F358402

General Info

Members Datasets Scaffolds Average Seq Length
246 177 492 134

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0211188|Ga0466967_0211188_1009_1491
Length 160
Sequence MAHVLFVCLHNAGRSQMSQALFERAAAGRHRAASAGTTPAEHVHPEVVEAMAELGVAVGDRVPQLLTDELALQADVIVTMGCGDECPYIPGKRYLDWELPDPKGRPLAEVRATRDEIARRVDALLAELDRSYASPSQKPSGSIRPITPIPRRNTFFERGK

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 8.54
Rhizosphere 90.65
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0211188 3300045976 Bacteria 1841
2 JGI24748J21848_1000858 3300002074 Bacteria 3290
3 JGI24034J26672_10006837 3300002239 Bacteria 1651
4 JGI24742J22300_10025165 3300002244 Bacteria 1028
5 Ga0070658_10114019 3300005327 Bacteria 2241
6 Ga0070676_10368930 3300005328 Bacteria 991
7 Ga0070683_101005343 3300005329 Bacteria 801
8 Ga0068869_100974517 3300005334 Bacteria 737
9 Ga0070666_10007238 3300005335 Bacteria 6841
10 Ga0070666_10010923 3300005335 Bacteria 5689
11 Ga0068868_100197329 3300005338 Bacteria 1676
12 Ga0068868_100399827 3300005338 Bacteria 1185
13 Ga0070660_100026254 3300005339 Bacteria 4334
14 Ga0070660_100129757 3300005339 Bacteria 2016
15 Ga0070689_100383236 3300005340 Bacteria 1185
16 Ga0070691_10003498 3300005341 Bacteria 7082
17 Ga0070687_100560785 3300005343 Bacteria 779
18 Ga0070668_100005191 3300005347 Bacteria 9656
19 Ga0070668_100267581 3300005347 Bacteria 1424
20 Ga0070659_100498402 3300005366 Bacteria 1038
21 Ga0070667_100226805 3300005367 Bacteria 1664
22 Ga0070709_11331363 3300005434 Bacteria 580
23 Ga0070714_100956923 3300005435 Bacteria 832
24 Ga0070713_100051426 3300005436 Bacteria 3407
25 Ga0070713_100186610 3300005436 Bacteria 1866
26 Ga0070710_10003941 3300005437 Bacteria 7033
27 Ga0070701_10402127 3300005438 Bacteria 868
28 Ga0070711_100002706 3300005439 Bacteria 10170
29 Ga0070705_100001812 3300005440 Bacteria 11029
30 Ga0070700_100037053 3300005441 Bacteria 2963
31 Ga0070708_100001035 3300005445 Bacteria 21186
32 Ga0070662_100023197 3300005457 Bacteria 4260
33 Ga0070662_100509971 3300005457 Bacteria 1004
34 Ga0070662_101173670 3300005457 Bacteria 660
35 Ga0070681_11181030 3300005458 Bacteria 687
36 Ga0070707_100036993 3300005468 Bacteria 4658
37 Ga0070707_100092790 3300005468 Bacteria 2923
38 Ga0070698_100013418 3300005471 Bacteria 8673
39 Ga0070699_100000142 3300005518 Bacteria 67557
40 Ga0070679_100034741 3300005530 Bacteria 4998
41 Ga0070697_100075257 3300005536 Bacteria 2775
42 Ga0070695_100070667 3300005545 Bacteria 2284
43 Ga0070665_100004811 3300005548 Bacteria 14035
44 Ga0070665_100132607 3300005548 Bacteria 2493
45 Ga0070702_100182876 3300005615 Bacteria 1373
46 Ga0068864_100000035 3300005618 Bacteria 195218
47 Ga0068861_100009279 3300005719 Bacteria 6788
48 Ga0068863_102706540 3300005841 Bacteria 505
49 Ga0068858_100308990 3300005842 Bacteria 1509
50 Ga0070717_10010857 3300006028 Bacteria 6893
51 Ga0070715_10463078 3300006163 Bacteria 718
52 Ga0070716_100062871 3300006173 Bacteria 2154
53 Ga0070712_100031313 3300006175 Bacteria 3582
54 Ga0070712_100060118 3300006175 Bacteria 2679
55 Ga0070712_100860681 3300006175 Bacteria 780
56 Ga0075433_10014222 3300006852 Bacteria 6498
57 Ga0075434_100012418 3300006871 Bacteria 8075
