F358495

General Info

Members Datasets Scaffolds Average Seq Length
246 186 233 327

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0159493|Ga0496125_0159493_146_1225
Length 359
Sequence MQKNQACKAVKLAEIRPKSPIQIDDAPIKFPEGVLMEYSNLGRTGLKISRLALGCMTFGSSKWAPWVLDEEASRPIIEKAVDLGINFFDLADMYSGGASEEVVARVLSPIARHKLVLATKLYNPMSADPNDRGLSRKHIFEAVDGSLKRLGTDYIDLYQLHRFDYETPLEETLDALNDVVRAGKVRYLGASSMHAWQFMKALGMQRANGWAPFVSMQPHYNLIYREEEREMLPLCREEGIGVIPWSPLARGRLAGRSGDATTTRSQTDKTASALYDRSQAQDDAVVAAVRTVAERHGRPPAQIAYAWVATRPGITAPIVGISKLHQFDDAVAALEVKLSDEDVALMEAPYQPKPVAGHQ

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
3 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
4 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
5 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
6 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
7 2643221591 Devosia sp. Root685 Isolate Unclassified
8 2643221679 Angustibacter sp. Root456 Isolate Unclassified
9 2738543024 Aminobacter sp. AP02 Isolate Unclassified
10 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
11 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
12 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
13 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0
Isolates 5.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 0.81
Rhizoplane 2.03
Rhizosphere 80.89
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10032259 3300003215 Bacteria 1750
2 Ga0055536_1002411 3300003781 Bacteria 10511
3 Ga0055540_1003038 3300003792 Bacteria 8373
4 Ga0055531_10000903 3300003794 Bacteria 24149
5 Ga0065712_10002054 3300005290 Bacteria 5663
6 Ga0070676_10002673 3300005328 Bacteria 9179
7 Ga0070683_100000487 3300005329 Bacteria 28009
8 Ga0070690_100002747 3300005330 Bacteria 9499
9 Ga0070670_100000065 3300005331 Bacteria 108496
10 Ga0070670_100000802 3300005331 Bacteria 24446
11 Ga0070670_100006662 3300005331 Bacteria 9787
12 Ga0068869_100000856 3300005334 Bacteria 17466
13 Ga0070666_10062579 3300005335 Bacteria 2521
14 Ga0068868_100306515 3300005338 Bacteria 1350
15 Ga0070689_100206784 3300005340 Bacteria 1605
16 Ga0070668_100026462 3300005347 Bacteria 4402
17 Ga0070669_100007630 3300005353 Bacteria 7731
18 Ga0070669_100178712 3300005353 Bacteria 1659
19 Ga0070675_100005187 3300005354 Bacteria 9935
20 Ga0070675_100006421 3300005354 Bacteria 9023
21 Ga0070675_100087730 3300005354 Bacteria 2602
22 Ga0070671_100007771 3300005355 Bacteria 8565
23 Ga0070671_100063976 3300005355 Bacteria 3064
24 Ga0070674_100046506 3300005356 Bacteria 2969
25 Ga0070673_100040279 3300005364 Bacteria 3583
26 Ga0070667_100031763 3300005367 Bacteria 4402
27 Ga0070709_10018672 3300005434 Bacteria 3999
28 Ga0070713_100298347 3300005436 Bacteria 1483
29 Ga0070701_10035776 3300005438 Bacteria 2498
30 Ga0070700_100000687 3300005441 Bacteria 16695
31 Ga0070694_100231292 3300005444 Bacteria 1391
32 Ga0070708_100491276 3300005445 Bacteria 1158
33 Ga0070678_100207694 3300005456 Bacteria 1620
34 Ga0068867_100008497 3300005459 Bacteria 7247
35 Ga0068867_100195188 3300005459 Bacteria 1618
36 Ga0070684_100000452 3300005535 Bacteria 28009
37 Ga0070684_100429469 3300005535 Bacteria 1220
38 Ga0070672_100018684 3300005543 Bacteria 5018
39 Ga0070672_100208547 3300005543 Bacteria 1636
40 Ga0070686_100009478 3300005544 Bacteria 5475
41 Ga0070695_100011264 3300005545 Bacteria 5348
42 Ga0070695_100224885 3300005545 Bacteria 1354
43 Ga0070665_100004019 3300005548 Bacteria 15490
44 Ga0070665_100474995 3300005548 Bacteria 1261
45 Ga0070664_100020640 3300005564 Bacteria 5427
46 Ga0070664_100145088 3300005564 Bacteria 2093
