F358793

General Info

Members Datasets Scaffolds Average Seq Length
247 152 494 427

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10069261|Ga0070710_100692611
Length 470
Sequence LEIAVPCFFSSDFLGQIDRRRLLELASAVAQLEHAGPMQSAVSIDRFRPPIVIRAFNRFGAMLNGKVSRRISPEELIETAKRRANLDDFGDGDFREPLGRLLESCWRDARLNVIGNIALRSDVLRILRNRLLLQRDRSLHSEIAQHQISAPLFVLGLPRTGTTFLHTLLSADPANRAPLTWEVMEPSPPTNAEKQRRIRRASQNLACLEWMAPNFRKLHPVGAKLPQECVSLMSPSFLSDQFDTMYNVPGYRKWFLQQNLPPAYEFHRRFLQHLQQRENGRRWVLKAPTHMFALPTLLAIYPDALFLQTHRAPLEAITSVSSLITILRRVFSDAVDPVKIGAEAIHYWSKTLTKFMSERDRLAPERIFDLSYVELRRDPIRSVRRVYKHFDWLLSLEAENRMREVLAKQPRDVHGFHRYAAAQFGLRPEHEQEFFAEYCERFSVGSAVSTRPVQLTSALNQSRFVRDGLG

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.07
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 29.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10069261 3300005437 Bacteria 2029
2 SwRhRL2b_contig_3930327 2162886007 Unclassified 2534
3 Ga0065704_10075340 3300005289 Bacteria 5634
4 Ga0065712_10001564 3300005290 Bacteria 8859
5 Ga0065712_10097772 3300005290 Unclassified 2140
6 Ga0065715_10009197 3300005293 Unclassified 4960
7 Ga0065715_10119113 3300005293 Bacteria 2295
8 Ga0065715_10185323 3300005293 Bacteria 1429
9 Ga0065707_10001101 3300005295 Bacteria 15152
10 Ga0065707_10163239 3300005295 Bacteria 1539
11 Ga0065707_10168714 3300005295 Bacteria 1490
12 Ga0070676_10013882 3300005328 Unclassified 4419
13 Ga0070676_10026046 3300005328 Bacteria 3310
14 Ga0070676_10119175 3300005328 Bacteria 1654
15 Ga0070683_100047737 3300005329 Bacteria 3957
16 Ga0068868_100062158 3300005338 Unclassified 2959
17 Ga0068868_100087553 3300005338 Bacteria 2505
18 Ga0070689_100000513 3300005340 Bacteria 22812
19 Ga0070689_100077709 3300005340 Bacteria 2602
20 Ga0070687_100018593 3300005343 Bacteria 3218
21 Ga0070668_100046294 3300005347 Unclassified 3339
22 Ga0070668_100051729 3300005347 Bacteria 3166
23 Ga0070668_100068479 3300005347 Unclassified 2759
24 Ga0070669_100024276 3300005353 Bacteria 4347
25 Ga0070669_100037828 3300005353 Bacteria 3501
26 Ga0070675_100009145 3300005354 Bacteria 7696
27 Ga0070675_100011124 3300005354 Bacteria 7042
28 Ga0070675_100101853 3300005354 Bacteria 2419
29 Ga0070675_100119982 3300005354 Bacteria 2233
30 Ga0070673_100012015 3300005364 Bacteria 5930
31 Ga0070673_100086790 3300005364 Unclassified 2550
32 Ga0070688_100027396 3300005365 Unclassified 3395
33 Ga0070688_100170520 3300005365 Unclassified 1501
34 Ga0070667_100076295 3300005367 Unclassified 2862
35 Ga0070667_100093438 3300005367 Unclassified 2590
36 Ga0070713_100206941 3300005436 Bacteria 1775
37 Ga0070711_100032635 3300005439 Bacteria 3463
38 Ga0070711_100045806 3300005439 Bacteria 2978
39 Ga0070711_100104502 3300005439 Bacteria 2066
40 Ga0070711_100139029 3300005439 Bacteria 1818
41 Ga0070705_100003859 3300005440 Bacteria 7332
42 Ga0070705_100049819 3300005440 Unclassified 2434
43 Ga0070708_100044411 3300005445 Unclassified 3907
44 Ga0070708_100054949 3300005445 Bacteria 3539
45 Ga0070708_100071492 3300005445 Bacteria 3124
46 Ga0070678_100035991 3300005456 Unclassified 3462
47 Ga0070662_100047040 3300005457 Bacteria 3101
48 Ga0070706_100033384 3300005467 Bacteria 4750
49 Ga0070707_100000417 3300005468 Bacteria 42073
50 Ga0070707_100034192 3300005468 Bacteria 4847
51 Ga0070707_100102151 3300005468 Bacteria 2778
52 Ga0070707_100109945 3300005468 Bacteria 2673
53 Ga0070698_100000252 3300005471 Bacteria 53672
54 Ga0070698_100008087 3300005471 Bacteria 11374
55 Ga0070698_100017639 3300005471 Bacteria 7521
56 Ga0070699_100019187 3300005518 Bacteria 5884
57 Ga0070684_100000857 3300005535 Bacteria 21480
58 Ga0070684_100069542 3300005535 Bacteria 3096
59 Ga0070697_100002848 3300005536 Bacteria 13296
60 Ga0070697_100023307 3300005536 Bacteria 4922
61 Ga0070697_100047611 3300005536 Bacteria 3476
62 Ga0070697_100052863 3300005536 Bacteria 3302
63 Ga0070697_100205405 3300005536 Bacteria 1675
64 Ga0070672_100012271 3300005543 Bacteria 6006
65 Ga0070696_100024183 3300005546 Bacteria 4128
66 Ga0070665_100017536 3300005548 Bacteria 7190
67 Ga0070665_100034652 3300005548 Bacteria 5077
68 Ga0070704_100000335 3300005549 Bacteria 21330
69 Ga0070704_100022441 3300005549 Unclassified 4108
70 Ga0070704_100064630 3300005549 Unclassified 2631
71 Ga0070664_100025901 3300005564 Unclassified 4863
72 Ga0068857_100175687 3300005577 Bacteria 1948
73 Ga0070702_100084606 3300005615 Bacteria 1908
74 Ga0068861_100047433 3300005719 Bacteria 3242
75 Ga0068863_100001547 3300005841 Bacteria 22708
76 Ga0068863_100090135 3300005841 Bacteria 2908
77 Ga0068858_100003324 3300005842 Bacteria 16007
78 Ga0081455_10000340 3300005937 Bacteria 61240
79 Ga0081455_10002487 3300005937 Bacteria 21900
80 Ga0081455_10004775 3300005937 Bacteria 15056
81 Ga0081455_10009805 3300005937 Bacteria 9809
82 Ga0081455_10043628 3300005937 Bacteria 3920
83 Ga0081538_10003294 3300005981 Bacteria 15324
84 Ga0081538_10025625 3300005981 Bacteria 4150
85 Ga0081540_1000127 3300005983 Bacteria 80551
86 Ga0081539_10021754 3300005985 Bacteria 4270
87 Ga0070717_10011728 3300006028 Bacteria 6669
88 Ga0070717_10017338 3300006028 Bacteria 5603
89 Ga0070717_10045392 3300006028 Bacteria 3592
90 Ga0070717_10101721 3300006028 Bacteria 2441
91 Ga0070715_10063188 3300006163 Bacteria 1631
92 Ga0070716_100054402 3300006173 Unclassified 2286
93 Ga0070712_100005462 3300006175 Bacteria 7870
94 Ga0070712_100011271 3300006175 Bacteria 5663
95 Ga0070712_100075463 3300006175 Unclassified 2424
96 Ga0070712_100111505 3300006175 Unclassified 2042
97 Ga0070712_100125230 3300006175 Unclassified 1940
98 Ga0097621_100147615 3300006237 Bacteria 2015
99 Ga0105245_10058077 3300009098 Unclassified 3482
100 Ga0105245_10131647 3300009098 Unclassified 2347
101 Ga0105245_10295154 3300009098 Bacteria 1589
102 Ga0105247_10052112 3300009101 Bacteria 2522
