F358495
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 186 | 233 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0159493|Ga0496125_0159493_146_1225 |
| Length | 359 |
| Sequence | MQKNQACKAVKLAEIRPKSPIQIDDAPIKFPEGVLMEYSNLGRTGLKISRLALGCMTFGSSKWAPWVLDEEASRPIIEKAVDLGINFFDLADMYSGGASEEVVARVLSPIARHKLVLATKLYNPMSADPNDRGLSRKHIFEAVDGSLKRLGTDYIDLYQLHRFDYETPLEETLDALNDVVRAGKVRYLGASSMHAWQFMKALGMQRANGWAPFVSMQPHYNLIYREEEREMLPLCREEGIGVIPWSPLARGRLAGRSGDATTTRSQTDKTASALYDRSQAQDDAVVAAVRTVAERHGRPPAQIAYAWVATRPGITAPIVGISKLHQFDDAVAALEVKLSDEDVALMEAPYQPKPVAGHQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 2 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 3 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 4 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 5 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 6 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 7 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 8 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 9 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 10 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 11 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 12 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 13 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 134 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 151 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 152 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 153 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 154 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 155 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 171 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 181 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 182 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 183 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 184 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 185 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 186 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 0 |
| Isolates | 5.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.76 |
| Nodule | 0.81 |
| Rhizoplane | 2.03 |
| Rhizosphere | 80.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10032259 | 3300003215 | Bacteria | 1750 |
| 2 | Ga0055536_1002411 | 3300003781 | Bacteria | 10511 |
| 3 | Ga0055540_1003038 | 3300003792 | Bacteria | 8373 |
| 4 | Ga0055531_10000903 | 3300003794 | Bacteria | 24149 |
| 5 | Ga0065712_10002054 | 3300005290 | Bacteria | 5663 |
| 6 | Ga0070676_10002673 | 3300005328 | Bacteria | 9179 |
| 7 | Ga0070683_100000487 | 3300005329 | Bacteria | 28009 |
| 8 | Ga0070690_100002747 | 3300005330 | Bacteria | 9499 |
| 9 | Ga0070670_100000065 | 3300005331 | Bacteria | 108496 |
| 10 | Ga0070670_100000802 | 3300005331 | Bacteria | 24446 |
| 11 | Ga0070670_100006662 | 3300005331 | Bacteria | 9787 |
| 12 | Ga0068869_100000856 | 3300005334 | Bacteria | 17466 |
| 13 | Ga0070666_10062579 | 3300005335 | Bacteria | 2521 |
| 14 | Ga0068868_100306515 | 3300005338 | Bacteria | 1350 |
| 15 | Ga0070689_100206784 | 3300005340 | Bacteria | 1605 |
| 16 | Ga0070668_100026462 | 3300005347 | Bacteria | 4402 |
| 17 | Ga0070669_100007630 | 3300005353 | Bacteria | 7731 |
| 18 | Ga0070669_100178712 | 3300005353 | Bacteria | 1659 |
| 19 | Ga0070675_100005187 | 3300005354 | Bacteria | 9935 |
| 20 | Ga0070675_100006421 | 3300005354 | Bacteria | 9023 |
| 21 | Ga0070675_100087730 | 3300005354 | Bacteria | 2602 |
| 22 | Ga0070671_100007771 | 3300005355 | Bacteria | 8565 |
| 23 | Ga0070671_100063976 | 3300005355 | Bacteria | 3064 |
| 24 | Ga0070674_100046506 | 3300005356 | Bacteria | 2969 |
| 25 | Ga0070673_100040279 | 3300005364 | Bacteria | 3583 |
| 26 | Ga0070667_100031763 | 3300005367 | Bacteria | 4402 |
| 27 | Ga0070709_10018672 | 3300005434 | Bacteria | 3999 |
| 28 | Ga0070713_100298347 | 3300005436 | Bacteria | 1483 |
| 29 | Ga0070701_10035776 | 3300005438 | Bacteria | 2498 |
| 30 | Ga0070700_100000687 | 3300005441 | Bacteria | 16695 |
| 31 | Ga0070694_100231292 | 3300005444 | Bacteria | 1391 |
| 32 | Ga0070708_100491276 | 3300005445 | Bacteria | 1158 |
| 33 | Ga0070678_100207694 | 3300005456 | Bacteria | 1620 |
| 34 | Ga0068867_100008497 | 3300005459 | Bacteria | 7247 |
| 35 | Ga0068867_100195188 | 3300005459 | Bacteria | 1618 |
| 36 | Ga0070684_100000452 | 3300005535 | Bacteria | 28009 |
| 37 | Ga0070684_100429469 | 3300005535 | Bacteria | 1220 |
| 38 | Ga0070672_100018684 | 3300005543 | Bacteria | 5018 |