47 Ga0068857_100000517 3300005577 Bacteria 27794
48 Ga0068854_100066152 3300005578 Bacteria 2630
49 Ga0068859_100023905 3300005617 Bacteria 6133
50 Ga0068859_100035264 3300005617 Bacteria 5020
51 Ga0068859_100189685 3300005617 Bacteria 2140
52 Ga0068859_100384677 3300005617 Bacteria 1499
53 Ga0068864_100000224 3300005618 Bacteria 51280
54 Ga0068864_100031074 3300005618 Bacteria 4530
55 Ga0068866_10104963 3300005718 Bacteria 1566
56 Ga0068861_100006800 3300005719 Bacteria 7812
57 Ga0068863_100000061 3300005841 Bacteria 121811
58 Ga0068858_100012412 3300005842 Bacteria 8033
59 Ga0068858_100022729 3300005842 Bacteria 5847
60 Ga0068860_100000123 3300005843 Bacteria 124700
61 Ga0075365_10001994 3300006038 Bacteria 9670
62 Ga0075368_10013362 3300006042 Bacteria 3013
63 Ga0075369_10048100 3300006186 Bacteria 1840
64 Ga0075366_10046279 3300006195 Bacteria 2578
65 Ga0097621_100134353 3300006237 Bacteria 2109
66 Ga0068871_100097886 3300006358 Bacteria 2453
67 Ga0075430_100000530 3300006846 Bacteria 28693
68 Ga0075430_100012800 3300006846 Bacteria 7147
69 Ga0075431_100491343 3300006847 Bacteria 1219
70 Ga0075434_100324978 3300006871 Bacteria 1559
71 Ga0075429_100015033 3300006880 Bacteria 6711
72 Ga0068865_100014919 3300006881 Bacteria 4947
73 Ga0068865_100140069 3300006881 Bacteria 1823
74 Ga0075436_100026984 3300006914 Bacteria 3954
75 Ga0097620_100023905 3300006931 Bacteria 6133
76 Ga0097620_100035264 3300006931 Bacteria 5020
77 Ga0097620_100189685 3300006931 Bacteria 2140
78 Ga0097620_100384679 3300006931 Bacteria 1499
79 Ga0075435_100026644 3300007076 Bacteria 4513
80 Ga0105251_10022897 3300009011 Bacteria 3233
81 Ga0111539_10000850 3300009094 Bacteria 39822
82 Ga0111539_10067819 3300009094 Bacteria 4212
83 Ga0105245_10277920 3300009098 Bacteria 1636
84 Ga0105247_10008959 3300009101 Bacteria 6098
85 Ga0105247_10131437 3300009101 Bacteria 1632
86 Ga0114129_10406203 3300009147 Bacteria 1794
87 Ga0105242_10007778 3300009176 Bacteria 8247
88 Ga0105248_10001925 3300009177 Bacteria 23047
89 Ga0105248_10015580 3300009177 Bacteria 8381
90 Ga0105248_10131792 3300009177 Bacteria 2820
91 Ga0105248_10481359 3300009177 Bacteria 1399
92 Ga0105238_10003023 3300009551 Bacteria 16786
93 Ga0105249_10000875 3300009553 Bacteria 26753
94 Ga0157374_10163203 3300013296 Bacteria 2171
95 Ga0163162_10016738 3300013306 Bacteria 7166
96 Ga0157375_10164026 3300013308 Bacteria 2366
97 Ga0163163_10021553 3300014325 Bacteria 6084
98 Ga0163163_10059966 3300014325 Bacteria 3766
99 Ga0163163_10065773 3300014325 Bacteria 3600
100 Ga0163163_10188365 3300014325 Bacteria 2111
101 Ga0163163_10349173 3300014325 Bacteria 1535
102 Ga0157380_10082118 3300014326 Bacteria 2637
103 Ga0157379_10004938 3300014968 Bacteria 11445
104 Ga0157379_10044372 3300014968 Bacteria 3969
105 Ga0157379_10366863 3300014968 Bacteria 1320
106 Ga0157376_10028085 3300014969 Bacteria 4468
107 Ga0209455_1016811 3300025272 Bacteria 1557
108 Ga0209676_1001187 3300025292 Bacteria 28036
109 Ga0209758_1001075 3300025297 Bacteria 35521
110 Ga0209050_1012474 3300025298 Bacteria 3890
111 Ga0209051_1001073 3300025303 Bacteria 25371
112 Ga0209257_1001332 3300025304 Bacteria 29987
113 Ga0207642_10023192 3300025899 Bacteria 2475
114 Ga0207710_10035620 3300025900 Bacteria 2190
115 Ga0207680_10044119 3300025903 Bacteria 2620
116 Ga0207680_10060416 3300025903 Bacteria 2307
117 Ga0207699_10083967 3300025906 Bacteria 1982
118 Ga0207645_10007933 3300025907 Bacteria 7457
119 Ga0207643_10017924 3300025908 Bacteria 3878
120 Ga0207646_10105159 3300025922 Bacteria 2531
121 Ga0207694_10015346 3300025924 Bacteria 5778
122 Ga0207650_10000031 3300025925 Bacteria 230128