58 Ga0105240_11071700 3300009093 Bacteria 859
59 Ga0111539_10533860 3300009094 Bacteria 1367
60 Ga0111539_11460000 3300009094 Bacteria 793
61 Ga0111539_12830848 3300009094 Bacteria 562
62 Ga0105245_10004387 3300009098 Bacteria 12486
63 Ga0105245_10958500 3300009098 Bacteria 899
64 Ga0114129_10003026 3300009147 Bacteria 23560
65 Ga0105243_10715568 3300009148 Bacteria 978
66 Ga0105243_11625277 3300009148 Bacteria 673
67 Ga0105242_11101379 3300009176 Bacteria 808
68 Ga0105242_11535718 3300009176 Bacteria 698
69 Ga0105249_10037401 3300009553 Bacteria 4405
70 Ga0105239_10502397 3300010375 Bacteria 1379
71 Ga0105246_11310589 3300011119 Bacteria 671
72 Ga0157378_10039100 3300013297 Bacteria 4207
73 Ga0163162_10632745 3300013306 Bacteria 1194
74 Ga0157372_11052573 3300013307 Bacteria 942
75 Ga0157375_13496818 3300013308 Bacteria 523
76 Ga0157379_10472378 3300014968 Bacteria 1160
77 Ga0213873_10288825 3300021358 Bacteria 527
78 Ga0207656_10528915 3300025321 Bacteria 600
79 Ga0207653_10024481 3300025885 Bacteria 1927
80 Ga0207692_10114270 3300025898 Bacteria 1502
81 Ga0207688_10735457 3300025901 Bacteria 624
82 Ga0207680_10013762 3300025903 Bacteria 4164
83 Ga0207680_10034956 3300025903 Bacteria 2880
84 Ga0207699_10040637 3300025906 Bacteria 2681
85 Ga0207705_10187783 3300025909 Bacteria 1562
86 Ga0207705_10406247 3300025909 Bacteria 1054
87 Ga0207693_10238372 3300025915 Bacteria 1428
88 Ga0207663_10082342 3300025916 Bacteria 2110
89 Ga0207657_10128406 3300025919 Bacteria 2080
90 Ga0207657_10201428 3300025919 Bacteria 1601
91 Ga0207652_10198647 3300025921 Bacteria 1805
92 Ga0207646_10045555 3300025922 Bacteria 3938
93 Ga0207687_10047563 3300025927 Bacteria 2974
94 Ga0207700_10038531 3300025928 Bacteria 3470
95 Ga0207700_10232124 3300025928 Bacteria 1569
96 Ga0207700_10927847 3300025928 Bacteria 779
97 Ga0207664_10443639 3300025929 Bacteria 1158
98 Ga0207690_10190414 3300025932 Bacteria 1551
99 Ga0207706_10000901 3300025933 Bacteria 30536
100 Ga0207706_10290119 3300025933 Bacteria 1426
101 Ga0207670_10315489 3300025936 Bacteria 1229
102 Ga0207704_10896073 3300025938 Bacteria 746
103 Ga0207665_10063537 3300025939 Bacteria 2507
104 Ga0207691_10246777 3300025940 Bacteria 1542
105 Ga0207689_10156021 3300025942 Bacteria 1882
106 Ga0207661_11050375 3300025944 Bacteria 750
107 Ga0207712_10254358 3300025961 Bacteria 1421
108 Ga0207668_10956047 3300025972 Bacteria 764
109 Ga0207640_10099017 3300025981 Bacteria 2040
110 Ga0207658_10012425 3300025986 Bacteria 5817
111 Ga0207677_11666176 3300026023 Bacteria 591
112 Ga0207708_10009357 3300026075 Bacteria 7254
113 Ga0207676_10000026 3300026095 Bacteria 248593
114 Ga0207675_100001369 3300026118 Bacteria 24433
115 Ga0207683_10185752 3300026121 Bacteria 1886
116 Ga0207683_10350707 3300026121 Bacteria 1354
117 Ga0207698_10775923 3300026142 Bacteria 959
118 Ga0268266_10000775 3300028379 Bacteria 42696
119 Ga0268266_10027142 3300028379 Bacteria 4871
120 Ga0268266_10057273 3300028379 Bacteria 3353
121 Ga0265327_10042001 3300031251 Bacteria 2459
122 Ga0307410_10845165 3300031852 Bacteria 781
123 Ga0307406_11124396 3300031901 Bacteria 679
124 Ga0307406_11320542 3300031901 Bacteria 630
