199
92 3300005543 Ga0070672_100270074 Ga0070672_1002700743 199
93 3300005544 Ga0070686_100001357 Ga0070686_10000135712 199
94 3300005545 Ga0070695_100001609 Ga0070695_1000016093 199
95 3300005546 Ga0070696_100208444 Ga0070696_1002084442 199
96 3300005547 Ga0070693_100000009 Ga0070693_10000000967 199
97 3300005549 Ga0070704_100000091 Ga0070704_10000009117 199
98 3300005563 Ga0068855_100003912 Ga0068855_10000391218 199
99 3300005578 Ga0068854_100081250 Ga0068854_1000812503 199
100 3300005614 Ga0068856_100570106 Ga0068856_1005701061 199
101 3300005615 Ga0070702_100000066 Ga0070702_10000006617 199
102 3300005615 Ga0070702_100240461 Ga0070702_1002404612 199
103 3300005617 Ga0068859_100003675 Ga0068859_1000036756 199
104 3300005718 Ga0068866_10000144 Ga0068866_1000014418 199
105 3300005719 Ga0068861_100000231 Ga0068861_10000023119 199
106 3300005840 Ga0068870_10040978 Ga0068870_100409785 199
107 3300005842 Ga0068858_100000921 Ga0068858_10000092119 199
108 3300005843 Ga0068860_100002180 Ga0068860_10000218018 199
109 3300005843 Ga0068860_100121085 Ga0068860_1001210854 199
110 3300006173 Ga0070716_100650489 Ga0070716_1006504891 199
111 3300006237 Ga0097621_100000596 Ga0097621_10000059621 199
112 3300006358 Ga0068871_100000495 Ga0068871_10000049526 199
113 3300006852 Ga0075433_10009402 Ga0075433_100094029 199
114 3300006871 Ga0075434_100000549 Ga0075434_1000005495 199
115 3300006881 Ga0068865_100001943 Ga0068865_10000194319 199
116 3300006914 Ga0075436_100001086 Ga0075436_1000010863 199
117 3300006931 Ga0097620_100003675 Ga0097620_1000036756 199
118 3300007076 Ga0075435_100009910 Ga0075435_1000099103 199
119 3300009092 Ga0105250_10042720 Ga0105250_100427202 199
120 3300009094 Ga0111539_10225338 Ga0111539_102253383 199
121 3300009098 Ga0105245_10000830 Ga0105245_1000083018 199
122 3300009148 Ga0105243_10000809 Ga0105243_1000080920 199
123 3300009176 Ga0105242_10000501 Ga0105242_1000050122 199
124 3300009177 Ga0105248_10326522 Ga0105248_103265222 199
125 3300009553 Ga0105249_10001520 Ga0105249_1000152012 199
126 3300013297 Ga0157378_10011388 Ga0157378_1001138812 199
127 3300014326 Ga0157380_10042247 Ga0157380_100422474 199
128 3300014969 Ga0157376_10002985 Ga0157376_100029854 199
129 3300021358 Ga0213873_10000003 Ga0213873_10000003540 199
130 3300021384 Ga0213876_10000003 Ga0213876_10000003328 199
131 3300025885 Ga0207653_10021677 Ga0207653_100216773 199
132 3300025899 Ga0207642_10000370 Ga0207642_1000037018 199
133 3300025904 Ga0207647_10142497 Ga0207647_101424973 199
134 3300025907 Ga0207645_10380833 Ga0207645_103808332 199
135 3300025908 Ga0207643_10156789 Ga0207643_101567892 199
136 3300025917 Ga0207660_10001746 Ga0207660_100017469 199
137 3300025918 Ga0207662_10000129 Ga0207662_1000012941 199
138 3300025919 Ga0207657_10473932 Ga0207657_104739322 199
139 3300025927 Ga0207687_10002926 Ga0207687_1000292619 199
140 3300025934 Ga0207686_10001808 Ga0207686_1000180820 199
141 3300025938 Ga0207704_10003728 Ga0207704_100037283 199
142 3300025939 Ga0207665_10456890 Ga0207665_104568902 199
143 3300025940 Ga0207691_10280943 Ga0207691_102809433 199
144 3300025941 Ga0207711_10239862 Ga0207711_102398622 199
145 3300025942 Ga0207689_10000544 Ga0207689_1000054418 199
146 3300025949 Ga0207667_10013608 Ga0207667_100136088 199
147 3300025961 Ga0207712_10006172 Ga0207712_1000617212 199
148 3300025981 Ga0207640_10089708 Ga0207640_100897083 199
149 3300026035 Ga0207703_10005033 Ga0207703_100050337 199
150 3300026041 Ga0207639_10112500 Ga0207639_101125002 199
151 3300026075 Ga0207708_10000417 Ga0207708_1000041724 199
152 3300026089 Ga0207648_10000135 Ga0207648_1000013518 199
153 3300026095 Ga0207676_10198464 Ga0207676_101984644 199
154 3300026118 Ga0207675_100000999 Ga0207675_10000099918 199
155 3300028380 Ga0268265_10003508 Ga0268265_100035083 199
156 3300028381 Ga0268264_10002949 Ga0268264_100029498 199