123 Ga0207650_10042216 3300025925 Bacteria 3345
124 Ga0207650_10159826 3300025925 Bacteria 1784
125 Ga0207650_10234585 3300025925 Bacteria 1481
126 Ga0207650_10271205 3300025925 Bacteria 1379
127 Ga0207659_10000662 3300025926 Bacteria 20344
128 Ga0207659_10008548 3300025926 Bacteria 6363
129 Ga0207659_10008986 3300025926 Bacteria 6230
130 Ga0207659_10028582 3300025926 Bacteria 3791
131 Ga0207700_10075635 3300025928 Bacteria 2610
132 Ga0207644_10004043 3300025931 Bacteria 9513
133 Ga0207686_10001676 3300025934 Bacteria 12340
134 Ga0207686_10032061 3300025934 Bacteria 3125
135 Ga0207709_10008753 3300025935 Bacteria 5582
136 Ga0207704_10003078 3300025938 Bacteria 7535
137 Ga0207704_10101267 3300025938 Bacteria 1921
138 Ga0207691_10048868 3300025940 Bacteria 3876
139 Ga0207691_10081308 3300025940 Bacteria 2912
140 Ga0207711_10110758 3300025941 Bacteria 2441
141 Ga0207711_10186564 3300025941 Bacteria 1888
142 Ga0207689_10005433 3300025942 Bacteria 11402
143 Ga0207689_10055435 3300025942 Bacteria 3262
144 Ga0207661_10000051 3300025944 Bacteria 92442
145 Ga0207679_10044966 3300025945 Bacteria 3190
146 Ga0207651_10002962 3300025960 Bacteria 8215
147 Ga0207712_10000663 3300025961 Bacteria 26711
148 Ga0207668_10003444 3300025972 Bacteria 9282
149 Ga0207658_10000301 3300025986 Bacteria 51412
150 Ga0207677_10225703 3300026023 Bacteria 1505
151 Ga0207703_10008120 3300026035 Bacteria 8296
152 Ga0207708_10001215 3300026075 Bacteria 19449
153 Ga0207641_10001268 3300026088 Bacteria 25135
154 Ga0207648_10003495 3300026089 Bacteria 16460
155 Ga0207676_10001915 3300026095 Bacteria 15194
156 Ga0207676_10008100 3300026095 Bacteria 7469
157 Ga0207675_100003622 3300026118 Bacteria 15060
158 Ga0207683_10036431 3300026121 Bacteria 4284
159 Ga0207683_10240165 3300026121 Bacteria 1652
160 Ga0207428_10001495 3300027907 Bacteria 24437
161 Ga0268266_10002065 3300028379 Bacteria 22244
162 Ga0268265_10003760 3300028380 Bacteria 10773
163 Ga0268264_10000178 3300028381 Bacteria 134713
164 Ga0268264_10381501 3300028381 Bacteria 1350
165 Ga0265327_10001021 3300031251 Bacteria 39585
166 Ga0395899_0008193 3300037312 Bacteria 8051
167 Ga0395898_0066793 3300037466 Bacteria 3482
168 Ga0395898_0080049 3300037466 Bacteria 3151
169 Ga0436365_1687961 3300039437 Bacteria 2269
170 Ga0439445_0030702 3300042004 Bacteria 1394
171 Ga0453683_0003745 3300044673 Bacteria 11091
172 Ga0453684_0038516 3300044712 Bacteria 6535
173 Ga0453684_0044200 3300044712 Bacteria 5968
174 Ga0453684_0111328 3300044712 Bacteria 3326
175 Ga0453684_0136486 3300044712 Bacteria 2936
176 Ga0451576_0001105 3300045051 Bacteria 49296
177 Ga0495662_0053182 3300046476 Bacteria 1956
178 Ga0495664_0123978 3300046477 Bacteria 1563
179 Ga0495648_0062567 3300046524 Bacteria 2203
180 Ga0495586_0126463 3300046535 Bacteria 1430
181 Ga0495645_0006945 3300046543 Bacteria 7867
182 Ga0495658_0219786 3300046683 Bacteria 1189
183 Ga0495636_0123112 3300047318 Bacteria 1149
184 Ga0495672_0172683 3300047320 Bacteria 1101
185 Ga0496102_0356273 3300048905 Bacteria 1377
186 Ga0496104_0036337 3300048907 Bacteria 4605
187 Ga0496108_0056122 3300048911 Bacteria 3308
188 Ga0496109_0264977 3300048912 Bacteria 1619
189 Ga0496112_0017264 3300048915 Bacteria 6776
190 Ga0496118_0244720 3300048921 Bacteria 1024
191 Ga0496121_0000025 3300048924 Bacteria 453467
192 Ga0496124_0030997 3300048927 Bacteria 4737
193 Ga0496125_0000292 3300048928 Bacteria 98599
194 Ga0496125_0159493 3300048928 Bacteria 1535
195 Ga0496126_0177015 3300048929 Bacteria 1814
196 Ga0501031_0272851 3300049568 Bacteria 1098
197 Ga0501033_0211508 3300049570 Bacteria 1383