| 39 | Ga0070672_100208547 | 3300005543 | Bacteria | 1636 |
| 40 | Ga0070686_100009478 | 3300005544 | Bacteria | 5475 |
| 41 | Ga0070695_100011264 | 3300005545 | Bacteria | 5348 |
| 42 | Ga0070695_100224885 | 3300005545 | Bacteria | 1354 |
| 43 | Ga0070665_100004019 | 3300005548 | Bacteria | 15490 |
| 44 | Ga0070665_100474995 | 3300005548 | Bacteria | 1261 |
| 45 | Ga0070664_100020640 | 3300005564 | Bacteria | 5427 |
| 46 | Ga0070664_100145088 | 3300005564 | Bacteria | 2093 |
| 47 | Ga0068857_100000517 | 3300005577 | Bacteria | 27794 |
| 48 | Ga0068854_100066152 | 3300005578 | Bacteria | 2630 |
| 49 | Ga0068859_100023905 | 3300005617 | Bacteria | 6133 |
| 50 | Ga0068859_100035264 | 3300005617 | Bacteria | 5020 |
| 51 | Ga0068859_100189685 | 3300005617 | Bacteria | 2140 |
| 52 | Ga0068859_100384677 | 3300005617 | Bacteria | 1499 |
| 53 | Ga0068864_100000224 | 3300005618 | Bacteria | 51280 |
| 54 | Ga0068864_100031074 | 3300005618 | Bacteria | 4530 |
| 55 | Ga0068866_10104963 | 3300005718 | Bacteria | 1566 |
| 56 | Ga0068861_100006800 | 3300005719 | Bacteria | 7812 |
| 57 | Ga0068863_100000061 | 3300005841 | Bacteria | 121811 |
| 58 | Ga0068858_100012412 | 3300005842 | Bacteria | 8033 |
| 59 | Ga0068858_100022729 | 3300005842 | Bacteria | 5847 |
| 60 | Ga0068860_100000123 | 3300005843 | Bacteria | 124700 |
| 61 | Ga0075365_10001994 | 3300006038 | Bacteria | 9670 |
| 62 | Ga0075368_10013362 | 3300006042 | Bacteria | 3013 |
| 63 | Ga0075369_10048100 | 3300006186 | Bacteria | 1840 |
| 64 | Ga0075366_10046279 | 3300006195 | Bacteria | 2578 |
| 65 | Ga0097621_100134353 | 3300006237 | Bacteria | 2109 |
| 66 | Ga0068871_100097886 | 3300006358 | Bacteria | 2453 |
| 67 | Ga0075430_100000530 | 3300006846 | Bacteria | 28693 |
| 68 | Ga0075430_100012800 | 3300006846 | Bacteria | 7147 |
| 69 | Ga0075431_100491343 | 3300006847 | Bacteria | 1219 |
| 70 | Ga0075434_100324978 | 3300006871 | Bacteria | 1559 |
| 71 | Ga0075429_100015033 | 3300006880 | Bacteria | 6711 |
| 72 | Ga0068865_100014919 | 3300006881 | Bacteria | 4947 |
| 73 | Ga0068865_100140069 | 3300006881 | Bacteria | 1823 |
| 74 | Ga0075436_100026984 | 3300006914 | Bacteria | 3954 |
| 75 | Ga0097620_100023905 | 3300006931 | Bacteria | 6133 |
| 76 | Ga0097620_100035264 | 3300006931 | Bacteria | 5020 |
| 77 | Ga0097620_100189685 | 3300006931 | Bacteria | 2140 |
| 78 | Ga0097620_100384679 | 3300006931 | Bacteria | 1499 |
| 79 | Ga0075435_100026644 | 3300007076 | Bacteria | 4513 |
| 80 | Ga0105251_10022897 | 3300009011 | Bacteria | 3233 |
| 81 | Ga0111539_10000850 | 3300009094 | Bacteria | 39822 |
| 82 | Ga0111539_10067819 | 3300009094 | Bacteria | 4212 |
| 83 | Ga0105245_10277920 | 3300009098 | Bacteria | 1636 |
| 84 | Ga0105247_10008959 | 3300009101 | Bacteria | 6098 |
| 85 | Ga0105247_10131437 | 3300009101 | Bacteria | 1632 |
| 86 | Ga0114129_10406203 | 3300009147 | Bacteria | 1794 |
| 87 | Ga0105242_10007778 | 3300009176 | Bacteria | 8247 |
| 88 | Ga0105248_10001925 | 3300009177 | Bacteria | 23047 |
| 89 | Ga0105248_10015580 | 3300009177 | Bacteria | 8381 |
| 90 | Ga0105248_10131792 | 3300009177 | Bacteria | 2820 |
| 91 | Ga0105248_10481359 | 3300009177 | Bacteria | 1399 |
| 92 | Ga0105238_10003023 | 3300009551 | Bacteria | 16786 |
| 93 | Ga0105249_10000875 | 3300009553 | Bacteria | 26753 |
| 94 | Ga0157374_10163203 | 3300013296 | Bacteria | 2171 |
| 95 | Ga0163162_10016738 | 3300013306 | Bacteria | 7166 |
| 96 | Ga0157375_10164026 | 3300013308 | Bacteria | 2366 |
| 97 | Ga0163163_10021553 | 3300014325 | Bacteria | 6084 |
| 98 | Ga0163163_10059966 | 3300014325 | Bacteria | 3766 |
| 99 | Ga0163163_10065773 | 3300014325 | Bacteria | 3600 |
| 100 | Ga0163163_10188365 | 3300014325 | Bacteria | 2111 |
| 101 | Ga0163163_10349173 | 3300014325 | Bacteria | 1535 |
| 102 | Ga0157380_10082118 | 3300014326 | Bacteria | 2637 |
| 103 | Ga0157379_10004938 | 3300014968 | Bacteria | 11445 |
| 104 | Ga0157379_10044372 | 3300014968 | Bacteria | 3969 |
| 105 | Ga0157379_10366863 | 3300014968 | Bacteria | 1320 |
| 106 | Ga0157376_10028085 | 3300014969 | Bacteria | 4468 |
| 107 | Ga0209455_1016811 | 3300025272 | Bacteria | 1557 |
| 108 | Ga0209676_1001187 | 3300025292 | Bacteria | 28036 |
| 109 | Ga0209758_1001075 | 3300025297 | Bacteria | 35521 |
| 110 | Ga0209050_1012474 | 3300025298 | Bacteria | 3890 |
| 111 | Ga0209051_1001073 | 3300025303 | Bacteria | 25371 |
| 112 | Ga0209257_1001332 | 3300025304 | Bacteria | 29987 |