103 Ga0114129_10207313 3300009147 Bacteria 2652
104 Ga0105241_10071593 3300009174 Unclassified 2691
105 Ga0105249_10002118 3300009553 Bacteria 17242
106 Ga0105249_10055588 3300009553 Bacteria 3622
107 Ga0105239_10082796 3300010375 Bacteria 3534
108 Ga0105239_10277438 3300010375 Bacteria 1886
109 Ga0157374_10068682 3300013296 Unclassified 3335
110 Ga0157374_10068879 3300013296 Unclassified 3330
111 Ga0157374_10165675 3300013296 Bacteria 2154
112 Ga0157374_10167901 3300013296 Bacteria 2139
113 Ga0157374_10310670 3300013296 Bacteria 1561
114 Ga0157378_10007006 3300013297 Bacteria 9835
115 Ga0163162_10042880 3300013306 Bacteria 4529
116 Ga0163162_10046244 3300013306 Unclassified 4362
117 Ga0157372_10123232 3300013307 Bacteria 2979
118 Ga0157375_10003763 3300013308 Bacteria 13155
119 Ga0157375_10047489 3300013308 Unclassified 4193
120 Ga0157375_10089553 3300013308 Unclassified 3134
121 Ga0163163_10029815 3300014325 Bacteria 5250
122 Ga0157380_10000618 3300014326 Bacteria 21908
123 Ga0182008_10046466 3300014497 Unclassified 2158
124 Ga0157379_10004919 3300014968 Bacteria 11469
125 Ga0157376_10101142 3300014969 Unclassified 2518
126 Ga0163161_10020071 3300017792 Unclassified 4688
127 Ga0207673_1001799 3300025290 Bacteria 2383
128 Ga0207697_10000218 3300025315 Bacteria 30853
129 Ga0207697_10000653 3300025315 Bacteria 19754
130 Ga0207697_10001937 3300025315 Bacteria 10996
131 Ga0207697_10003687 3300025315 Bacteria 7502
132 Ga0207697_10004026 3300025315 Bacteria 7122
133 Ga0207692_10013172 3300025898 Unclassified 3580
134 Ga0207688_10012653 3300025901 Unclassified 4591
135 Ga0207680_10028765 3300025903 Bacteria 3113
136 Ga0207680_10053057 3300025903 Unclassified 2432
137 Ga0207685_10012403 3300025905 Unclassified 2599
138 Ga0207645_10002398 3300025907 Bacteria 14743
139 Ga0207645_10002936 3300025907 Bacteria 13177
140 Ga0207684_10004311 3300025910 Bacteria 13460
141 Ga0207684_10005970 3300025910 Bacteria 11141
142 Ga0207707_10165215 3300025912 Bacteria 1934
143 Ga0207693_10008874 3300025915 Bacteria 8212
144 Ga0207693_10009913 3300025915 Bacteria 7746
145 Ga0207693_10018750 3300025915 Bacteria 5507
146 Ga0207693_10031901 3300025915 Unclassified 4162
147 Ga0207693_10163535 3300025915 Unclassified 1751
148 Ga0207663_10013666 3300025916 Unclassified 4419
149 Ga0207663_10043624 3300025916 Unclassified 2747
150 Ga0207660_10170758 3300025917 Bacteria 1683
151 Ga0207662_10026456 3300025918 Bacteria 3346
152 Ga0207657_10171669 3300025919 Bacteria 1756
153 Ga0207652_10028782 3300025921 Unclassified 4638
154 Ga0207646_10002875 3300025922 Bacteria 19978
155 Ga0207646_10068373 3300025922 Bacteria 3172
156 Ga0207646_10075037 3300025922 Bacteria 3021
157 Ga0207681_10026653 3300025923 Unclassified 3730
158 Ga0207681_10179974 3300025923 Bacteria 1609
159 Ga0207659_10152370 3300025926 Unclassified 1806
160 Ga0207700_10185791 3300025928 Unclassified 1743