198 Ga0501034_0055478 3300049571 Bacteria 3987
199 Ga0501036_0045903 3300049572 Bacteria 3700
200 Ga0501038_0113329 3300049574 Bacteria 2244
201 Ga0501040_0396634 3300049576 Bacteria 991
202 Ga0501041_0025110 3300049577 Bacteria 3581
203 Ga0501042_0025133 3300049578 Bacteria 4182
204 Ga0501042_0260051 3300049578 Bacteria 1253
205 Ga0501046_0118801 3300049580 Bacteria 2013
206 Ga0501070_0004216 3300049586 Bacteria 12358
207 Ga0501075_0136529 3300049591 Bacteria 1868
208 Ga0501076_0079599 3300049592 Bacteria 2629
209 Ga0501080_0069884 3300049742 Bacteria 3266
210 Ga0501081_0012914 3300049743 Bacteria 5494
211 nmdc:mga00v17_127149_c1 3300050491 Bacteria 1627
212 nmdc:mga0yw44_155_c1 3300050492 Bacteria 23178
213 nmdc:mga06z11_68375_c1 3300050494 Bacteria 1872
214 nmdc:mga09592_11223_c1 3300050508 Bacteria 7290
215 nmdc:mga09592_12870_c1 3300050508 Bacteria 6821
216 nmdc:mga0qj67_20186_c1 3300050509 Bacteria 5100
217 nmdc:mga0qj67_94605_c1 3300050509 Bacteria 2404
218 nmdc:mga06r32_2468_c1 3300050510 Bacteria 16549
219 nmdc:mga06r32_268375_c1 3300050510 Bacteria 1694
220 nmdc:mga08y16_3332_c1 3300050511 Bacteria 16637
221 nmdc:mga0n895_247047_c1 3300050512 Bacteria 1811
222 nmdc:mga0n895_6732_c1 3300050512 Bacteria 9801
223 nmdc:mga0a205_46220_c1 3300050515 Bacteria 4198
224 Ga0495601_0128696 3300053077 Bacteria 1648
225 Ga0495619_0391981 3300053085 Bacteria 959
226 Ga0500556_0020518 3300053104 Bacteria 2116
227 Ga0500573_0005199 3300053140 Bacteria 6945
228 Ga0500616_0000072 3300053153 Bacteria 231471
229 Ga0500620_008840 3300053155 Bacteria 2568
230 Ga0500622_0000070 3300053156 Bacteria 115284
231 Ga0500622_0018955 3300053156 Bacteria 3656
232 Ga0500634_0041358 3300053161 Bacteria 2502
233 Ga0501084_0013978 3300054114 Bacteria 6645

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0391981 Ga0495619_0391981_18_824 264
2 3300025922 Ga0207646_10105159 Ga0207646_101051593 282
3 3300013296 Ga0157374_10163203 Ga0157374_101632032 291
4 3300047318 Ga0495636_0123112 Ga0495636_0123112_28_936 295
5 iso_pu_bacteria 2643221679 2644444680 295
6 3300048921 Ga0496118_0244720 Ga0496118_0244720_82_993 300
7 3300046683 Ga0495658_0219786 Ga0495658_0219786_255_1172 301
8 3300049576 Ga0501040_0396634 Ga0501040_0396634_59_970 301
9 3300050512 nmdc:mga0n895_6732_c1 nmdc:mga0n895_6732_c1_6530_7453 302
10 3300053104 Ga0500556_0020518 Ga0500556_0020518_1164_2090 302
11 3300005331 Ga0070670_100006662 Ga0070670_10000666210 303
12 3300005364 Ga0070673_100040279 Ga0070673_1000402793 303
13 3300005718 Ga0068866_10104963 Ga0068866_101049632 303
14 3300006237 Ga0097621_100134353 Ga0097621_1001343532 303
15 3300009094 Ga0111539_10067819 Ga0111539_100678194 303
16 3300009101 Ga0105247_10008959 Ga0105247_100089593 303
17 3300009177 Ga0105248_10015580 Ga0105248_100155803 303
18 3300009177 Ga0105248_10131792 Ga0105248_101317922 303
19 3300009177 Ga0105248_10481359 Ga0105248_104813592 303
20 3300009553 Ga0105249_10000875 Ga0105249_1000087522 303
21 3300013306 Ga0163162_10016738 Ga0163162_100167389 303
22 3300014325 Ga0163163_10065773 Ga0163163_100657733 303
23 3300014968 Ga0157379_10004938 Ga0157379_100049388 303
24 3300025926 Ga0207659_10008548 Ga0207659_100085485 303
25 3300025931 Ga0207644_10004043 Ga0207644_100040432 303
26 3300026121 Ga0207683_10036431 Ga0207683_100364313 303
27 3300047320 Ga0495672_0172683 Ga0495672_0172683_155_1075 303
28 3300048905 Ga0496102_0356273 Ga0496102_0356273_79_1005 303
29 3300050491 nmdc:mga00v17_127149_c1 nmdc:mga00v17_127149_c1_529_1455 303
30 3300050494 nmdc:mga06z11_68375_c1 nmdc:mga06z11_68375_c1_833_1759 303