| 113 | Ga0207642_10023192 | 3300025899 | Bacteria | 2475 |
| 114 | Ga0207710_10035620 | 3300025900 | Bacteria | 2190 |
| 115 | Ga0207680_10044119 | 3300025903 | Bacteria | 2620 |
| 116 | Ga0207680_10060416 | 3300025903 | Bacteria | 2307 |
| 117 | Ga0207699_10083967 | 3300025906 | Bacteria | 1982 |
| 118 | Ga0207645_10007933 | 3300025907 | Bacteria | 7457 |
| 119 | Ga0207643_10017924 | 3300025908 | Bacteria | 3878 |
| 120 | Ga0207646_10105159 | 3300025922 | Bacteria | 2531 |
| 121 | Ga0207694_10015346 | 3300025924 | Bacteria | 5778 |
| 122 | Ga0207650_10000031 | 3300025925 | Bacteria | 230128 |
| 123 | Ga0207650_10042216 | 3300025925 | Bacteria | 3345 |
| 124 | Ga0207650_10159826 | 3300025925 | Bacteria | 1784 |
| 125 | Ga0207650_10234585 | 3300025925 | Bacteria | 1481 |
| 126 | Ga0207650_10271205 | 3300025925 | Bacteria | 1379 |
| 127 | Ga0207659_10000662 | 3300025926 | Bacteria | 20344 |
| 128 | Ga0207659_10008548 | 3300025926 | Bacteria | 6363 |
| 129 | Ga0207659_10008986 | 3300025926 | Bacteria | 6230 |
| 130 | Ga0207659_10028582 | 3300025926 | Bacteria | 3791 |
| 131 | Ga0207700_10075635 | 3300025928 | Bacteria | 2610 |
| 132 | Ga0207644_10004043 | 3300025931 | Bacteria | 9513 |
| 133 | Ga0207686_10001676 | 3300025934 | Bacteria | 12340 |
| 134 | Ga0207686_10032061 | 3300025934 | Bacteria | 3125 |
| 135 | Ga0207709_10008753 | 3300025935 | Bacteria | 5582 |
| 136 | Ga0207704_10003078 | 3300025938 | Bacteria | 7535 |
| 137 | Ga0207704_10101267 | 3300025938 | Bacteria | 1921 |
| 138 | Ga0207691_10048868 | 3300025940 | Bacteria | 3876 |
| 139 | Ga0207691_10081308 | 3300025940 | Bacteria | 2912 |
| 140 | Ga0207711_10110758 | 3300025941 | Bacteria | 2441 |
| 141 | Ga0207711_10186564 | 3300025941 | Bacteria | 1888 |
| 142 | Ga0207689_10005433 | 3300025942 | Bacteria | 11402 |
| 143 | Ga0207689_10055435 | 3300025942 | Bacteria | 3262 |
| 144 | Ga0207661_10000051 | 3300025944 | Bacteria | 92442 |
| 145 | Ga0207679_10044966 | 3300025945 | Bacteria | 3190 |
| 146 | Ga0207651_10002962 | 3300025960 | Bacteria | 8215 |
| 147 | Ga0207712_10000663 | 3300025961 | Bacteria | 26711 |
| 148 | Ga0207668_10003444 | 3300025972 | Bacteria | 9282 |
| 149 | Ga0207658_10000301 | 3300025986 | Bacteria | 51412 |
| 150 | Ga0207677_10225703 | 3300026023 | Bacteria | 1505 |
| 151 | Ga0207703_10008120 | 3300026035 | Bacteria | 8296 |
| 152 | Ga0207708_10001215 | 3300026075 | Bacteria | 19449 |
| 153 | Ga0207641_10001268 | 3300026088 | Bacteria | 25135 |
| 154 | Ga0207648_10003495 | 3300026089 | Bacteria | 16460 |
| 155 | Ga0207676_10001915 | 3300026095 | Bacteria | 15194 |
| 156 | Ga0207676_10008100 | 3300026095 | Bacteria | 7469 |
| 157 | Ga0207675_100003622 | 3300026118 | Bacteria | 15060 |
| 158 | Ga0207683_10036431 | 3300026121 | Bacteria | 4284 |
| 159 | Ga0207683_10240165 | 3300026121 | Bacteria | 1652 |
| 160 | Ga0207428_10001495 | 3300027907 | Bacteria | 24437 |
| 161 | Ga0268266_10002065 | 3300028379 | Bacteria | 22244 |
| 162 | Ga0268265_10003760 | 3300028380 | Bacteria | 10773 |
| 163 | Ga0268264_10000178 | 3300028381 | Bacteria | 134713 |
| 164 | Ga0268264_10381501 | 3300028381 | Bacteria | 1350 |
| 165 | Ga0265327_10001021 | 3300031251 | Bacteria | 39585 |
| 166 | Ga0395899_0008193 | 3300037312 | Bacteria | 8051 |
| 167 | Ga0395898_0066793 | 3300037466 | Bacteria | 3482 |
| 168 | Ga0395898_0080049 | 3300037466 | Bacteria | 3151 |
| 169 | Ga0436365_1687961 | 3300039437 | Bacteria | 2269 |
| 170 | Ga0439445_0030702 | 3300042004 | Bacteria | 1394 |
| 171 | Ga0453683_0003745 | 3300044673 | Bacteria | 11091 |
| 172 | Ga0453684_0038516 | 3300044712 | Bacteria | 6535 |
| 173 | Ga0453684_0044200 | 3300044712 | Bacteria | 5968 |
| 174 | Ga0453684_0111328 | 3300044712 | Bacteria | 3326 |
| 175 | Ga0453684_0136486 | 3300044712 | Bacteria | 2936 |
| 176 | Ga0451576_0001105 | 3300045051 | Bacteria | 49296 |
| 177 | Ga0495662_0053182 | 3300046476 | Bacteria | 1956 |
| 178 | Ga0495664_0123978 | 3300046477 | Bacteria | 1563 |
| 179 | Ga0495648_0062567 | 3300046524 | Bacteria | 2203 |
| 180 | Ga0495586_0126463 | 3300046535 | Bacteria | 1430 |
| 181 | Ga0495645_0006945 | 3300046543 | Bacteria | 7867 |
| 182 | Ga0495658_0219786 | 3300046683 | Bacteria | 1189 |
| 183 | Ga0495636_0123112 | 3300047318 | Bacteria | 1149 |
| 184 | Ga0495672_0172683 | 3300047320 | Bacteria | 1101 |
| 185 | Ga0496102_0356273 | 3300048905 | Bacteria | 1377 |
| 186 | Ga0496104_0036337 | 3300048907 | Bacteria | 4605 |