161 Ga0207700_10189363 3300025928 Unclassified 1728
162 Ga0207664_10110094 3300025929 Unclassified 2289
163 Ga0207664_10151455 3300025929 Unclassified 1970
164 Ga0207664_10231529 3300025929 Bacteria 1606
165 Ga0207644_10024982 3300025931 Unclassified 4104
166 Ga0207706_10014574 3300025933 Bacteria 7121
167 Ga0207706_10015772 3300025933 Bacteria 6830
168 Ga0207706_10206518 3300025933 Unclassified 1722
169 Ga0207670_10000691 3300025936 Bacteria 17819
170 Ga0207670_10091773 3300025936 Bacteria 2148
171 Ga0207669_10077853 3300025937 Bacteria 2110
172 Ga0207665_10011122 3300025939 Bacteria 5904
173 Ga0207691_10001371 3300025940 Bacteria 24295
174 Ga0207661_10129490 3300025944 Bacteria 2159
175 Ga0207661_10186746 3300025944 Bacteria 1814
176 Ga0207651_10103006 3300025960 Unclassified 2123
177 Ga0207712_10005203 3300025961 Bacteria 8230
178 Ga0207668_10081379 3300025972 Unclassified 2349
179 Ga0207668_10103404 3300025972 Unclassified 2121
180 Ga0207658_10080893 3300025986 Unclassified 2490
181 Ga0207658_10202684 3300025986 Bacteria 1657
182 Ga0207677_10155018 3300026023 Bacteria 1772
183 Ga0207703_10004158 3300026035 Bacteria 11938
184 Ga0207678_10011156 3300026067 Bacteria 7892
185 Ga0207678_10076333 3300026067 Bacteria 2870
186 Ga0207675_100070755 3300026118 Bacteria 3260
187 Ga0207683_10037841 3300026121 Unclassified 4203
188 Ga0268266_10029781 3300028379 Unclassified 4638
189 Ga0268266_10055134 3300028379 Unclassified 3417
190 Ga0268266_10201031 3300028379 Unclassified 1824
191 Ga0268265_10024921 3300028380 Bacteria 4240
192 Ga0307409_100054099 3300031995 Bacteria 3089
193 Ga0307409_100091954 3300031995 Unclassified 2488
194 Ga0307416_100028120 3300032002 Bacteria 4177
195 Ga0373934_0024757 3300035086 Bacteria 2322
196 Ga0373954_0015372 3300035118 Bacteria 3422
197 Ga0373946_0091353 3300035171 Bacteria 1350
198 Ga0373955_0077315 3300035172 Unclassified 1874
199 Ga0373927_0059676 3300035695 Bacteria 2467
200 Ga0373947_0022257 3300035725 Bacteria 3674
201 Ga0373925_0134651 3300037068 Unclassified 1930
202 Ga0395900_0016306 3300037418 Bacteria 7573
203 Ga0395898_0002872 3300037466 Bacteria 19658
204 Ga0395905_0253523 3300037471 Bacteria 1644
205 Ga0395901_0003781 3300038443 Bacteria 15247
206 Ga0395901_0028464 3300038443 Bacteria 5746
207 Ga0495592_0057692 3300046454 Bacteria 2865
208 Ga0495629_0110850 3300046459 Bacteria 1913
209 Ga0495582_0047697 3300046473 Unclassified 2359
210 Ga0495584_0056182 3300046491 Unclassified 1981
211 Ga0495628_0059588 3300046516 Bacteria 2996
212 Ga0495652_0050247 3300046529 Bacteria 3565
213 Ga0495586_0030342 3300046535 Unclassified 2893
214 Ga0495587_0108877 3300046536 Bacteria 1592
215 Ga0495645_0008304 3300046543 Bacteria 7246
216 Ga0495657_0109373 3300046675 Unclassified 1753
217 Ga0495599_0005716 3300046678 Bacteria 7459
218 Ga0495623_0021324 3300046679 Bacteria 4184
219 Ga0495646_0011602 3300046680 Bacteria 5598
220 Ga0495658_0067727 3300046683 Unclassified 2065
221 Ga0495624_0030317 3300046690 Bacteria 3524
222 Ga0495604_0046038 3300047317 Bacteria 3402
223 Ga0495680_0047246 3300047322 Bacteria 3387
224 Ga0495675_0028512 3300047444 Bacteria 3558
225 Ga0495602_0044093 3300048088 Bacteria 4049
226 Ga0496100_0009497 3300048903 Bacteria 5466
227 Ga0496101_0018694 3300048904 Unclassified 4716
228 Ga0496102_0017982 3300048905 Bacteria 6203
229 Ga0496102_0054779 3300048905 Unclassified 3637
230 Ga0496106_0007136 3300048909 Bacteria 8252
231 Ga0496106_0208684 3300048909 Bacteria 1555
232 Ga0496107_0001848 3300048910 Bacteria 13380
233 Ga0496107_0217912 3300048910 Unclassified 1420
234 Ga0496108_0191131 3300048911 Unclassified 1774
235 Ga0496110_0192857 3300048913 Bacteria 1850
236 Ga0496112_0016245 3300048915 Bacteria 6966
237 Ga0496112_0320757 3300048915 Bacteria 1493
238 Ga0496113_0029708 3300048916 Unclassified 3951
239 Ga0496115_0019090 3300048918 Bacteria 5271
240 Ga0496115_0031752 3300048918 Unclassified 4163
241 Ga0496118_0043820 3300048921 Unclassified 3512
242 Ga0501298_009732 3300049521 Bacteria 1640
243 Ga0501217_017558 3300049661 Bacteria 1652
244 nmdc:mga05p37_20587_c1 3300050507 Bacteria 7982
245 Ga0495601_0007313 3300053077 Bacteria 6472
246 Ga0590071_007333 3300059421 Bacteria 2609
247 Ga0590077_003858 3300059426 Bacteria 3091
248 Ga0070710_10069261
249 SwRhRL2b_contig_3930327
250 Ga0065704_10075340
251 Ga0065712_10001564
252 Ga0065712_10097772
253 Ga0065715_10009197
254 Ga0065715_10119113
255 Ga0065715_10185323
256 Ga0065707_10001101
257 Ga0065707_10163239
258 Ga0065707_10168714
259 Ga0070676_10013882
260 Ga0070676_10026046
261 Ga0070676_10119175
262 Ga0070683_100047737
263 Ga0068868_100062158
264 Ga0068868_100087553
265 Ga0070689_100000513
266 Ga0070689_100077709
267 Ga0070687_100018593
268 Ga0070668_100046294
269 Ga0070668_100051729
270 Ga0070668_100068479
271 Ga0070669_100024276
272 Ga0070669_100037828
273 Ga0070675_100009145
274 Ga0070675_100011124
275 Ga0070675_100101853
276 Ga0070675_100119982
277 Ga0070673_100012015
278 Ga0070673_100086790
279 Ga0070688_100027396
280 Ga0070688_100170520
281 Ga0070667_100076295
282 Ga0070667_100093438
283 Ga0070713_100206941
284 Ga0070711_100032635
285 Ga0070711_100045806
286 Ga0070711_100104502
287 Ga0070711_100139029
288 Ga0070705_100003859
289 Ga0070705_100049819
290 Ga0070708_100044411
291 Ga0070708_100054949
292 Ga0070708_100071492
293 Ga0070678_100035991
294 Ga0070662_100047040
295 Ga0070706_100033384
296 Ga0070707_100000417
297 Ga0070707_100034192
298 Ga0070707_100102151
299 Ga0070707_100109945
300 Ga0070698_100000252
301 Ga0070698_100008087
302 Ga0070698_100017639
303 Ga0070699_100019187
304 Ga0070684_100000857
305 Ga0070684_100069542
306 Ga0070697_100002848
307 Ga0070697_100023307
308 Ga0070697_100047611
309 Ga0070697_100052863
310 Ga0070697_100205405
311 Ga0070672_100012271
312 Ga0070696_100024183
313 Ga0070665_100017536
314 Ga0070665_100034652
315 Ga0070704_100000335
316 Ga0070704_100022441
317 Ga0070704_100064630
318 Ga0070664_100025901
319 Ga0068857_100175687
320 Ga0070702_100084606
321 Ga0068861_100047433
322 Ga0068863_100001547
323 Ga0068863_100090135
324 Ga0068858_100003324
325 Ga0081455_10000340
326 Ga0081455_10002487
327 Ga0081455_10004775
328 Ga0081455_10009805
329 Ga0081455_10043628
330 Ga0081538_10003294
331 Ga0081538_10025625
332 Ga0081540_1000127
333 Ga0081539_10021754
334 Ga0070717_10011728
335 Ga0070717_10017338
336 Ga0070717_10045392
337 Ga0070717_10101721
338 Ga0070715_10063188
339 Ga0070716_100054402
340 Ga0070712_100005462
341 Ga0070712_100011271
342 Ga0070712_100075463
343 Ga0070712_100111505
344 Ga0070712_100125230
345 Ga0097621_100147615
346 Ga0105245_10058077
347 Ga0105245_10131647
348 Ga0105245_10295154
349 Ga0105247_10052112
350 Ga0114129_10207313
351 Ga0105241_10071593
352 Ga0105249_10002118
353 Ga0105249_10055588
354 Ga0105239_10082796
355 Ga0105239_10277438
356 Ga0157374_10068682
357 Ga0157374_10068879
358 Ga0157374_10165675
359 Ga0157374_10167901
360 Ga0157374_10310670
361 Ga0157378_10007006
362 Ga0163162_10042880
363 Ga0163162_10046244
364 Ga0157372_10123232
365 Ga0157375_10003763
366 Ga0157375_10047489
367 Ga0157375_10089553
368 Ga0163163_10029815
369 Ga0157380_10000618
370 Ga0182008_10046466
371 Ga0157379_10004919
372 Ga0157376_10101142
373 Ga0163161_10020071
374 Ga0207673_1001799
375 Ga0207697_10000218
376 Ga0207697_10000653
377 Ga0207697_10001937
378 Ga0207697_10003687
379 Ga0207697_10004026
380 Ga0207692_10013172
381 Ga0207688_10012653
382 Ga0207680_10028765
383 Ga0207680_10053057
384 Ga0207685_10012403
385 Ga0207645_10002398
386 Ga0207645_10002936
387 Ga0207684_10004311
388 Ga0207684_10005970
389 Ga0207707_10165215
390 Ga0207693_10008874
391 Ga0207693_10009913
392 Ga0207693_10018750
393 Ga0207693_10031901
394 Ga0207693_10163535
395 Ga0207663_10013666
396 Ga0207663_10043624
397 Ga0207660_10170758
398 Ga0207662_10026456
399 Ga0207657_10171669
400 Ga0207652_10028782
401 Ga0207646_10002875
402 Ga0207646_10068373
403 Ga0207646_10075037
404 Ga0207681_10026653
405 Ga0207681_10179974
406 Ga0207659_10152370
407 Ga0207700_10185791
408 Ga0207700_10189363
409 Ga0207664_10110094
410 Ga0207664_10151455
411 Ga0207664_10231529
412 Ga0207644_10024982
413 Ga0207706_10014574
414 Ga0207706_10015772
415 Ga0207706_10206518
416 Ga0207670_10000691
417 Ga0207670_10091773
418 Ga0207669_10077853
419 Ga0207665_10011122
420 Ga0207691_10001371
421 Ga0207661_10129490
422 Ga0207661_10186746
423 Ga0207651_10103006
424 Ga0207712_10005203
425 Ga0207668_10081379
426 Ga0207668_10103404
427 Ga0207658_10080893
428 Ga0207658_10202684
429 Ga0207677_10155018
430 Ga0207703_10004158
431 Ga0207678_10011156
432 Ga0207678_10076333
433 Ga0207675_100070755
434 Ga0207683_10037841
435 Ga0268266_10029781
436 Ga0268266_10055134
437 Ga0268266_10201031
438 Ga0268265_10024921