31 3300050510 nmdc:mga06r32_268375_c1 nmdc:mga06r32_268375_c1_648_1589 303
32 3300050512 nmdc:mga0n895_247047_c1 nmdc:mga0n895_247047_c1_568_1509 303
33 3300053077 Ga0495601_0128696 Ga0495601_0128696_499_1437 303
34 3300049571 Ga0501034_0055478 Ga0501034_0055478_341_1264 304
35 3300005577 Ga0068857_100000517 Ga0068857_10000051717 312
36 3300048924 Ga0496121_0000025 Ga0496121_0000025_187043_188047 312
37 3300053155 Ga0500620_008840 Ga0500620_008840_1425_2435 312
38 3300050510 nmdc:mga06r32_2468_c1 nmdc:mga06r32_2468_c1_14315_15286 313
39 3300049586 Ga0501070_0004216 Ga0501070_0004216_106_1128 314
40 iso_pu_bacteria 2643221591 2643965407 316
41 iso_pu_bacteria 2894817345 2894819198 318
42 3300031251 Ga0265327_10001021 Ga0265327_1000102128 319
43 iso_pu_bacteria 2571042588 2573037760 319
44 iso_pu_bacteria 2579778775 2580931166 319
45 iso_pu_bacteria 2619619294 2621273027 319
46 iso_pu_bacteria 2881636855 2881638593 319
47 iso_pu_bacteria 2996310559 2996311361 319
48 3300048927 Ga0496124_0030997 Ga0496124_0030997_43_1014 320
49 3300048928 Ga0496125_0000292 Ga0496125_0000292_64000_64971 320
50 3300053161 Ga0500634_0041358 Ga0500634_0041358_1190_2161 320
51 iso_pu_bacteria 2510917026 2511169163 320
52 iso_pu_bacteria 2585427633 2585993087 320
53 iso_pu_bacteria 2585427634 2586003823 320
54 iso_pu_bacteria 2738543024 2739305870 320
55 iso_pu_bacteria 2919171160 2919174006 320
56 3300005329 Ga0070683_100000487 Ga0070683_10000048710 321
57 3300005338 Ga0068868_100306515 Ga0068868_1003065152 321
58 3300005535 Ga0070684_100000452 Ga0070684_1000004529 321
59 3300005535 Ga0070684_100429469 Ga0070684_1004294691 321
60 3300005543 Ga0070672_100208547 Ga0070672_1002085471 321
61 3300005564 Ga0070664_100145088 Ga0070664_1001450883 321
62 3300005617 Ga0068859_100384677 Ga0068859_1003846772 321
63 3300005842 Ga0068858_100022729 Ga0068858_1000227295 321
64 3300006358 Ga0068871_100097886 Ga0068871_1000978861 321
65 3300006881 Ga0068865_100014919 Ga0068865_1000149194 321
66 3300006881 Ga0068865_100140069 Ga0068865_1001400692 321
67 3300006931 Ga0097620_100384679 Ga0097620_1003846792 321
68 3300009177 Ga0105248_10001925 Ga0105248_100019257 321
69 3300014325 Ga0163163_10188365 Ga0163163_101883652 321
70 3300014325 Ga0163163_10349173 Ga0163163_103491731 321
71 3300014968 Ga0157379_10044372 Ga0157379_100443724 321
72 3300014969 Ga0157376_10028085 Ga0157376_100280854 321
73 3300025925 Ga0207650_10159826 Ga0207650_101598262 321
74 3300025934 Ga0207686_10032061 Ga0207686_100320614 321
75 3300025938 Ga0207704_10101267 Ga0207704_101012672 321
76 3300025941 Ga0207711_10186564 Ga0207711_101865642 321
77 3300025942 Ga0207689_10055435 Ga0207689_100554352 321
78 3300025944 Ga0207661_10000051 Ga0207661_1000005152 321
79 3300026023 Ga0207677_10225703 Ga0207677_102257032 321
80 3300028381 Ga0268264_10381501 Ga0268264_103815012 321
81 3300042004 Ga0439445_0030702 Ga0439445_0030702_205_1176 321
82 3300044673 Ga0453683_0003745 Ga0453683_0003745_7230_8207 321
83 3300044712 Ga0453684_0038516 Ga0453684_0038516_1997_2974 321
84 3300045051 Ga0451576_0001105 Ga0451576_0001105_7167_8144 321
85 3300046476 Ga0495662_0053182 Ga0495662_0053182_872_1849 321
86 3300046477 Ga0495664_0123978 Ga0495664_0123978_411_1403 321
87 3300046535 Ga0495586_0126463 Ga0495586_0126463_271_1248 321
88 3300046543 Ga0495645_0006945 Ga0495645_0006945_1426_2403 321
89 3300048907 Ga0496104_0036337 Ga0496104_0036337_1811_2788 321
90 3300048911 Ga0496108_0056122 Ga0496108_0056122_1363_2340 321
91 3300048912 Ga0496109_0264977 Ga0496109_0264977_620_1597 321
92 3300048915 Ga0496112_0017264 Ga0496112_0017264_4669_5646 321