| 187 | Ga0496108_0056122 | 3300048911 | Bacteria | 3308 |
| 188 | Ga0496109_0264977 | 3300048912 | Bacteria | 1619 |
| 189 | Ga0496112_0017264 | 3300048915 | Bacteria | 6776 |
| 190 | Ga0496118_0244720 | 3300048921 | Bacteria | 1024 |
| 191 | Ga0496121_0000025 | 3300048924 | Bacteria | 453467 |
| 192 | Ga0496124_0030997 | 3300048927 | Bacteria | 4737 |
| 193 | Ga0496125_0000292 | 3300048928 | Bacteria | 98599 |
| 194 | Ga0496125_0159493 | 3300048928 | Bacteria | 1535 |
| 195 | Ga0496126_0177015 | 3300048929 | Bacteria | 1814 |
| 196 | Ga0501031_0272851 | 3300049568 | Bacteria | 1098 |
| 197 | Ga0501033_0211508 | 3300049570 | Bacteria | 1383 |
| 198 | Ga0501034_0055478 | 3300049571 | Bacteria | 3987 |
| 199 | Ga0501036_0045903 | 3300049572 | Bacteria | 3700 |
| 200 | Ga0501038_0113329 | 3300049574 | Bacteria | 2244 |
| 201 | Ga0501040_0396634 | 3300049576 | Bacteria | 991 |
| 202 | Ga0501041_0025110 | 3300049577 | Bacteria | 3581 |
| 203 | Ga0501042_0025133 | 3300049578 | Bacteria | 4182 |
| 204 | Ga0501042_0260051 | 3300049578 | Bacteria | 1253 |
| 205 | Ga0501046_0118801 | 3300049580 | Bacteria | 2013 |
| 206 | Ga0501070_0004216 | 3300049586 | Bacteria | 12358 |
| 207 | Ga0501075_0136529 | 3300049591 | Bacteria | 1868 |
| 208 | Ga0501076_0079599 | 3300049592 | Bacteria | 2629 |
| 209 | Ga0501080_0069884 | 3300049742 | Bacteria | 3266 |
| 210 | Ga0501081_0012914 | 3300049743 | Bacteria | 5494 |
| 211 | nmdc:mga00v17_127149_c1 | 3300050491 | Bacteria | 1627 |
| 212 | nmdc:mga0yw44_155_c1 | 3300050492 | Bacteria | 23178 |
| 213 | nmdc:mga06z11_68375_c1 | 3300050494 | Bacteria | 1872 |
| 214 | nmdc:mga09592_11223_c1 | 3300050508 | Bacteria | 7290 |
| 215 | nmdc:mga09592_12870_c1 | 3300050508 | Bacteria | 6821 |
| 216 | nmdc:mga0qj67_20186_c1 | 3300050509 | Bacteria | 5100 |
| 217 | nmdc:mga0qj67_94605_c1 | 3300050509 | Bacteria | 2404 |
| 218 | nmdc:mga06r32_2468_c1 | 3300050510 | Bacteria | 16549 |
| 219 | nmdc:mga06r32_268375_c1 | 3300050510 | Bacteria | 1694 |
| 220 | nmdc:mga08y16_3332_c1 | 3300050511 | Bacteria | 16637 |
| 221 | nmdc:mga0n895_247047_c1 | 3300050512 | Bacteria | 1811 |
| 222 | nmdc:mga0n895_6732_c1 | 3300050512 | Bacteria | 9801 |
| 223 | nmdc:mga0a205_46220_c1 | 3300050515 | Bacteria | 4198 |
| 224 | Ga0495601_0128696 | 3300053077 | Bacteria | 1648 |
| 225 | Ga0495619_0391981 | 3300053085 | Bacteria | 959 |
| 226 | Ga0500556_0020518 | 3300053104 | Bacteria | 2116 |
| 227 | Ga0500573_0005199 | 3300053140 | Bacteria | 6945 |
| 228 | Ga0500616_0000072 | 3300053153 | Bacteria | 231471 |
| 229 | Ga0500620_008840 | 3300053155 | Bacteria | 2568 |
| 230 | Ga0500622_0000070 | 3300053156 | Bacteria | 115284 |
| 231 | Ga0500622_0018955 | 3300053156 | Bacteria | 3656 |
| 232 | Ga0500634_0041358 | 3300053161 | Bacteria | 2502 |
| 233 | Ga0501084_0013978 | 3300054114 | Bacteria | 6645 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053085 | Ga0495619_0391981 | Ga0495619_0391981_18_824 | 264 |
| 2 | 3300025922 | Ga0207646_10105159 | Ga0207646_101051593 | 282 |
| 3 | 3300013296 | Ga0157374_10163203 | Ga0157374_101632032 | 291 |
| 4 | 3300047318 | Ga0495636_0123112 | Ga0495636_0123112_28_936 | 295 |
| 5 | iso_pu_bacteria | 2643221679 | 2644444680 | 295 |
| 6 | 3300048921 | Ga0496118_0244720 | Ga0496118_0244720_82_993 | 300 |
| 7 | 3300046683 | Ga0495658_0219786 | Ga0495658_0219786_255_1172 | 301 |
| 8 | 3300049576 | Ga0501040_0396634 | Ga0501040_0396634_59_970 | 301 |
| 9 | 3300050512 | nmdc:mga0n895_6732_c1 | nmdc:mga0n895_6732_c1_6530_7453 | 302 |
| 10 | 3300053104 | Ga0500556_0020518 | Ga0500556_0020518_1164_2090 | 302 |
| 11 | 3300005331 | Ga0070670_100006662 | Ga0070670_10000666210 | 303 |
| 12 | 3300005364 | Ga0070673_100040279 | Ga0070673_1000402793 | 303 |
| 13 | 3300005718 | Ga0068866_10104963 | Ga0068866_101049632 | 303 |
| 14 | 3300006237 | Ga0097621_100134353 | Ga0097621_1001343532 | 303 |
| 15 | 3300009094 | Ga0111539_10067819 | Ga0111539_100678194 | 303 |
| 16 | 3300009101 | Ga0105247_10008959 | Ga0105247_100089593 | 303 |
| 17 | 3300009177 | Ga0105248_10015580 | Ga0105248_100155803 | 303 |
| 18 | 3300009177 | Ga0105248_10131792 | Ga0105248_101317922 | 303 |
| 19 | 3300009177 | Ga0105248_10481359 | Ga0105248_104813592 | 303 |
| 20 | 3300009553 | Ga0105249_10000875 | Ga0105249_1000087522 | 303 |
| 21 | 3300013306 | Ga0163162_10016738 | Ga0163162_100167389 | 303 |
| 22 | 3300014325 | Ga0163163_10065773 | Ga0163163_100657733 | 303 |