439 Ga0307409_100054099
440 Ga0307409_100091954
441 Ga0307416_100028120
442 Ga0373934_0024757
443 Ga0373954_0015372
444 Ga0373946_0091353
445 Ga0373955_0077315
446 Ga0373927_0059676
447 Ga0373947_0022257
448 Ga0373925_0134651
449 Ga0395900_0016306
450 Ga0395898_0002872
451 Ga0395905_0253523
452 Ga0395901_0003781
453 Ga0395901_0028464
454 Ga0495592_0057692
455 Ga0495629_0110850
456 Ga0495582_0047697
457 Ga0495584_0056182
458 Ga0495628_0059588
459 Ga0495652_0050247
460 Ga0495586_0030342
461 Ga0495587_0108877
462 Ga0495645_0008304
463 Ga0495657_0109373
464 Ga0495599_0005716
465 Ga0495623_0021324
466 Ga0495646_0011602
467 Ga0495658_0067727
468 Ga0495624_0030317
469 Ga0495604_0046038
470 Ga0495680_0047246
471 Ga0495675_0028512
472 Ga0495602_0044093
473 Ga0496100_0009497
474 Ga0496101_0018694
475 Ga0496102_0017982
476 Ga0496102_0054779
477 Ga0496106_0007136
478 Ga0496106_0208684
479 Ga0496107_0001848
480 Ga0496107_0217912
481 Ga0496108_0191131
482 Ga0496110_0192857
483 Ga0496112_0016245
484 Ga0496112_0320757
485 Ga0496113_0029708
486 Ga0496115_0019090
487 Ga0496115_0031752
488 Ga0496118_0043820
489 Ga0501298_009732
490 Ga0501217_017558
491 nmdc:mga05p37_20587_c1
492 Ga0495601_0007313
493 Ga0590071_007333
494 Ga0590077_003858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13469

Sulfotransfer_3

Sulfotransferase family

151

395

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zq5-assembly1.cif.gz_A crystal structure of sulfotransferase stf1 from mycobacterium tuberculosis h37rv (type1 form) 0.9015 36 403
2z6v-assembly1.cif.gz_A crystal structure of sulfotransferase stf9 from mycobacterium avium 0.8964 34 411
2zq5-assembly1.cif.gz_A crystal structure of sulfotransferase stf1 from mycobacterium tuberculosis h37rv (type1 form) 0.8898 36 403
2z6v-assembly1.cif.gz_A crystal structure of sulfotransferase stf9 from mycobacterium avium 0.8638 34 411
7sce-assembly1.cif.gz_A ternary complex of fixed-arm trx-3ost5 (i299e) with 8mer-2 octasaccharide substrate and co-factor product pap 0.6421 114 361
ID Description Score Start End Superfamily
af_A4HW45_78_437_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9264 81 401 3.40.50.300
af_Q4DDY4_35_448_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9244 38 409 3.40.50.300
af_Q4D429_2_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9111 249 409 3.40.50.300
2zq5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9015 36 403 3.40.50.300
2z6vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8964 34 411 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V5ZTJ6-F1-model_v4 Sulfotransferase 0.9923 100 415 GO:0016740
AF-A0A2V5QI15-F1-model_v4 Sulfotransferase 0.986 146 298 GO:0016740
AF-A0A2V6L4R7-F1-model_v4 Sulfotransferase 0.9824 1 414 GO:0016740
AF-A0A2V5YJC9-F1-model_v4 Sulfotransferase 0.9814 27 415 GO:0016740
AF-A0A2V6HHD1-F1-model_v4 Sulfotransferase 0.9811 1 333 GO:0016740

Map