93 3300048928 Ga0496125_0159493 Ga0496125_0159493_146_1225 321
94 3300049568 Ga0501031_0272851 Ga0501031_0272851_58_1029 321
95 3300049578 Ga0501042_0260051 Ga0501042_0260051_235_1206 321
96 3300053140 Ga0500573_0005199 Ga0500573_0005199_2421_3395 321
97 3300005445 Ga0070708_100491276 Ga0070708_1004912761 322
98 3300005545 Ga0070695_100011264 Ga0070695_1000112646 322
99 3300006038 Ga0075365_10001994 Ga0075365_100019947 322
100 3300006914 Ga0075436_100026984 Ga0075436_1000269844 322
101 3300007076 Ga0075435_100026644 Ga0075435_1000266443 322
102 3300025272 Ga0209455_1016811 Ga0209455_10168112 322
103 3300037312 Ga0395899_0008193 Ga0395899_0008193_1900_2901 322
104 3300037466 Ga0395898_0066793 Ga0395898_0066793_1829_2830 322
105 3300050492 nmdc:mga0yw44_155_c1 nmdc:mga0yw44_155_c1_16439_17407 322
106 3300005290 Ga0065712_10002054 Ga0065712_100020544 323
107 3300005328 Ga0070676_10002673 Ga0070676_100026737 323
108 3300005330 Ga0070690_100002747 Ga0070690_1000027479 323
109 3300005331 Ga0070670_100000065 Ga0070670_10000006568 323
110 3300005331 Ga0070670_100000802 Ga0070670_10000080210 323
111 3300005334 Ga0068869_100000856 Ga0068869_10000085613 323
112 3300005335 Ga0070666_10062579 Ga0070666_100625793 323
113 3300005340 Ga0070689_100206784 Ga0070689_1002067842 323
114 3300005347 Ga0070668_100026462 Ga0070668_1000264624 323
115 3300005353 Ga0070669_100007630 Ga0070669_1000076302 323
116 3300005353 Ga0070669_100178712 Ga0070669_1001787122 323
117 3300005354 Ga0070675_100005187 Ga0070675_1000051877 323
118 3300005354 Ga0070675_100006421 Ga0070675_1000064214 323
119 3300005354 Ga0070675_100087730 Ga0070675_1000877301 323
120 3300005355 Ga0070671_100007771 Ga0070671_1000077712 323
121 3300005355 Ga0070671_100063976 Ga0070671_1000639763 323
122 3300005356 Ga0070674_100046506 Ga0070674_1000465063 323
123 3300005367 Ga0070667_100031763 Ga0070667_1000317634 323
124 3300005434 Ga0070709_10018672 Ga0070709_100186725 323
125 3300005436 Ga0070713_100298347 Ga0070713_1002983472 323
126 3300005438 Ga0070701_10035776 Ga0070701_100357763 323
127 3300005441 Ga0070700_100000687 Ga0070700_10000068711 323
128 3300005444 Ga0070694_100231292 Ga0070694_1002312922 323
129 3300005456 Ga0070678_100207694 Ga0070678_1002076941 323
130 3300005459 Ga0068867_100008497 Ga0068867_1000084975 323
131 3300005459 Ga0068867_100195188 Ga0068867_1001951881 323
132 3300005543 Ga0070672_100018684 Ga0070672_1000186842 323
133 3300005544 Ga0070686_100009478 Ga0070686_1000094786 323
134 3300005545 Ga0070695_100224885 Ga0070695_1002248851 323
135 3300005548 Ga0070665_100004019 Ga0070665_10000401916 323
136 3300005548 Ga0070665_100474995 Ga0070665_1004749951 323
137 3300005564 Ga0070664_100020640 Ga0070664_1000206405 323
138 3300005578 Ga0068854_100066152 Ga0068854_1000661524 323
139 3300005617 Ga0068859_100023905 Ga0068859_1000239052 323
140 3300005617 Ga0068859_100035264 Ga0068859_1000352645 323
141 3300005617 Ga0068859_100189685 Ga0068859_1001896852 323
142 3300005618 Ga0068864_100000224 Ga0068864_10000022447 323
143 3300005618 Ga0068864_100031074 Ga0068864_1000310744 323
144 3300005719 Ga0068861_100006800 Ga0068861_1000068005 323
145 3300005841 Ga0068863_100000061 Ga0068863_100000061102 323
146 3300005842 Ga0068858_100012412 Ga0068858_1000124129 323
147 3300005843 Ga0068860_100000123 Ga0068860_10000012316 323
148 3300006042 Ga0075368_10013362 Ga0075368_100133622 323
149 3300006186 Ga0075369_10048100 Ga0075369_100481002 323
150 3300006195 Ga0075366_10046279 Ga0075366_100462792 323
151 3300006846 Ga0075430_100000530 Ga0075430_1000005305 323
