F358300

General Info

Members Datasets Scaffolds Average Seq Length
246 190 492 166

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100249582|Ga0307416_1002495823
Length 204
Sequence LEPTASGVVAGDLDAAGAVADSVVAVAASVAVARQAGGEMNIKRIVGHLFTTRGKVNRAFPRDTLIAIEQAIRICDAEHVGEVCFAIEGALHSTALFNGQSARERAVDVFSQLRVWDTEHNNGVLIYVLLADRDVEIVADRGVHARVGAQEWQTICHTMEEAFRQGTYREGAISGVQAVAQLLKRHFPACRDSANELPDSPAIL

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
158 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
161 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
162 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
165 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
166 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
167 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
173 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
174 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
175 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
179 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
180 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
183 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
188 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
189 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
190 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.45
Nodule 0
Rhizoplane 1.63
Rhizosphere 67.48
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100249582 3300032002 Bacteria 1726
2 SwRhRL2b_contig_1249271 2162886007 Bacteria 1876
3 JGI24735J21928_10131383 3300002067 Bacteria 722
4 rootH2_10101638 3300003320 Bacteria 5254
5 rootH2_10160597 3300003320 Bacteria 5417
6 rootH2_10208640 3300003320 Bacteria 1826
7 Ga0055526_1027583 3300003771 Bacteria 1751
8 Ga0065704_10070480 3300005289 Bacteria 23034
9 Ga0070670_100177629 3300005331 Unclassified 1848
10 Ga0070689_100551967 3300005340 Bacteria 993
11 Ga0070689_100876110 3300005340 Bacteria 793
12 Ga0070691_10124443 3300005341 Bacteria 1301
13 Ga0070669_100437770 3300005353 Bacteria 1075
14 Ga0070671_100812901 3300005355 Bacteria 814
15 Ga0070674_100063560 3300005356 Bacteria 2584
16 Ga0070673_100084165 3300005364 Bacteria 2586
17 Ga0070709_10036561 3300005434 Bacteria 2993
18 Ga0070694_101251433 3300005444 Unclassified 623
19 Ga0070678_100236244 3300005456 Unclassified 1526
20 Ga0070662_100045064 3300005457 Bacteria 3163
21 Ga0068867_100998894 3300005459 Bacteria 759
22 Ga0070672_100636690 3300005543 Bacteria 931
23 Ga0070696_100430266 3300005546 Bacteria 1038
24 Ga0068859_101391402 3300005617 Bacteria 774
25 Ga0068861_100133874 3300005719 Bacteria 2015
26 Ga0068861_100245627 3300005719 Bacteria 1525
27 Ga0068863_100033801 3300005841 Bacteria 4872
28 Ga0070715_10535710 3300006163 Bacteria 676
29 Ga0097621_100379641 3300006237 Unclassified 1262
30 Ga0097621_100674315 3300006237 Bacteria 950
31 Ga0068871_100362574 3300006358 Bacteria 1284
32 Ga0068865_100154694 3300006881 Bacteria 1743
33 Ga0097620_101391509 3300006931 Bacteria 774
34 Ga0111539_10083346 3300009094 Bacteria 3760
35 Ga0111539_10687099 3300009094 Unclassified 1191
36 Ga0105248_10272492 3300009177 Bacteria 1906
37 Ga0105248_12137986 3300009177 Bacteria 637
38 Ga0105249_11701926 3300009553 Unclassified 703
39 Ga0157375_10014664 3300013308 Bacteria 7001
40 Ga0157375_10708763 3300013308 Bacteria 1160