157 3300028381 Ga0268264_10024272 Ga0268264_100242728 199
158 3300034820 Ga0373959_0044266 Ga0373959_0044266_293_916 199
159 3300035083 Ga0373926_0002058 Ga0373926_0002058_3173_3796 199
160 3300035089 Ga0373944_0001231 Ga0373944_0001231_3980_4603 199
161 3300035092 Ga0373952_0026442 Ga0373952_0026442_68_691 199
162 3300035113 Ga0373936_0003283 Ga0373936_0003283_3196_3819 199
163 3300035113 Ga0373936_0013995 Ga0373936_0013995_638_1261 199
164 3300035116 Ga0373945_0001248 Ga0373945_0001248_3255_3878 199
165 3300035170 Ga0373943_0001683 Ga0373943_0001683_3227_3850 199
166 3300035170 Ga0373943_0009619 Ga0373943_0009619_2589_3212 199
167 3300035171 Ga0373946_0002413 Ga0373946_0002413_2931_3554 199
168 3300035171 Ga0373946_0031543 Ga0373946_0031543_660_1283 199
169 3300035410 Ga0373924_0186892 Ga0373924_0186892_144_767 199
170 3300035691 Ga0373931_0002692 Ga0373931_0002692_1322_1945 199
171 3300035691 Ga0373931_0066710 Ga0373931_0066710_826_1449 199
172 3300035692 Ga0373935_0010331 Ga0373935_0010331_4313_4936 199
173 3300035692 Ga0373935_0019773 Ga0373935_0019773_2241_2864 199
174 3300035695 Ga0373927_0010855 Ga0373927_0010855_1731_2354 199
175 3300035725 Ga0373947_0007412 Ga0373947_0007412_4484_5107 199
176 3300035725 Ga0373947_0013930 Ga0373947_0013930_1246_1869 199
177 3300037068 Ga0373925_0004033 Ga0373925_0004033_1021_1644 199
178 3300037068 Ga0373925_0018726 Ga0373925_0018726_3128_3751 199
179 3300039437 Ga0436365_1186993 Ga0436365_1186993_143534_144151 199
180 3300039453 Ga0436362_1234996 Ga0436362_1234996_67270_67887 199
181 3300042876 Ga0451577_0621449 Ga0451577_0621449_150_773 199
182 3300045051 Ga0451576_0025729 Ga0451576_0025729_1679_2302 199
183 3300046455 Ga0495603_0146126 Ga0495603_0146126_243_866 199
184 3300046472 Ga0495580_0009998 Ga0495580_0009998_1281_1904 199
185 3300046473 Ga0495582_0037940 Ga0495582_0037940_659_1282 199
186 3300046475 Ga0495639_0001879 Ga0495639_0001879_6089_6712 199
187 3300046499 Ga0495594_0095255 Ga0495594_0095255_716_1339 199
188 3300046517 Ga0495630_0107778 Ga0495630_0107778_1137_1760 199
189 3300046523 Ga0495644_0098500 Ga0495644_0098500_161_784 199
190 3300046526 Ga0495666_0006208 Ga0495666_0006208_2204_2827 199
191 3300046531 Ga0495665_0028411 Ga0495665_0028411_596_1219 199
192 3300046535 Ga0495586_0002704 Ga0495586_0002704_1304_1927 199
193 3300046537 Ga0495598_0088147 Ga0495598_0088147_261_884 199
194 3300046674 Ga0495588_0012870 Ga0495588_0012870_824_1447 199
195 3300046681 Ga0495647_0000337 Ga0495647_0000337_3506_4129 199
196 3300046683 Ga0495658_0002650 Ga0495658_0002650_4637_5260 199
197 3300047315 Ga0495581_0016637 Ga0495581_0016637_2221_2844 199
198 3300047321 Ga0495676_0021039 Ga0495676_0021039_1245_1868 199
199 3300048909 Ga0496106_0637638 Ga0496106_0637638_99_722 199
200 3300050512 nmdc:mga0n895_34018_c1 nmdc:mga0n895_34018_c1_1551_2174 199
201 3300050513 nmdc:mga0rr50_43005_c1 nmdc:mga0rr50_43005_c1_1924_2547 199
202 3300050514 nmdc:mga08x19_1311_c1 nmdc:mga08x19_1311_c1_12328_12951 199
203 3300050515 nmdc:mga0a205_46108_c1 nmdc:mga0a205_46108_c1_596_1219 199
204 iso_pu_bacteria 2911138879 2911143363 199
205 3300006871 Ga0075434_100957889 Ga0075434_1009578892 200
206 3300025942 Ga0207689_10196699 Ga0207689_101966991 200
207 3300005841 Ga0068863_100447384 Ga0068863_1004473841 204
208 3300026088 Ga0207641_10303082 Ga0207641_103030822 204
209 3300005367 Ga0070667_100401479 Ga0070667_1004014792 205
210 3300005843 Ga0068860_101373512 Ga0068860_1013735121 205
211 3300025907 Ga0207645_10166756 Ga0207645_101667562 205
212 3300025986 Ga0207658_10318098 Ga0207658_103180981 205
213 3300031344 Ga0265316_10365510 Ga0265316_103655102 205
214 3300046678 Ga0495599_0125265 Ga0495599_0125265_518_1135 205
215 3300005440 Ga0070705_100457571 Ga0070705_1004575711 206
216 3300005546 Ga0070696_100566916 Ga0070696_1005669161 206