152 3300006846 Ga0075430_100012800 Ga0075430_1000128008 323
153 3300006847 Ga0075431_100491343 Ga0075431_1004913431 323
154 3300006871 Ga0075434_100324978 Ga0075434_1003249782 323
155 3300006880 Ga0075429_100015033 Ga0075429_1000150336 323
156 3300006931 Ga0097620_100023905 Ga0097620_1000239052 323
157 3300006931 Ga0097620_100035264 Ga0097620_1000352645 323
158 3300006931 Ga0097620_100189685 Ga0097620_1001896852 323
159 3300009011 Ga0105251_10022897 Ga0105251_100228973 323
160 3300009094 Ga0111539_10000850 Ga0111539_1000085038 323
161 3300009098 Ga0105245_10277920 Ga0105245_102779202 323
162 3300009101 Ga0105247_10131437 Ga0105247_101314372 323
163 3300009147 Ga0114129_10406203 Ga0114129_104062032 323
164 3300009176 Ga0105242_10007778 Ga0105242_100077786 323
165 3300009551 Ga0105238_10003023 Ga0105238_1000302312 323
166 3300013308 Ga0157375_10164026 Ga0157375_101640262 323
167 3300014325 Ga0163163_10021553 Ga0163163_100215532 323
168 3300014325 Ga0163163_10059966 Ga0163163_100599661 323
169 3300014326 Ga0157380_10082118 Ga0157380_100821182 323
170 3300014968 Ga0157379_10366863 Ga0157379_103668631 323
171 3300025899 Ga0207642_10023192 Ga0207642_100231923 323
172 3300025900 Ga0207710_10035620 Ga0207710_100356202 323
173 3300025903 Ga0207680_10044119 Ga0207680_100441192 323
174 3300025903 Ga0207680_10060416 Ga0207680_100604162 323
175 3300025906 Ga0207699_10083967 Ga0207699_100839673 323
176 3300025907 Ga0207645_10007933 Ga0207645_100079335 323
177 3300025908 Ga0207643_10017924 Ga0207643_100179242 323
178 3300025924 Ga0207694_10015346 Ga0207694_100153465 323
179 3300025925 Ga0207650_10000031 Ga0207650_10000031107 323
180 3300025925 Ga0207650_10042216 Ga0207650_100422162 323
181 3300025925 Ga0207650_10234585 Ga0207650_102345852 323
182 3300025925 Ga0207650_10271205 Ga0207650_102712052 323
183 3300025926 Ga0207659_10000662 Ga0207659_1000066214 323
184 3300025926 Ga0207659_10008986 Ga0207659_100089866 323
185 3300025926 Ga0207659_10028582 Ga0207659_100285823 323
186 3300025928 Ga0207700_10075635 Ga0207700_100756353 323
187 3300025934 Ga0207686_10001676 Ga0207686_100016764 323
188 3300025935 Ga0207709_10008753 Ga0207709_100087531 323
189 3300025938 Ga0207704_10003078 Ga0207704_100030787 323
190 3300025940 Ga0207691_10048868 Ga0207691_100488684 323
191 3300025940 Ga0207691_10081308 Ga0207691_100813083 323
192 3300025941 Ga0207711_10110758 Ga0207711_101107583 323
193 3300025942 Ga0207689_10005433 Ga0207689_100054336 323
194 3300025945 Ga0207679_10044966 Ga0207679_100449662 323
195 3300025960 Ga0207651_10002962 Ga0207651_100029624 323
196 3300025961 Ga0207712_10000663 Ga0207712_1000066322 323
197 3300025972 Ga0207668_10003444 Ga0207668_100034449 323
198 3300025986 Ga0207658_10000301 Ga0207658_1000030114 323
199 3300026035 Ga0207703_10008120 Ga0207703_100081203 323
200 3300026075 Ga0207708_10001215 Ga0207708_1000121512 323
201 3300026088 Ga0207641_10001268 Ga0207641_1000126811 323
202 3300026089 Ga0207648_10003495 Ga0207648_1000349513 323
203 3300026095 Ga0207676_10001915 Ga0207676_100019159 323
204 3300026095 Ga0207676_10008100 Ga0207676_100081005 323
205 3300026118 Ga0207675_100003622 Ga0207675_1000036227 323
206 3300026121 Ga0207683_10240165 Ga0207683_102401652 323
207 3300027907 Ga0207428_10001495 Ga0207428_1000149519 323
208 3300028379 Ga0268266_10002065 Ga0268266_100020653 323
209 3300028380 Ga0268265_10003760 Ga0268265_1000376012 323
210 3300028381 Ga0268264_10000178 Ga0268264_1000017856 323
211 3300037466 Ga0395898_0080049 Ga0395898_0080049_1260_2255 323
212 3300039437 Ga0436365_1687961 Ga0436365_1687961_960_1946 323
213 3300044712 Ga0453684_0044200 Ga0453684_0044200_363_1349 323