41 Ga0163163_10256275 3300014325 Bacteria 1800
42 Ga0157380_10002321 3300014326 Bacteria 12783
43 Ga0157380_12741410 3300014326 Bacteria 559
44 Ga0182008_10229573 3300014497 Bacteria 952
45 Ga0157376_10324961 3300014969 Unclassified 1464
46 Ga0209564_1001777 3300025295 Bacteria 19994
47 Ga0209564_1005303 3300025295 Bacteria 7426
48 Ga0209564_1008863 3300025295 Bacteria 4893
49 Ga0207713_1000240 3300025735 Bacteria 73219
50 Ga0207647_10001239 3300025904 Bacteria 19642
51 Ga0207699_10016321 3300025906 Bacteria 3883
52 Ga0207681_10192538 3300025923 Bacteria 1561
53 Ga0207659_10026988 3300025926 Bacteria 3882
54 Ga0207659_10457402 3300025926 Bacteria 1076
55 Ga0207669_10298199 3300025937 Bacteria 1224
56 Ga0207704_10129651 3300025938 Bacteria 1744
57 Ga0207691_10007501 3300025940 Bacteria 10497
58 Ga0207689_10186785 3300025942 Unclassified 1709
59 Ga0207651_10032489 3300025960 Bacteria 3353
60 Ga0207678_10059639 3300026067 Bacteria 3283
61 Ga0207641_10024367 3300026088 Bacteria 4988
62 Ga0207648_10297992 3300026089 Bacteria 1445
63 Ga0207675_100046119 3300026118 Bacteria 4071
64 Ga0207675_100094305 3300026118 Bacteria 2815
65 Ga0268265_10270497 3300028380 Unclassified 1515
66 Ga0268265_10580122 3300028380 Bacteria 1069
67 Ga0265334_10088074 3300028573 Unclassified 1136
68 Ga0265324_10000740 3300029957 Bacteria 21734
69 Ga0307511_10008136 3300030521 Bacteria 10497
70 Ga0307408_100216761 3300031548 Bacteria 1559
71 Ga0307516_10004973 3300031730 Bacteria 16142
72 Ga0307405_10525244 3300031731 Bacteria 953
73 Ga0307413_10214518 3300031824 Unclassified 1401
74 Ga0307410_10070843 3300031852 Bacteria 2416
75 Ga0307406_10548015 3300031901 Bacteria 946
76 Ga0307409_100197650 3300031995 Bacteria 1796
77 Ga0307416_100088186 3300032002 Bacteria 2652
78 Ga0307415_100229475 3300032126 Bacteria 1494
79 Ga0373923_0129157 3300035111 Bacteria 1134
80 Ga0373936_0013009 3300035113 Bacteria 3173
81 Ga0373945_0002443 3300035116 Bacteria 5832
82 Ga0373954_0171529 3300035118 Bacteria 1062
83 Ga0373956_0136100 3300035119 Unclassified 1152
84 Ga0373956_0142330 3300035119 Bacteria 1126
85 Ga0373943_0056343 3300035170 Bacteria 1950
86 Ga0373946_0006184 3300035171 Bacteria 4336
87 Ga0373955_0028357 3300035172 Bacteria 2901
88 Ga0373955_0560923 3300035172 Unclassified 699
89 Ga0373924_0066826 3300035410 Bacteria 1512
90 Ga0373931_0427358 3300035691 Bacteria 843
91 Ga0373933_0009646 3300035724 Bacteria 5275
92 Ga0373933_0131652 3300035724 Bacteria 1573
93 Ga0373947_0003846 3300035725 Bacteria 8835
94 Ga0373937_0009810 3300036401 Bacteria 8349
95 Ga0373937_0124764 3300036401 Bacteria 2401
96 Ga0451577_0106151 3300042876 Bacteria 2510
97 Ga0451577_0140332 3300042876 Bacteria 2171
98 Ga0451577_0165258 3300042876 Bacteria 1993
99 Ga0451577_0448706 3300042876 Bacteria 1171
100 Ga0453684_0008881 3300044712 Bacteria 17806
101 Ga0453684_0016129 3300044712 Bacteria 11720
102 Ga0453684_0168413 3300044712 Bacteria 2584
103 Ga0453684_0184534 3300044712 Bacteria 2446
104 Ga0453684_1142352 3300044712 Bacteria 821
105 Ga0451576_0008029 3300045051 Bacteria 12460
106 Ga0451576_0100904 3300045051 Bacteria 3001
107 Ga0451576_0215868 3300045051 Bacteria 2003
108 Ga0495592_0209301 3300046454 Bacteria 1310
109 Ga0495629_0166787 3300046459 Bacteria 1529
110 Ga0495580_0019055 3300046472 Bacteria 5102