217 3300005614 Ga0068856_101354460 Ga0068856_1013544601 207
218 3300026078 Ga0207702_11270366 Ga0207702_112703661 207
219 3300005367 Ga0070667_100051758 Ga0070667_1000517583 208
220 3300028380 Ga0268265_10464885 Ga0268265_104648852 210
221 3300031507 Ga0307509_10070110 Ga0307509_100701103 213
222 3300005445 Ga0070708_100327134 Ga0070708_1003271342 214
223 3300035118 Ga0373954_0035763 Ga0373954_0035763_1356_2048 214
224 3300036401 Ga0373937_0277081 Ga0373937_0277081_753_1445 214
225 3300046529 Ga0495652_0077990 Ga0495652_0077990_867_1559 214
226 3300048088 Ga0495602_0196580 Ga0495602_0196580_330_1022 214
227 3300005327 Ga0070658_10007568 Ga0070658_100075686 215
228 3300005328 Ga0070676_10004186 Ga0070676_100041863 215
229 3300005335 Ga0070666_10028170 Ga0070666_100281702 215
230 3300005347 Ga0070668_100251652 Ga0070668_1002516521 215
231 3300005548 Ga0070665_100000688 Ga0070665_1000006889 215
232 3300005548 Ga0070665_100283667 Ga0070665_1002836672 215
233 3300009177 Ga0105248_11268702 Ga0105248_112687021 215
234 3300009551 Ga0105238_10034090 Ga0105238_100340901 215
235 3300013297 Ga0157378_10484634 Ga0157378_104846342 215
236 3300025907 Ga0207645_10116878 Ga0207645_101168782 215
237 3300025909 Ga0207705_10029773 Ga0207705_100297732 215
238 3300025927 Ga0207687_10258888 Ga0207687_102588882 215
239 3300028379 Ga0268266_10000684 Ga0268266_1000068433 215
240 3300000532 CNAas_1000031 CNAas_10000317 216
241 3300005434 Ga0070709_10238486 Ga0070709_102384862 216
242 3300006852 Ga0075433_10193798 Ga0075433_101937982 216
243 3300009147 Ga0114129_10507541 Ga0114129_105075412 216
244 3300038742 Ga0400486_21331 Ga0400486_21331_160_831 216
245 3300044694 Ga0466963_0100573 Ga0466963_0100573_294_983 216
246 3300050514 nmdc:mga08x19_491178_c1 nmdc:mga08x19_491178_c1_149_835 216
247 3300050515 nmdc:mga0a205_131073_c1 nmdc:mga0a205_131073_c1_1073_1759 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

37

210

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6we5-assembly1.cif.gz_C crystal structure of an inorganic pyrophosphatase from chlamydia trachomatis d/uw-3/cx 0.942 15 209
3q5v-assembly1.cif.gz_A the structure of inorganic pyrophosphatase from thermococcus thioreducens in complex with magnesium and sulfate 0.9311 15 210
1twl-assembly1.cif.gz_A inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 0.9257 15 208
3q46-assembly1.cif.gz_A magnesium activated inorganic pyrophosphatase from thermococcus thioreducens bound to hydrolyzed product at 0.99 angstrom resolution 0.9228 16 211
3r6e-assembly1.cif.gz_B the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate 0.9217 15 210
ID Description Score Start End Superfamily
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9326 16 210 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9162 29 208 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9125 16 210 3.90.80.10
af_A0A0R0EZ04_29_196_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9019 15 201 3.90.80.10
2prdA00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8968 15 205 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A3A0FEW2-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9821 118 207 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A356R824-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.978 67 215 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A2V8QDL1-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9763 75 210 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A2V8QDL1-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9693 75 210 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A059X7K2-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9644 44 210 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Feature Viewer

pLDDT pTM Quality
89.34 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map