| 23 | 3300014968 | Ga0157379_10004938 | Ga0157379_100049388 | 303 |
| 24 | 3300025926 | Ga0207659_10008548 | Ga0207659_100085485 | 303 |
| 25 | 3300025931 | Ga0207644_10004043 | Ga0207644_100040432 | 303 |
| 26 | 3300026121 | Ga0207683_10036431 | Ga0207683_100364313 | 303 |
| 27 | 3300047320 | Ga0495672_0172683 | Ga0495672_0172683_155_1075 | 303 |
| 28 | 3300048905 | Ga0496102_0356273 | Ga0496102_0356273_79_1005 | 303 |
| 29 | 3300050491 | nmdc:mga00v17_127149_c1 | nmdc:mga00v17_127149_c1_529_1455 | 303 |
| 30 | 3300050494 | nmdc:mga06z11_68375_c1 | nmdc:mga06z11_68375_c1_833_1759 | 303 |
| 31 | 3300050510 | nmdc:mga06r32_268375_c1 | nmdc:mga06r32_268375_c1_648_1589 | 303 |
| 32 | 3300050512 | nmdc:mga0n895_247047_c1 | nmdc:mga0n895_247047_c1_568_1509 | 303 |
| 33 | 3300053077 | Ga0495601_0128696 | Ga0495601_0128696_499_1437 | 303 |
| 34 | 3300049571 | Ga0501034_0055478 | Ga0501034_0055478_341_1264 | 304 |
| 35 | 3300005577 | Ga0068857_100000517 | Ga0068857_10000051717 | 312 |
| 36 | 3300048924 | Ga0496121_0000025 | Ga0496121_0000025_187043_188047 | 312 |
| 37 | 3300053155 | Ga0500620_008840 | Ga0500620_008840_1425_2435 | 312 |
| 38 | 3300050510 | nmdc:mga06r32_2468_c1 | nmdc:mga06r32_2468_c1_14315_15286 | 313 |
| 39 | 3300049586 | Ga0501070_0004216 | Ga0501070_0004216_106_1128 | 314 |
| 40 | iso_pu_bacteria | 2643221591 | 2643965407 | 316 |
| 41 | iso_pu_bacteria | 2894817345 | 2894819198 | 318 |
| 42 | 3300031251 | Ga0265327_10001021 | Ga0265327_1000102128 | 319 |
| 43 | iso_pu_bacteria | 2571042588 | 2573037760 | 319 |
| 44 | iso_pu_bacteria | 2579778775 | 2580931166 | 319 |
| 45 | iso_pu_bacteria | 2619619294 | 2621273027 | 319 |
| 46 | iso_pu_bacteria | 2881636855 | 2881638593 | 319 |
| 47 | iso_pu_bacteria | 2996310559 | 2996311361 | 319 |
| 48 | 3300048927 | Ga0496124_0030997 | Ga0496124_0030997_43_1014 | 320 |
| 49 | 3300048928 | Ga0496125_0000292 | Ga0496125_0000292_64000_64971 | 320 |
| 50 | 3300053161 | Ga0500634_0041358 | Ga0500634_0041358_1190_2161 | 320 |
| 51 | iso_pu_bacteria | 2510917026 | 2511169163 | 320 |
| 52 | iso_pu_bacteria | 2585427633 | 2585993087 | 320 |
| 53 | iso_pu_bacteria | 2585427634 | 2586003823 | 320 |
| 54 | iso_pu_bacteria | 2738543024 | 2739305870 | 320 |
| 55 | iso_pu_bacteria | 2919171160 | 2919174006 | 320 |
| 56 | 3300005329 | Ga0070683_100000487 | Ga0070683_10000048710 | 321 |
| 57 | 3300005338 | Ga0068868_100306515 | Ga0068868_1003065152 | 321 |
| 58 | 3300005535 | Ga0070684_100000452 | Ga0070684_1000004529 | 321 |
| 59 | 3300005535 | Ga0070684_100429469 | Ga0070684_1004294691 | 321 |
| 60 | 3300005543 | Ga0070672_100208547 | Ga0070672_1002085471 | 321 |
| 61 | 3300005564 | Ga0070664_100145088 | Ga0070664_1001450883 | 321 |
| 62 | 3300005617 | Ga0068859_100384677 | Ga0068859_1003846772 | 321 |
| 63 | 3300005842 | Ga0068858_100022729 | Ga0068858_1000227295 | 321 |
| 64 | 3300006358 | Ga0068871_100097886 | Ga0068871_1000978861 | 321 |
| 65 | 3300006881 | Ga0068865_100014919 | Ga0068865_1000149194 | 321 |
| 66 | 3300006881 | Ga0068865_100140069 | Ga0068865_1001400692 | 321 |
| 67 | 3300006931 | Ga0097620_100384679 | Ga0097620_1003846792 | 321 |
| 68 | 3300009177 | Ga0105248_10001925 | Ga0105248_100019257 | 321 |
| 69 | 3300014325 | Ga0163163_10188365 | Ga0163163_101883652 | 321 |
| 70 | 3300014325 | Ga0163163_10349173 | Ga0163163_103491731 | 321 |
| 71 | 3300014968 | Ga0157379_10044372 | Ga0157379_100443724 | 321 |
| 72 | 3300014969 | Ga0157376_10028085 | Ga0157376_100280854 | 321 |
| 73 | 3300025925 | Ga0207650_10159826 | Ga0207650_101598262 | 321 |
| 74 | 3300025934 | Ga0207686_10032061 | Ga0207686_100320614 | 321 |
| 75 | 3300025938 | Ga0207704_10101267 | Ga0207704_101012672 | 321 |
| 76 | 3300025941 | Ga0207711_10186564 | Ga0207711_101865642 | 321 |
| 77 | 3300025942 | Ga0207689_10055435 | Ga0207689_100554352 | 321 |
| 78 | 3300025944 | Ga0207661_10000051 | Ga0207661_1000005152 | 321 |
| 79 | 3300026023 | Ga0207677_10225703 | Ga0207677_102257032 | 321 |
| 80 | 3300028381 | Ga0268264_10381501 | Ga0268264_103815012 | 321 |
| 81 | 3300042004 | Ga0439445_0030702 | Ga0439445_0030702_205_1176 | 321 |
| 82 | 3300044673 | Ga0453683_0003745 | Ga0453683_0003745_7230_8207 | 321 |
| 83 | 3300044712 | Ga0453684_0038516 | Ga0453684_0038516_1997_2974 | 321 |
| 84 | 3300045051 | Ga0451576_0001105 | Ga0451576_0001105_7167_8144 | 321 |
| 85 | 3300046476 | Ga0495662_0053182 | Ga0495662_0053182_872_1849 | 321 |
| 86 | 3300046477 | Ga0495664_0123978 | Ga0495664_0123978_411_1403 | 321 |