125 Ga0307407_10534769 3300031903 Bacteria 864
126 Ga0307412_11696319 3300031911 Bacteria 579
127 Ga0307409_100180384 3300031995 Bacteria 1869
128 Ga0307409_102516445 3300031995 Bacteria 543
129 Ga0307414_11854833 3300032004 Bacteria 563
130 Ga0307415_100903485 3300032126 Bacteria 814
131 Ga0373923_0564205 3300035111 Bacteria 559
132 Ga0373953_0426200 3300035117 Bacteria 585
133 Ga0373956_0174496 3300035119 Bacteria 1015
134 Ga0373955_0043275 3300035172 Bacteria 2422
135 Ga0316574_0198430 3300035398 Bacteria 1289
136 Ga0373924_0143071 3300035410 Bacteria 1044
137 Ga0373937_0008747 3300036401 Bacteria 8787
138 Ga0373937_0012511 3300036401 Bacteria 7467
139 Ga0395899_0500000 3300037312 Bacteria 789
140 Ga0395898_0410839 3300037466 Bacteria 1290
141 Ga0395905_0568965 3300037471 Bacteria 1035
142 Ga0395901_0537555 3300038443 Bacteria 1186
143 Ga0395901_0662589 3300038443 Bacteria 1045
144 Ga0395901_1012991 3300038443 Bacteria 806
145 Ga0395901_1151150 3300038443 Bacteria 744
146 Ga0395901_1419248 3300038443 Bacteria 652
147 Ga0466963_0081737 3300044694 Bacteria 2189
148 Ga0466963_0483073 3300044694 Bacteria 874
149 Ga0466964_0220152 3300044706 Bacteria 921
150 Ga0466964_0278297 3300044706 Bacteria 835
151 Ga0466967_0034450 3300045976 Bacteria 4298
152 Ga0466967_0044008 3300045976 Bacteria 3869
153 Ga0466967_0224300 3300045976 Bacteria 1787
154 Ga0466967_0224745 3300045976 Bacteria 1785
155 Ga0466967_0228193 3300045976 Bacteria 1772
156 Ga0466967_0290022 3300045976 Bacteria 1572
157 Ga0466967_0400062 3300045976 Bacteria 1336
158 Ga0466967_0562671 3300045976 Bacteria 1123
159 Ga0466967_0646210 3300045976 Bacteria 1046
160 Ga0495603_0001386 3300046455 Bacteria 14068
161 Ga0495629_0297109 3300046459 Bacteria 1106
162 Ga0495629_0853084 3300046459 Bacteria 599
163 Ga0495641_0127608 3300046461 Bacteria 1135
164 Ga0495641_0206872 3300046461 Bacteria 880
165 Ga0495651_0065470 3300046462 Bacteria 2775
166 Ga0495651_0171923 3300046462 Bacteria 1542
167 Ga0495653_0041123 3300046463 Bacteria 3610
168 Ga0495582_0241878 3300046473 Bacteria 1034
169 Ga0495662_0265880 3300046476 Bacteria 844
170 Ga0495608_0000013 3300046511 Bacteria 228481
171 Ga0495608_0033717 3300046511 Bacteria 3457
172 Ga0495618_0082061 3300046514 Bacteria 2059
173 Ga0495628_0041212 3300046516 Bacteria 3686
174 Ga0495630_0002670 3300046517 Bacteria 12360
175 Ga0495630_0129706 3300046517 Bacteria 1915
176 Ga0495652_0062156 3300046529 Bacteria 3149
177 Ga0495652_0128366 3300046529 Bacteria 2011
178 Ga0495665_0286420 3300046531 Bacteria 845
179 Ga0495665_0546699 3300046531 Bacteria 581
180 Ga0495640_0075919 3300046533 Bacteria 2243
181 Ga0495640_0635346 3300046533 Bacteria 643
182 Ga0495587_0011100 3300046536 Bacteria 5714
183 Ga0495587_0021365 3300046536 Bacteria 3991
184 Ga0495667_0014128 3300046559 Bacteria 5389
185 Ga0495667_0343252 3300046559 Bacteria 944
186 Ga0495635_0007195 3300046663 Bacteria 7774
187 Ga0495635_0269582 3300046663 Bacteria 1145
188 Ga0495657_0000003 3300046675 Bacteria 279680
189 Ga0495657_0023918 3300046675 Bacteria 4359
190 Ga0495599_0170421 3300046678 Bacteria 1343
191 Ga0495599_0314214 3300046678 Bacteria 944
192 Ga0495646_0048890 3300046680 Bacteria 2568
193 Ga0495613_0533212 3300046689 Bacteria 787
194 Ga0495600_0007595 3300046809 Bacteria 6641
195 Ga0495581_0385608 3300047315 Bacteria 818
196 Ga0495604_0003334 3300047317 Bacteria 12801
197 Ga0495674_0099250 3300047319 Bacteria 2479
198 Ga0495672_0024786 3300047320 Bacteria 3857
199 Ga0495676_0324062 3300047321 Bacteria 1034
200 Ga0495680_0017283 3300047322 Bacteria 6163
201 Ga0495675_0000002 3300047444 Bacteria 216469
202 Ga0495684_0001990 3300047471 Bacteria 16424
203 Ga0495684_0027283 3300047471 Bacteria 4385
204 Ga0495593_0301673 3300047673 Bacteria 801
205 Ga0495602_0024230 3300048088 Bacteria 5891
206 Ga0496100_0975051 3300048903 Bacteria 667
207 Ga0496104_0000010 3300048907 Bacteria 475255
208 Ga0496104_0117862 3300048907 Bacteria 2548
209 Ga0496105_0000005 3300048908 Bacteria 475797
210 Ga0496105_0075697 3300048908 Bacteria 2780
211 Ga0496105_0116219 3300048908 Bacteria 2207
212 Ga0496106_0491574 3300048909 Bacteria 986
213 Ga0496108_0117925 3300048911 Bacteria 2275
214 Ga0496109_0379109 3300048912 Bacteria 1336
215 Ga0496110_0181184 3300048913 Bacteria 1913
216 Ga0496111_0557213 3300048914 Bacteria 841
217 Ga0496112_0025074 3300048915 Bacteria 5721
218 Ga0496112_0360506 3300048915 Bacteria 1396
219 Ga0496112_1440815 3300048915 Unclassified 603
220 Ga0496113_0007820 3300048916 Bacteria 6910
221 Ga0496113_0954142 3300048916 Bacteria 677
222 Ga0496113_1334180 3300048916 Unclassified 557
223 Ga0496114_0000043 3300048917 Bacteria 131720
224 Ga0496114_0480096 3300048917 Bacteria 1100
225 Ga0496115_0000016 3300048918 Bacteria 187067
226 Ga0496115_0000104 3300048918 Bacteria 79824
227 Ga0496121_0002166 3300048924 Bacteria 30741
228 Ga0501042_0234819 3300049578 Bacteria 1323
229 Ga0501048_0296910 3300049582 Bacteria 1149
230 Ga0501068_0295714 3300049584 Bacteria 1036
231 Ga0501072_0376830 3300049588 Bacteria 1126
232 Ga0501075_0681846 3300049591 Bacteria 783
233 Ga0501045_0126204 3300049824 Bacteria 1901
234 nmdc:mga05p37_21452_c1 3300050507 Bacteria 7823
235 nmdc:mga08y16_1478454_c1 3300050511 Bacteria 640
236 nmdc:mga08y16_634559_c1 3300050511 Bacteria 1074
237 nmdc:mga0n895_11316_c1 3300050512 Bacteria 7951
238 nmdc:mga0a205_5221_c1 3300050515 Bacteria 11687
239 Ga0495601_0412219 3300053077 Bacteria 875
240 Ga0495655_0018687 3300053083 Bacteria 1528
241 Ga0495595_0000007 3300053084 Bacteria 228504
242 Ga0495595_0015869 3300053084 Bacteria 3216
243 Ga0495619_0000026 3300053085 Bacteria 167387
244 Ga0495619_0144874 3300053085 Bacteria 1637
245 Ga0500566_0013213 3300053094 Bacteria 4863
246 Ga0501084_1208697 3300054114 Bacteria 634
247 Ga0466967_0211188
248 JGI24748J21848_1000858
249 JGI24034J26672_10006837
250 JGI24742J22300_10025165
251 Ga0070658_10114019
252 Ga0070676_10368930
253 Ga0070683_101005343
254 Ga0068869_100974517
255 Ga0070666_10007238
256 Ga0070666_10010923
257 Ga0068868_100197329
258 Ga0068868_100399827
259 Ga0070660_100026254
260 Ga0070660_100129757
261 Ga0070689_100383236
262 Ga0070691_10003498
263 Ga0070687_100560785
264 Ga0070668_100005191
265 Ga0070668_100267581
266 Ga0070659_100498402
267 Ga0070667_100226805
268 Ga0070709_11331363
269 Ga0070714_100956923
270 Ga0070713_100051426
271 Ga0070713_100186610
272 Ga0070710_10003941
273 Ga0070701_10402127
274 Ga0070711_100002706
275 Ga0070705_100001812
276 Ga0070700_100037053
277 Ga0070708_100001035
278 Ga0070662_100023197
279 Ga0070662_100509971
280 Ga0070662_101173670
281 Ga0070681_11181030
282 Ga0070707_100036993
283 Ga0070707_100092790
284 Ga0070698_100013418
285 Ga0070699_100000142
286 Ga0070679_100034741
287 Ga0070697_100075257
288 Ga0070695_100070667
289 Ga0070665_100004811
290 Ga0070665_100132607
291 Ga0070702_100182876
292 Ga0068864_100000035
293 Ga0068861_100009279
294 Ga0068863_102706540
295 Ga0068858_100308990
296 Ga0070717_10010857
297 Ga0070715_10463078
298 Ga0070716_100062871
299 Ga0070712_100031313
300 Ga0070712_100060118
301 Ga0070712_100860681
302 Ga0075433_10014222
303 Ga0075434_100012418
304 Ga0105240_11071700
305 Ga0111539_10533860
306 Ga0111539_11460000
307 Ga0111539_12830848
308 Ga0105245_10004387
309 Ga0105245_10958500
310 Ga0114129_10003026
311 Ga0105243_10715568
312 Ga0105243_11625277
313 Ga0105242_11101379
314 Ga0105242_11535718
315 Ga0105249_10037401
316 Ga0105239_10502397
317 Ga0105246_11310589
318 Ga0157378_10039100
319 Ga0163162_10632745
320 Ga0157372_11052573
321 Ga0157375_13496818
322 Ga0157379_10472378
323 Ga0213873_10288825
324 Ga0207656_10528915
325 Ga0207653_10024481
326 Ga0207692_10114270
327 Ga0207688_10735457
328 Ga0207680_10013762
329 Ga0207680_10034956
330 Ga0207699_10040637
331 Ga0207705_10187783
332 Ga0207705_10406247
333 Ga0207693_10238372
334 Ga0207663_10082342
335 Ga0207657_10128406
336 Ga0207657_10201428
337 Ga0207652_10198647
338 Ga0207646_10045555
339 Ga0207687_10047563
340 Ga0207700_10038531
341 Ga0207700_10232124
342 Ga0207700_10927847
343 Ga0207664_10443639
344 Ga0207690_10190414
345 Ga0207706_10000901
346 Ga0207706_10290119
347 Ga0207670_10315489
348 Ga0207704_10896073
349 Ga0207665_10063537
350 Ga0207691_10246777
351 Ga0207689_10156021
352 Ga0207661_11050375
353 Ga0207712_10254358
354 Ga0207668_10956047
355 Ga0207640_10099017
356 Ga0207658_10012425
357 Ga0207677_11666176
358 Ga0207708_10009357
359 Ga0207676_10000026
360 Ga0207675_100001369
361 Ga0207683_10185752
362 Ga0207683_10350707
363 Ga0207698_10775923
364 Ga0268266_10000775
365 Ga0268266_10027142
366 Ga0268266_10057273
367 Ga0265327_10042001
368 Ga0307410_10845165
369 Ga0307406_11124396
370 Ga0307406_11320542
371 Ga0307407_10534769
372 Ga0307412_11696319
373 Ga0307409_100180384
374 Ga0307409_102516445
375 Ga0307414_11854833
376 Ga0307415_100903485
377 Ga0373923_0564205
378 Ga0373953_0426200
379 Ga0373956_0174496
380 Ga0373955_0043275
381 Ga0316574_0198430
382 Ga0373924_0143071
383 Ga0373937_0008747
384 Ga0373937_0012511
385 Ga0395899_0500000
386 Ga0395898_0410839
387 Ga0395905_0568965
388 Ga0395901_0537555
389 Ga0395901_0662589
390 Ga0395901_1012991
391 Ga0395901_1151150
392 Ga0395901_1419248
393 Ga0466963_0081737
394 Ga0466963_0483073
395 Ga0466964_0220152
396 Ga0466964_0278297
397 Ga0466967_0034450
398 Ga0466967_0044008
399 Ga0466967_0224300
400 Ga0466967_0224745
401 Ga0466967_0228193
402 Ga0466967_0290022
403 Ga0466967_0400062
404 Ga0466967_0562671
405 Ga0466967_0646210
406 Ga0495603_0001386
407 Ga0495629_0297109
408 Ga0495629_0853084
409 Ga0495641_0127608
410 Ga0495641_0206872
411 Ga0495651_0065470
412 Ga0495651_0171923
413 Ga0495653_0041123
414 Ga0495582_0241878
415 Ga0495662_0265880
416 Ga0495608_0000013
417 Ga0495608_0033717
418 Ga0495618_0082061
419 Ga0495628_0041212
420 Ga0495630_0002670
421 Ga0495630_0129706
422 Ga0495652_0062156
423 Ga0495652_0128366
424 Ga0495665_0286420
425 Ga0495665_0546699
426 Ga0495640_0075919
427 Ga0495640_0635346
428 Ga0495587_0011100
429 Ga0495587_0021365
430 Ga0495667_0014128
431 Ga0495667_0343252
432 Ga0495635_0007195
433 Ga0495635_0269582
434 Ga0495657_0000003
435 Ga0495657_0023918
436 Ga0495599_0170421
437 Ga0495599_0314214
438 Ga0495646_0048890
439 Ga0495613_0533212
440 Ga0495600_0007595
441 Ga0495581_0385608
442 Ga0495604_0003334
443 Ga0495674_0099250
444 Ga0495672_0024786
445 Ga0495676_0324062
446 Ga0495680_0017283
447 Ga0495675_0000002
448 Ga0495684_0001990
449 Ga0495684_0027283
450 Ga0495593_0301673
451 Ga0495602_0024230
452 Ga0496100_0975051
453 Ga0496104_0000010
454 Ga0496104_0117862
455 Ga0496105_0000005
456 Ga0496105_0075697
457 Ga0496105_0116219
458 Ga0496106_0491574
459 Ga0496108_0117925
460 Ga0496109_0379109
461 Ga0496110_0181184
462 Ga0496111_0557213
463 Ga0496112_0025074
464 Ga0496112_0360506
465 Ga0496112_1440815
466 Ga0496113_0007820
467 Ga0496113_0954142
468 Ga0496113_1334180
469 Ga0496114_0000043
470 Ga0496114_0480096
471 Ga0496115_0000016
472 Ga0496115_0000104
473 Ga0496121_0002166
474 Ga0501042_0234819
475 Ga0501048_0296910
476 Ga0501068_0295714
477 Ga0501072_0376830
478 Ga0501075_0681846
479 Ga0501045_0126204
480 nmdc:mga05p37_21452_c1
481 nmdc:mga08y16_1478454_c1
482 nmdc:mga08y16_634559_c1
483 nmdc:mga0n895_11316_c1
484 nmdc:mga0a205_5221_c1
485 Ga0495601_0412219
486 Ga0495655_0018687
487 Ga0495595_0000007
488 Ga0495595_0015869
489 Ga0495619_0000026
490 Ga0495619_0144874
491 Ga0500566_0013213
492 Ga0501084_1208697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

4

125

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cd7-assembly1.cif.gz_A staphylococcus aureus pi258 arsenate reductase (arsc) h62q mutant 0.9446 2 126
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.9441 2 126
3t38-assembly1.cif.gz_B corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1' 0.9353 1 129
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.9334 2 124
1ljl-assembly1.cif.gz_A wild type pi258 s. aureus arsenate reductase 0.9133 2 124
ID Description Score Start End Superfamily
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9835 1 130 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9688 1 130 3.40.50.2300
3t38B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9305 1 129 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8979 1 127 3.40.50.2300
3t38B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8935 1 129 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7M2YY78-F1-model_v4 Protein-tyrosine-phosphatase 1.001 2 127 GO:0046685
AF-A0A6L6APF7-F1-model_v4 deleted 0.9997 1 129
AF-A0A6J7HFE5-F1-model_v4 Unannotated protein 0.9982 1 130 GO:0046685
AF-A0A535I029-F1-model_v4 Arsenate reductase ArsC 0.9954 1 129 GO:0046685
AF-A0A498PYR4-F1-model_v4 Arsenate-mycothiol transferase ArsC2 (EC 2.8.4.2) 0.9941 2 128 GO:0046685
GO:0102100

Map