111 Ga0495580_0246163 3300046472 Bacteria 1225
112 Ga0495582_0009582 3300046473 Bacteria 5333
113 Ga0495639_0007352 3300046475 Bacteria 4728
114 Ga0495662_0017587 3300046476 Bacteria 3460
115 Ga0495664_0004468 3300046477 Bacteria 7656
116 Ga0495583_0005447 3300046506 Bacteria 8646
117 Ga0495606_0061749 3300046507 Bacteria 2395
118 Ga0495610_0094939 3300046512 Bacteria 1345
119 Ga0495616_0189216 3300046513 Bacteria 910
120 Ga0495620_0082371 3300046515 Bacteria 1300
121 Ga0495628_0007720 3300046516 Bacteria 9286
122 Ga0495630_0032415 3300046517 Bacteria 3893
123 Ga0495631_0020251 3300046518 Bacteria 3110
124 Ga0495637_0100181 3300046520 Bacteria 1133
125 Ga0495643_0118783 3300046522 Bacteria 1338
126 Ga0495643_0132698 3300046522 Bacteria 1249
127 Ga0495648_0001814 3300046524 Bacteria 20579
128 Ga0495654_0054809 3300046530 Bacteria 1932
129 Ga0495654_0334203 3300046530 Unclassified 612
130 Ga0495665_0014782 3300046531 Bacteria 4206
131 Ga0495640_0091995 3300046533 Bacteria 2001
132 Ga0495586_0026404 3300046535 Bacteria 3107
133 Ga0495597_0146551 3300046542 Bacteria 971
134 Ga0495622_0076315 3300046557 Bacteria 1544
135 Ga0495667_0016662 3300046559 Bacteria 4962
136 Ga0495656_0424303 3300046615 Bacteria 698
137 Ga0495634_0035974 3300046642 Bacteria 3388
138 Ga0495625_0824339 3300046660 Bacteria 538
139 Ga0495635_0178371 3300046663 Bacteria 1444
140 Ga0495599_0097995 3300046678 Bacteria 1828
141 Ga0495658_0115603 3300046683 Bacteria 1617
142 Ga0495670_0060324 3300046691 Bacteria 1905
143 Ga0495671_0006931 3300046692 Bacteria 6501
144 Ga0495600_0531580 3300046809 Bacteria 720
145 Ga0495660_0205995 3300046810 Bacteria 936
146 Ga0495674_0032375 3300047319 Bacteria 4742
147 Ga0495674_0032759 3300047319 Bacteria 4710
148 Ga0495672_0165151 3300047320 Bacteria 1134
149 Ga0495676_0661579 3300047321 Bacteria 677
150 Ga0495683_0017955 3300047323 Bacteria 3662
151 Ga0495683_0026224 3300047323 Bacteria 2982
152 Ga0495684_0002264 3300047471 Bacteria 15423
153 Ga0495686_0047869 3300047472 Bacteria 2698
154 Ga0495686_0369718 3300047472 Bacteria 775
155 Ga0495602_0000724 3300048088 Bacteria 31157
156 Ga0495602_0210952 3300048088 Bacteria 1474
157 Ga0495614_0126055 3300048089 Bacteria 1131
158 Ga0496102_0353235 3300048905 Bacteria 1384
159 Ga0496105_1164521 3300048908 Bacteria 569
160 Ga0496114_0203724 3300048917 Bacteria 1734
161 Ga0496116_0000786 3300048919 Bacteria 40350
162 Ga0496116_0022127 3300048919 Bacteria 4777
163 Ga0496116_0207145 3300048919 Bacteria 1020
164 Ga0496117_0092370 3300048920 Bacteria 1944
165 Ga0496117_0190081 3300048920 Bacteria 1170
166 Ga0496118_0013636 3300048921 Bacteria 7672
167 Ga0496118_0207203 3300048921 Bacteria 1154
168 Ga0496119_0070428 3300048922 Bacteria 2051
169 Ga0496119_0373126 3300048922 Bacteria 686
170 Ga0496120_0067112 3300048923 Bacteria 1983
171 Ga0496121_0012451 3300048924 Bacteria 9271
172 Ga0496121_0013798 3300048924 Bacteria 8648
173 Ga0496121_0180563 3300048924 Bacteria 1524
174 Ga0496121_0181279 3300048924 Bacteria 1520
175 Ga0496121_0436791 3300048924 Bacteria 847
176 Ga0496121_0547785 3300048924 Bacteria 724
177 Ga0496122_0014608 3300048925 Bacteria 7578
178 Ga0496122_0075178 3300048925 Bacteria 2385
179 Ga0496123_0009978 3300048926 Bacteria 8464
180 Ga0496123_0114870 3300048926 Bacteria 1529
181 Ga0496123_0158303 3300048926 Bacteria 1211
182 Ga0496123_0162155 3300048926 Bacteria 1191
183 Ga0496124_0200961 3300048927 Bacteria 1516
184 Ga0496124_0324036 3300048927 Bacteria 1102
185 Ga0496125_0015609 3300048928 Bacteria 7331
186 Ga0496125_0261147 3300048928 Bacteria 1085
187 Ga0496126_0051015 3300048929 Bacteria 3769
188 Ga0496126_0345318 3300048929 Bacteria 1218
189 Ga0496126_0378480 3300048929 Bacteria 1153
190 Ga0496126_0580858 3300048929 Bacteria 885
191 Ga0501042_0324799 3300049578 Bacteria 1112
192 Ga0501067_0021602 3300049583 Bacteria 3562
193 Ga0501068_0000289 3300049584 Bacteria 25017
194 Ga0501070_0003759 3300049586 Bacteria 13106
195 Ga0501071_0006064 3300049587 Bacteria 7831
196 Ga0501072_0505848 3300049588 Unclassified 955
197 Ga0501073_0000841 3300049589 Bacteria 21854
198 Ga0501074_0001016 3300049590 Bacteria 18256
199 Ga0501075_0159217 3300049591 Unclassified 1722
200 Ga0501076_0254393 3300049592 Unclassified 1438
201 Ga0501077_0000942 3300049593 Bacteria 17539
202 Ga0501079_0001317 3300049741 Bacteria 17449
203 Ga0501080_0000468 3300049742 Bacteria 31379
204 Ga0501083_0064814 3300049744 Bacteria 2434
205 Ga0501035_0502951 3300049822 Bacteria 997
206 nmdc:mga0yw44_178403_c1 3300050492 Bacteria 1397
207 nmdc:mga08y16_54445_c1 3300050511 Bacteria 4180
208 nmdc:mga0sz30_65877_c1 3300050516 Bacteria 1553
209 Ga0500643_033392 3300053087 Bacteria 1556
210 Ga0500644_0149304 3300053088 Bacteria 935
211 Ga0500581_163573 3300053089 Bacteria 1030
212 Ga0500646_0017103 3300053090 Bacteria 1898
213 Ga0500651_0021664 3300053093 Bacteria 4009
214 Ga0500566_0001451 3300053094 Bacteria 13903
215 Ga0500641_0012083 3300053096 Bacteria 3146
216 Ga0500554_030614 3300053102 Bacteria 1583
217 Ga0500556_0000003 3300053104 Bacteria 679379
218 Ga0500569_032201 3300053109 Bacteria 1480
219 Ga0500592_019365 3300053116 Bacteria 1093
220 Ga0500607_056080 3300053121 Bacteria 2081
221 Ga0500608_117312 3300053122 Bacteria 1212
222 Ga0500642_0000085 3300053130 Bacteria 48934
223 Ga0500652_000335 3300053131 Bacteria 16893
224 Ga0500559_0001784 3300053136 Bacteria 11815
225 Ga0500559_0046411 3300053136 Bacteria 1905
226 Ga0500568_0000584 3300053139 Bacteria 26496
227 Ga0500577_0000217 3300053142 Bacteria 15263
228 Ga0500577_0143928 3300053142 Bacteria 1007
229 Ga0500586_001343 3300053145 Bacteria 5169
230 Ga0500590_018087 3300053148 Bacteria 3647
231 Ga0500604_0003837 3300053151 Bacteria 4017
232 Ga0500616_0000041 3300053153 Bacteria 359328
233 Ga0500622_0001078 3300053156 Bacteria 22690
234 Ga0500624_015156 3300053157 Bacteria 1175
235 Ga0500627_0208476 3300053158 Bacteria 874
236 Ga0500634_0160135 3300053161 Bacteria 1040
237 Ga0500636_0001355 3300053177 Bacteria 13296
238 Ga0500637_0084925 3300053178 Bacteria 1830
239 Ga0500570_155586 3300053724 Bacteria 801
240 Ga0500645_121106 3300053730 Bacteria 730
241 Ga0501084_0010051 3300054114 Bacteria 7821
242 Ga0501082_0027828 3300060353 Bacteria 4869
243 2603859902 2602042107 Bacteria 6226103
244 2857524895 2857524615 Bacteria 6615449
245 2893071123 2893066018 Bacteria 6158120
246 2919078782 2919073203 Bacteria 6531949
247 Ga0307416_100249582
248 SwRhRL2b_contig_1249271
249 JGI24735J21928_10131383
250 rootH2_10101638
251 rootH2_10160597
252 rootH2_10208640
253 Ga0055526_1027583
254 Ga0065704_10070480
255 Ga0070670_100177629
256 Ga0070689_100551967
257 Ga0070689_100876110
258 Ga0070691_10124443
259 Ga0070669_100437770
260 Ga0070671_100812901
261 Ga0070674_100063560
262 Ga0070673_100084165
263 Ga0070709_10036561
264 Ga0070694_101251433
265 Ga0070678_100236244
266 Ga0070662_100045064
267 Ga0068867_100998894
268 Ga0070672_100636690
269 Ga0070696_100430266
270 Ga0068859_101391402
271 Ga0068861_100133874
272 Ga0068861_100245627
273 Ga0068863_100033801
274 Ga0070715_10535710
275 Ga0097621_100379641
276 Ga0097621_100674315
277 Ga0068871_100362574
278 Ga0068865_100154694
279 Ga0097620_101391509
280 Ga0111539_10083346
281 Ga0111539_10687099
282 Ga0105248_10272492
283 Ga0105248_12137986
284 Ga0105249_11701926
285 Ga0157375_10014664
286 Ga0157375_10708763
287 Ga0163163_10256275
288 Ga0157380_10002321
289 Ga0157380_12741410
290 Ga0182008_10229573
291 Ga0157376_10324961
292 Ga0209564_1001777
293 Ga0209564_1005303
294 Ga0209564_1008863
295 Ga0207713_1000240
296 Ga0207647_10001239
297 Ga0207699_10016321
298 Ga0207681_10192538
299 Ga0207659_10026988
300 Ga0207659_10457402
301 Ga0207669_10298199
302 Ga0207704_10129651
303 Ga0207691_10007501
304 Ga0207689_10186785
305 Ga0207651_10032489
306 Ga0207678_10059639
307 Ga0207641_10024367
308 Ga0207648_10297992
309 Ga0207675_100046119
310 Ga0207675_100094305
311 Ga0268265_10270497
312 Ga0268265_10580122
313 Ga0265334_10088074
314 Ga0265324_10000740
315 Ga0307511_10008136
316 Ga0307408_100216761
317 Ga0307516_10004973
318 Ga0307405_10525244
319 Ga0307413_10214518
320 Ga0307410_10070843
321 Ga0307406_10548015
322 Ga0307409_100197650
323 Ga0307416_100088186
324 Ga0307415_100229475
325 Ga0373923_0129157
326 Ga0373936_0013009
327 Ga0373945_0002443
328 Ga0373954_0171529
329 Ga0373956_0136100
330 Ga0373956_0142330
331 Ga0373943_0056343
332 Ga0373946_0006184
333 Ga0373955_0028357
334 Ga0373955_0560923
335 Ga0373924_0066826
336 Ga0373931_0427358
337 Ga0373933_0009646
338 Ga0373933_0131652
339 Ga0373947_0003846
340 Ga0373937_0009810
341 Ga0373937_0124764
342 Ga0451577_0106151
343 Ga0451577_0140332
344 Ga0451577_0165258
345 Ga0451577_0448706
346 Ga0453684_0008881
347 Ga0453684_0016129
348 Ga0453684_0168413
349 Ga0453684_0184534
350 Ga0453684_1142352
351 Ga0451576_0008029
352 Ga0451576_0100904
353 Ga0451576_0215868
354 Ga0495592_0209301
355 Ga0495629_0166787
356 Ga0495580_0019055
357 Ga0495580_0246163
358 Ga0495582_0009582
359 Ga0495639_0007352
360 Ga0495662_0017587
361 Ga0495664_0004468
362 Ga0495583_0005447
363 Ga0495606_0061749
364 Ga0495610_0094939
365 Ga0495616_0189216
366 Ga0495620_0082371
367 Ga0495628_0007720
368 Ga0495630_0032415
369 Ga0495631_0020251
370 Ga0495637_0100181
371 Ga0495643_0118783
372 Ga0495643_0132698
373 Ga0495648_0001814
374 Ga0495654_0054809
375 Ga0495654_0334203
376 Ga0495665_0014782
377 Ga0495640_0091995
378 Ga0495586_0026404
379 Ga0495597_0146551
380 Ga0495622_0076315
381 Ga0495667_0016662
382 Ga0495656_0424303
383 Ga0495634_0035974
384 Ga0495625_0824339
385 Ga0495635_0178371
386 Ga0495599_0097995
387 Ga0495658_0115603
388 Ga0495670_0060324
389 Ga0495671_0006931
390 Ga0495600_0531580
391 Ga0495660_0205995
392 Ga0495674_0032375
393 Ga0495674_0032759
394 Ga0495672_0165151
395 Ga0495676_0661579
396 Ga0495683_0017955
397 Ga0495683_0026224
398 Ga0495684_0002264
399 Ga0495686_0047869
400 Ga0495686_0369718
401 Ga0495602_0000724
402 Ga0495602_0210952
403 Ga0495614_0126055
404 Ga0496102_0353235