| 87 | 3300046535 | Ga0495586_0126463 | Ga0495586_0126463_271_1248 | 321 |
| 88 | 3300046543 | Ga0495645_0006945 | Ga0495645_0006945_1426_2403 | 321 |
| 89 | 3300048907 | Ga0496104_0036337 | Ga0496104_0036337_1811_2788 | 321 |
| 90 | 3300048911 | Ga0496108_0056122 | Ga0496108_0056122_1363_2340 | 321 |
| 91 | 3300048912 | Ga0496109_0264977 | Ga0496109_0264977_620_1597 | 321 |
| 92 | 3300048915 | Ga0496112_0017264 | Ga0496112_0017264_4669_5646 | 321 |
| 93 | 3300048928 | Ga0496125_0159493 | Ga0496125_0159493_146_1225 | 321 |
| 94 | 3300049568 | Ga0501031_0272851 | Ga0501031_0272851_58_1029 | 321 |
| 95 | 3300049578 | Ga0501042_0260051 | Ga0501042_0260051_235_1206 | 321 |
| 96 | 3300053140 | Ga0500573_0005199 | Ga0500573_0005199_2421_3395 | 321 |
| 97 | 3300005445 | Ga0070708_100491276 | Ga0070708_1004912761 | 322 |
| 98 | 3300005545 | Ga0070695_100011264 | Ga0070695_1000112646 | 322 |
| 99 | 3300006038 | Ga0075365_10001994 | Ga0075365_100019947 | 322 |
| 100 | 3300006914 | Ga0075436_100026984 | Ga0075436_1000269844 | 322 |
| 101 | 3300007076 | Ga0075435_100026644 | Ga0075435_1000266443 | 322 |
| 102 | 3300025272 | Ga0209455_1016811 | Ga0209455_10168112 | 322 |
| 103 | 3300037312 | Ga0395899_0008193 | Ga0395899_0008193_1900_2901 | 322 |
| 104 | 3300037466 | Ga0395898_0066793 | Ga0395898_0066793_1829_2830 | 322 |
| 105 | 3300050492 | nmdc:mga0yw44_155_c1 | nmdc:mga0yw44_155_c1_16439_17407 | 322 |
| 106 | 3300005290 | Ga0065712_10002054 | Ga0065712_100020544 | 323 |
| 107 | 3300005328 | Ga0070676_10002673 | Ga0070676_100026737 | 323 |
| 108 | 3300005330 | Ga0070690_100002747 | Ga0070690_1000027479 | 323 |
| 109 | 3300005331 | Ga0070670_100000065 | Ga0070670_10000006568 | 323 |
| 110 | 3300005331 | Ga0070670_100000802 | Ga0070670_10000080210 | 323 |
| 111 | 3300005334 | Ga0068869_100000856 | Ga0068869_10000085613 | 323 |
| 112 | 3300005335 | Ga0070666_10062579 | Ga0070666_100625793 | 323 |
| 113 | 3300005340 | Ga0070689_100206784 | Ga0070689_1002067842 | 323 |
| 114 | 3300005347 | Ga0070668_100026462 | Ga0070668_1000264624 | 323 |
| 115 | 3300005353 | Ga0070669_100007630 | Ga0070669_1000076302 | 323 |
| 116 | 3300005353 | Ga0070669_100178712 | Ga0070669_1001787122 | 323 |
| 117 | 3300005354 | Ga0070675_100005187 | Ga0070675_1000051877 | 323 |
| 118 | 3300005354 | Ga0070675_100006421 | Ga0070675_1000064214 | 323 |
| 119 | 3300005354 | Ga0070675_100087730 | Ga0070675_1000877301 | 323 |
| 120 | 3300005355 | Ga0070671_100007771 | Ga0070671_1000077712 | 323 |
| 121 | 3300005355 | Ga0070671_100063976 | Ga0070671_1000639763 | 323 |
| 122 | 3300005356 | Ga0070674_100046506 | Ga0070674_1000465063 | 323 |
| 123 | 3300005367 | Ga0070667_100031763 | Ga0070667_1000317634 | 323 |
| 124 | 3300005434 | Ga0070709_10018672 | Ga0070709_100186725 | 323 |
| 125 | 3300005436 | Ga0070713_100298347 | Ga0070713_1002983472 | 323 |
| 126 | 3300005438 | Ga0070701_10035776 | Ga0070701_100357763 | 323 |
| 127 | 3300005441 | Ga0070700_100000687 | Ga0070700_10000068711 | 323 |
| 128 | 3300005444 | Ga0070694_100231292 | Ga0070694_1002312922 | 323 |
| 129 | 3300005456 | Ga0070678_100207694 | Ga0070678_1002076941 | 323 |
| 130 | 3300005459 | Ga0068867_100008497 | Ga0068867_1000084975 | 323 |
| 131 | 3300005459 | Ga0068867_100195188 | Ga0068867_1001951881 | 323 |
| 132 | 3300005543 | Ga0070672_100018684 | Ga0070672_1000186842 | 323 |
| 133 | 3300005544 | Ga0070686_100009478 | Ga0070686_1000094786 | 323 |
| 134 | 3300005545 | Ga0070695_100224885 | Ga0070695_1002248851 | 323 |
| 135 | 3300005548 | Ga0070665_100004019 | Ga0070665_10000401916 | 323 |
| 136 | 3300005548 | Ga0070665_100474995 | Ga0070665_1004749951 | 323 |
| 137 | 3300005564 | Ga0070664_100020640 | Ga0070664_1000206405 | 323 |
| 138 | 3300005578 | Ga0068854_100066152 | Ga0068854_1000661524 | 323 |
| 139 | 3300005617 | Ga0068859_100023905 | Ga0068859_1000239052 | 323 |
| 140 | 3300005617 | Ga0068859_100035264 | Ga0068859_1000352645 | 323 |
| 141 | 3300005617 | Ga0068859_100189685 | Ga0068859_1001896852 | 323 |
| 142 | 3300005618 | Ga0068864_100000224 | Ga0068864_10000022447 | 323 |
| 143 | 3300005618 | Ga0068864_100031074 | Ga0068864_1000310744 | 323 |
| 144 | 3300005719 | Ga0068861_100006800 | Ga0068861_1000068005 | 323 |
| 145 | 3300005841 | Ga0068863_100000061 | Ga0068863_100000061102 | 323 |
| 146 | 3300005842 | Ga0068858_100012412 | Ga0068858_1000124129 | 323 |
| 147 | 3300005843 | Ga0068860_100000123 | Ga0068860_10000012316 | 323 |