214 3300044712 Ga0453684_0111328 Ga0453684_0111328_2107_3093 323
215 3300044712 Ga0453684_0136486 Ga0453684_0136486_356_1342 323
216 3300046524 Ga0495648_0062567 Ga0495648_0062567_55_1035 323
217 3300049570 Ga0501033_0211508 Ga0501033_0211508_56_1036 323
218 3300049572 Ga0501036_0045903 Ga0501036_0045903_335_1336 323
219 3300049574 Ga0501038_0113329 Ga0501038_0113329_1052_2053 323
220 3300049577 Ga0501041_0025110 Ga0501041_0025110_2349_3350 323
221 3300049578 Ga0501042_0025133 Ga0501042_0025133_693_1694 323
222 3300049580 Ga0501046_0118801 Ga0501046_0118801_223_1224 323
223 3300049591 Ga0501075_0136529 Ga0501075_0136529_614_1615 323
224 3300049592 Ga0501076_0079599 Ga0501076_0079599_256_1257 323
225 3300049742 Ga0501080_0069884 Ga0501080_0069884_2231_3232 323
226 3300049743 Ga0501081_0012914 Ga0501081_0012914_2516_3517 323
227 3300050508 nmdc:mga09592_11223_c1 nmdc:mga09592_11223_c1_3100_4098 323
228 3300050508 nmdc:mga09592_12870_c1 nmdc:mga09592_12870_c1_4936_5937 323
229 3300050509 nmdc:mga0qj67_20186_c1 nmdc:mga0qj67_20186_c1_2231_3232 323
230 3300050509 nmdc:mga0qj67_94605_c1 nmdc:mga0qj67_94605_c1_1363_2361 323
231 3300050511 nmdc:mga08y16_3332_c1 nmdc:mga08y16_3332_c1_1828_2826 323
232 3300050515 nmdc:mga0a205_46220_c1 nmdc:mga0a205_46220_c1_1543_2541 323
233 3300054114 Ga0501084_0013978 Ga0501084_0013978_2743_3744 323
234 3300003215 JGI25153J46596_10032259 JGI25153J46596_100322592 324
235 3300003781 Ga0055536_1002411 Ga0055536_10024116 324
236 3300003792 Ga0055540_1003038 Ga0055540_10030385 324
237 3300003794 Ga0055531_10000903 Ga0055531_100009036 324
238 3300025292 Ga0209676_1001187 Ga0209676_100118717 324
239 3300025297 Ga0209758_1001075 Ga0209758_100107518 324
240 3300025298 Ga0209050_1012474 Ga0209050_10124743 324
241 3300025303 Ga0209051_1001073 Ga0209051_100107311 324
242 3300025304 Ga0209257_1001332 Ga0209257_100133213 324
243 3300048929 Ga0496126_0177015 Ga0496126_0177015_347_1321 324
244 3300053153 Ga0500616_0000072 Ga0500616_0000072_60140_61114 324
245 3300053156 Ga0500622_0000070 Ga0500622_0000070_54968_55942 324
246 3300053156 Ga0500622_0018955 Ga0500622_0018955_1093_2067 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

50

350

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9493 1 320
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9453 1 320
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9431 1 320
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9334 1 320
4aub-assembly1.cif.gz_F the complex structure of the bacterial aldo-keto reductase akr14a1 with nadp and citrate 0.9171 1 315
ID Description Score Start End Superfamily
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9553 1 322 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9524 1 322 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9343 1 318 3.20.20.100
af_G2TRN6_1_317_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9339 23 316 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9191 1 314 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V8KXA4-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9863 2 159 GO:0005829
GO:0016491
AF-A0A817MNW5-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.986 1 154 GO:0005829
AF-A0A381TWP4-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9851 1 166 GO:0005829
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9833 1 210 GO:0005829
GO:0016491
AF-A0A7W5XCZ6-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9827 1 175 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.84 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map