405 Ga0496105_1164521
406 Ga0496114_0203724
407 Ga0496116_0000786
408 Ga0496116_0022127
409 Ga0496116_0207145
410 Ga0496117_0092370
411 Ga0496117_0190081
412 Ga0496118_0013636
413 Ga0496118_0207203
414 Ga0496119_0070428
415 Ga0496119_0373126
416 Ga0496120_0067112
417 Ga0496121_0012451
418 Ga0496121_0013798
419 Ga0496121_0180563
420 Ga0496121_0181279
421 Ga0496121_0436791
422 Ga0496121_0547785
423 Ga0496122_0014608
424 Ga0496122_0075178
425 Ga0496123_0009978
426 Ga0496123_0114870
427 Ga0496123_0158303
428 Ga0496123_0162155
429 Ga0496124_0200961
430 Ga0496124_0324036
431 Ga0496125_0015609
432 Ga0496125_0261147
433 Ga0496126_0051015
434 Ga0496126_0345318
435 Ga0496126_0378480
436 Ga0496126_0580858
437 Ga0501042_0324799
438 Ga0501067_0021602
439 Ga0501068_0000289
440 Ga0501070_0003759
441 Ga0501071_0006064
442 Ga0501072_0505848
443 Ga0501073_0000841
444 Ga0501074_0001016
445 Ga0501075_0159217
446 Ga0501076_0254393
447 Ga0501077_0000942
448 Ga0501079_0001317
449 Ga0501080_0000468
450 Ga0501083_0064814
451 Ga0501035_0502951
452 nmdc:mga0yw44_178403_c1
453 nmdc:mga08y16_54445_c1
454 nmdc:mga0sz30_65877_c1
455 Ga0500643_033392
456 Ga0500644_0149304
457 Ga0500581_163573
458 Ga0500646_0017103
459 Ga0500651_0021664
460 Ga0500566_0001451
461 Ga0500641_0012083
462 Ga0500554_030614
463 Ga0500556_0000003
464 Ga0500569_032201
465 Ga0500592_019365
466 Ga0500607_056080
467 Ga0500608_117312
468 Ga0500642_0000085
469 Ga0500652_000335
470 Ga0500559_0001784
471 Ga0500559_0046411
472 Ga0500568_0000584
473 Ga0500577_0000217
474 Ga0500577_0143928
475 Ga0500586_001343
476 Ga0500590_018087
477 Ga0500604_0003837
478 Ga0500616_0000041
479 Ga0500622_0001078
480 Ga0500624_015156
481 Ga0500627_0208476
482 Ga0500634_0160135
483 Ga0500636_0001355
484 Ga0500637_0084925
485 Ga0500570_155586
486 Ga0500645_121106
487 Ga0501084_0010051
488 Ga0501082_0027828
489 2603859902
490 2857524895
491 2893071123
492 2919078782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04536

TPM_phosphatase

TPM domain

57

182

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8844 24 167
5anp-assembly1.cif.gz_A crystal structure of the ba41 protein from bizionia argentinensis 0.864 23 148
5anp-assembly2.cif.gz_B crystal structure of the ba41 protein from bizionia argentinensis 0.8393 23 148
7tbr-assembly1.cif.gz_A crystal structure of the tpm domain from the rhodothermus marinus protein rhom172_1776 0.8265 17 150
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8228 24 167
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8844 24 167 3.10.310.50
af_P9WLA7_26_161_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8442 21 140 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8228 24 167 3.10.310.50
5anpB00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8203 23 151 3.10.310.50
af_C0H4B4_80_222_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8052 23 148 3.10.310.50
ID Description Score Start End GO Terms
AF-Y0KFD6-F1-model_v4 Putative membrane protein 0.9853 5 167 GO:0016020
AF-A0A2M7NB41-F1-model_v4 TPM domain-containing protein 0.9837 1 122 GO:0016020
AF-A0A3N5G268-F1-model_v4 TPM domain-containing protein 0.9814 1 167 GO:0016020
AF-A0A1L6I6R8-F1-model_v4 TPM domain-containing protein 0.9807 1 167 GO:0016020
AF-A0A257XCI0-F1-model_v4 TPM domain-containing protein 0.98 1 148 GO:0016020

Map