| 148 | 3300006042 | Ga0075368_10013362 | Ga0075368_100133622 | 323 |
| 149 | 3300006186 | Ga0075369_10048100 | Ga0075369_100481002 | 323 |
| 150 | 3300006195 | Ga0075366_10046279 | Ga0075366_100462792 | 323 |
| 151 | 3300006846 | Ga0075430_100000530 | Ga0075430_1000005305 | 323 |
| 152 | 3300006846 | Ga0075430_100012800 | Ga0075430_1000128008 | 323 |
| 153 | 3300006847 | Ga0075431_100491343 | Ga0075431_1004913431 | 323 |
| 154 | 3300006871 | Ga0075434_100324978 | Ga0075434_1003249782 | 323 |
| 155 | 3300006880 | Ga0075429_100015033 | Ga0075429_1000150336 | 323 |
| 156 | 3300006931 | Ga0097620_100023905 | Ga0097620_1000239052 | 323 |
| 157 | 3300006931 | Ga0097620_100035264 | Ga0097620_1000352645 | 323 |
| 158 | 3300006931 | Ga0097620_100189685 | Ga0097620_1001896852 | 323 |
| 159 | 3300009011 | Ga0105251_10022897 | Ga0105251_100228973 | 323 |
| 160 | 3300009094 | Ga0111539_10000850 | Ga0111539_1000085038 | 323 |
| 161 | 3300009098 | Ga0105245_10277920 | Ga0105245_102779202 | 323 |
| 162 | 3300009101 | Ga0105247_10131437 | Ga0105247_101314372 | 323 |
| 163 | 3300009147 | Ga0114129_10406203 | Ga0114129_104062032 | 323 |
| 164 | 3300009176 | Ga0105242_10007778 | Ga0105242_100077786 | 323 |
| 165 | 3300009551 | Ga0105238_10003023 | Ga0105238_1000302312 | 323 |
| 166 | 3300013308 | Ga0157375_10164026 | Ga0157375_101640262 | 323 |
| 167 | 3300014325 | Ga0163163_10021553 | Ga0163163_100215532 | 323 |
| 168 | 3300014325 | Ga0163163_10059966 | Ga0163163_100599661 | 323 |
| 169 | 3300014326 | Ga0157380_10082118 | Ga0157380_100821182 | 323 |
| 170 | 3300014968 | Ga0157379_10366863 | Ga0157379_103668631 | 323 |
| 171 | 3300025899 | Ga0207642_10023192 | Ga0207642_100231923 | 323 |
| 172 | 3300025900 | Ga0207710_10035620 | Ga0207710_100356202 | 323 |
| 173 | 3300025903 | Ga0207680_10044119 | Ga0207680_100441192 | 323 |
| 174 | 3300025903 | Ga0207680_10060416 | Ga0207680_100604162 | 323 |
| 175 | 3300025906 | Ga0207699_10083967 | Ga0207699_100839673 | 323 |
| 176 | 3300025907 | Ga0207645_10007933 | Ga0207645_100079335 | 323 |
| 177 | 3300025908 | Ga0207643_10017924 | Ga0207643_100179242 | 323 |
| 178 | 3300025924 | Ga0207694_10015346 | Ga0207694_100153465 | 323 |
| 179 | 3300025925 | Ga0207650_10000031 | Ga0207650_10000031107 | 323 |
| 180 | 3300025925 | Ga0207650_10042216 | Ga0207650_100422162 | 323 |
| 181 | 3300025925 | Ga0207650_10234585 | Ga0207650_102345852 | 323 |
| 182 | 3300025925 | Ga0207650_10271205 | Ga0207650_102712052 | 323 |
| 183 | 3300025926 | Ga0207659_10000662 | Ga0207659_1000066214 | 323 |
| 184 | 3300025926 | Ga0207659_10008986 | Ga0207659_100089866 | 323 |
| 185 | 3300025926 | Ga0207659_10028582 | Ga0207659_100285823 | 323 |
| 186 | 3300025928 | Ga0207700_10075635 | Ga0207700_100756353 | 323 |
| 187 | 3300025934 | Ga0207686_10001676 | Ga0207686_100016764 | 323 |
| 188 | 3300025935 | Ga0207709_10008753 | Ga0207709_100087531 | 323 |
| 189 | 3300025938 | Ga0207704_10003078 | Ga0207704_100030787 | 323 |
| 190 | 3300025940 | Ga0207691_10048868 | Ga0207691_100488684 | 323 |
| 191 | 3300025940 | Ga0207691_10081308 | Ga0207691_100813083 | 323 |
| 192 | 3300025941 | Ga0207711_10110758 | Ga0207711_101107583 | 323 |
| 193 | 3300025942 | Ga0207689_10005433 | Ga0207689_100054336 | 323 |
| 194 | 3300025945 | Ga0207679_10044966 | Ga0207679_100449662 | 323 |
| 195 | 3300025960 | Ga0207651_10002962 | Ga0207651_100029624 | 323 |
| 196 | 3300025961 | Ga0207712_10000663 | Ga0207712_1000066322 | 323 |
| 197 | 3300025972 | Ga0207668_10003444 | Ga0207668_100034449 | 323 |
| 198 | 3300025986 | Ga0207658_10000301 | Ga0207658_1000030114 | 323 |
| 199 | 3300026035 | Ga0207703_10008120 | Ga0207703_100081203 | 323 |
| 200 | 3300026075 | Ga0207708_10001215 | Ga0207708_1000121512 | 323 |
| 201 | 3300026088 | Ga0207641_10001268 | Ga0207641_1000126811 | 323 |
| 202 | 3300026089 | Ga0207648_10003495 | Ga0207648_1000349513 | 323 |
| 203 | 3300026095 | Ga0207676_10001915 | Ga0207676_100019159 | 323 |
| 204 | 3300026095 | Ga0207676_10008100 | Ga0207676_100081005 | 323 |
| 205 | 3300026118 | Ga0207675_100003622 | Ga0207675_1000036227 | 323 |
| 206 | 3300026121 | Ga0207683_10240165 | Ga0207683_102401652 | 323 |
| 207 | 3300027907 | Ga0207428_10001495 | Ga0207428_1000149519 | 323 |
| 208 | 3300028379 | Ga0268266_10002065 | Ga0268266_100020653 | 323 |
| 209 | 3300028380 | Ga0268265_10003760 | Ga0268265_1000376012 | 323 |
| 210 | 3300028381 | Ga0268264_10000178 | Ga0268264_1000017856 | 323 |
| 211 | 3300037466 | Ga0395898_0080049 | Ga0395898_0080049_1260_2255 | 323 |
| 212 | 3300039437 | Ga0436365_1687961 | Ga0436365_1687961_960_1946 | 323 |
| 213 | 3300044712 | Ga0453684_0044200 | Ga0453684_0044200_363_1349 | 323 |
| 214 | 3300044712 | Ga0453684_0111328 | Ga0453684_0111328_2107_3093 | 323 |
| 215 | 3300044712 | Ga0453684_0136486 | Ga0453684_0136486_356_1342 | 323 |
| 216 | 3300046524 | Ga0495648_0062567 | Ga0495648_0062567_55_1035 | 323 |
| 217 | 3300049570 | Ga0501033_0211508 | Ga0501033_0211508_56_1036 | 323 |
| 218 | 3300049572 | Ga0501036_0045903 | Ga0501036_0045903_335_1336 | 323 |
| 219 | 3300049574 | Ga0501038_0113329 | Ga0501038_0113329_1052_2053 | 323 |
| 220 | 3300049577 | Ga0501041_0025110 | Ga0501041_0025110_2349_3350 | 323 |
| 221 | 3300049578 | Ga0501042_0025133 | Ga0501042_0025133_693_1694 | 323 |
| 222 | 3300049580 | Ga0501046_0118801 | Ga0501046_0118801_223_1224 | 323 |
| 223 | 3300049591 | Ga0501075_0136529 | Ga0501075_0136529_614_1615 | 323 |
| 224 | 3300049592 | Ga0501076_0079599 | Ga0501076_0079599_256_1257 | 323 |
| 225 | 3300049742 | Ga0501080_0069884 | Ga0501080_0069884_2231_3232 | 323 |
| 226 | 3300049743 | Ga0501081_0012914 | Ga0501081_0012914_2516_3517 | 323 |
| 227 | 3300050508 | nmdc:mga09592_11223_c1 | nmdc:mga09592_11223_c1_3100_4098 | 323 |
| 228 | 3300050508 | nmdc:mga09592_12870_c1 | nmdc:mga09592_12870_c1_4936_5937 | 323 |
| 229 | 3300050509 | nmdc:mga0qj67_20186_c1 | nmdc:mga0qj67_20186_c1_2231_3232 | 323 |
| 230 | 3300050509 | nmdc:mga0qj67_94605_c1 | nmdc:mga0qj67_94605_c1_1363_2361 | 323 |
| 231 | 3300050511 | nmdc:mga08y16_3332_c1 | nmdc:mga08y16_3332_c1_1828_2826 | 323 |
| 232 | 3300050515 | nmdc:mga0a205_46220_c1 | nmdc:mga0a205_46220_c1_1543_2541 | 323 |
| 233 | 3300054114 | Ga0501084_0013978 | Ga0501084_0013978_2743_3744 | 323 |
| 234 | 3300003215 | JGI25153J46596_10032259 | JGI25153J46596_100322592 | 324 |
| 235 | 3300003781 | Ga0055536_1002411 | Ga0055536_10024116 | 324 |
| 236 | 3300003792 | Ga0055540_1003038 | Ga0055540_10030385 | 324 |
| 237 | 3300003794 | Ga0055531_10000903 | Ga0055531_100009036 | 324 |
| 238 | 3300025292 | Ga0209676_1001187 | Ga0209676_100118717 | 324 |
| 239 | 3300025297 | Ga0209758_1001075 | Ga0209758_100107518 | 324 |
| 240 | 3300025298 | Ga0209050_1012474 | Ga0209050_10124743 | 324 |
| 241 | 3300025303 | Ga0209051_1001073 | Ga0209051_100107311 | 324 |
| 242 | 3300025304 | Ga0209257_1001332 | Ga0209257_100133213 | 324 |
| 243 | 3300048929 | Ga0496126_0177015 | Ga0496126_0177015_347_1321 | 324 |
| 244 | 3300053153 | Ga0500616_0000072 | Ga0500616_0000072_60140_61114 | 324 |
| 245 | 3300053156 | Ga0500622_0000070 | Ga0500622_0000070_54968_55942 | 324 |
| 246 | 3300053156 | Ga0500622_0018955 | Ga0500622_0018955_1093_2067 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7utf-assembly2.cif.gz_D | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9493 | 1 | 320 |
| 7utf-assembly1.cif.gz_A | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9453 | 1 | 320 |
| 7utf-assembly1.cif.gz_C | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9431 | 1 | 320 |
| 7utf-assembly2.cif.gz_B | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9334 | 1 | 320 |
| 4aub-assembly1.cif.gz_F | the complex structure of the bacterial aldo-keto reductase akr14a1 with nadp and citrate | 0.9171 | 1 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77735_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9553 | 1 | 322 | 3.20.20.100 |
| af_P77735_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9524 | 1 | 322 | 3.20.20.100 |
| af_Q02895_4_341_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9343 | 1 | 318 | 3.20.20.100 |
| af_G2TRN6_1_317_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9339 | 23 | 316 | 3.20.20.100 |
| af_O59826_13_339_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9191 | 1 | 314 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8KXA4-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9863 | 2 | 159 |
GO:0005829
GO:0016491 |
| AF-A0A817MNW5-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.986 | 1 | 154 |
GO:0005829
|
| AF-A0A381TWP4-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9851 | 1 | 166 |
GO:0005829
|
| AF-A0A3M1Z231-F1-model_v4 | Aldo/keto reductase | 0.9833 | 1 | 210 |
GO:0005829
GO:0016491 |
| AF-A0A7W5XCZ6-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9827 | 1 | 175 |
GO:0005829
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar