F358223

General Info

Members Datasets Scaffolds Average Seq Length
246 127 492 519

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10051333|Ga0207707_100513332
Length 480
Sequence MIAAAVVLPAFMEVIDTSIAAVCIPYIAGSLSASTDEATWVLTFYLLSNAIVLPASAWFALRFGRKRFLIASIAIFTISSFLQPLSQAILTESFPPEKRGMAMGLFGLGVVVAPVLGPTLGGWLTDTYSWRWAFYINIPIGVLAIFMISRFIEDPPYIANAKPGKLDSIGFGLLALWLGCMQLILDRGQEDDWFGATWIRWAFIVMVVCFVLFVISQLKKKYPLVDLTIFRNRNFTVGCVLIFMFGAAIYGAVTLLPLFYQTMMDYSAFAAGFIVSPRGIGSIIAMPLVGYLVSKLDTRVLVSLGFTVFGICSFIWGGLTLQISPWSLLWPIVISGFALGLVFVPLSTTTLGDLAPERIGNGSGLFNLMRNVGGSVGISLVNTILVRHQQLHQNELVQHLSPTSPAAQQSLHAYSRMFAGAGGAATAHQQAYGMLQNVVSQQAALWSYIDDFRYMALGCFACVPVVWLLKRVRGGPIAAE

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10051333 3300025912 Bacteria 3591
2 LJNas_1000195 3300000546 Bacteria 10227
3 Ga0070658_10082254 3300005327 Bacteria 2646
4 Ga0070683_100004013 3300005329 Bacteria 12056
5 Ga0070683_100007825 3300005329 Bacteria 9053
6 Ga0070683_100094489 3300005329 Bacteria 2810
7 Ga0068869_100003743 3300005334 Bacteria 9360
8 Ga0070680_100046588 3300005336 Unclassified 3528
9 Ga0068868_100004113 3300005338 Bacteria 10165
10 Ga0070660_100016490 3300005339 Bacteria 5362
11 Ga0070660_100060695 3300005339 Bacteria 2935
12 Ga0070661_100002577 3300005344 Bacteria 12430
13 Ga0070661_100016065 3300005344 Bacteria 5284
14 Ga0070671_100010075 3300005355 Bacteria 7590
15 Ga0070667_100004921 3300005367 Bacteria 11193
16 Ga0070709_10000249 3300005434 Bacteria 34789
17 Ga0070714_100023712 3300005435 Bacteria 5045
18 Ga0070713_100001177 3300005436 Bacteria 16713
19 Ga0070713_100009701 3300005436 Bacteria 6913
20 Ga0070713_100035675 3300005436 Bacteria 4006
21 Ga0070710_10017266 3300005437 Bacteria 3689
22 Ga0070711_100039269 3300005439 Bacteria 3187
23 Ga0070681_10008177 3300005458 Bacteria 10240
24 Ga0070681_10042314 3300005458 Bacteria 4565
25 Ga0070681_10050822 3300005458 Bacteria 4135
26 Ga0070681_10052624 3300005458 Bacteria 4061
27 Ga0070679_100126787 3300005530 Bacteria 2535
28 Ga0068853_100013614 3300005539 Bacteria 6647
29 Ga0068853_100024299 3300005539 Bacteria 5079
30 Ga0068855_100001832 3300005563 Bacteria 26521
31 Ga0068855_100002423 3300005563 Bacteria 23028
32 Ga0068855_100076869 3300005563 Bacteria 3873
33 Ga0068855_100089193 3300005563 Bacteria 3561
34 Ga0068855_100207129 3300005563 Bacteria 2206
35 Ga0070664_100069491 3300005564 Bacteria 3014
36 Ga0068857_100021546 3300005577 Bacteria 5670
37 Ga0068854_100042374 3300005578 Bacteria 3222
38 Ga0068856_100003264 3300005614 Bacteria 16499
39 Ga0068856_100003655 3300005614 Bacteria 15443
40 Ga0068856_100004941 3300005614 Bacteria 13201
41 Ga0068856_100019131 3300005614 Bacteria 6648
42 Ga0068856_100030730 3300005614 Bacteria 5251
43 Ga0068856_100185783 3300005614 Bacteria 2092
44 Ga0068852_100000066 3300005616 Bacteria 72069
45 Ga0068852_100226043 3300005616 Bacteria 1782
46 Ga0068859_100009391 3300005617 Bacteria 9878
47 Ga0068864_100000341 3300005618 Bacteria 41241
48 Ga0068851_10003164 3300005834 Bacteria 7298
49 Ga0068863_100023560 3300005841 Bacteria 5876
50 Ga0068858_100024180 3300005842 Bacteria 5661
51 Ga0068860_100000322 3300005843 Bacteria 65040
52 Ga0070717_10007116 3300006028 Bacteria 8291
53 Ga0070717_10059394 3300006028 Bacteria 3164
54 Ga0070717_10101871 3300006028 Bacteria 2439
55 Ga0070712_100000137 3300006175 Bacteria 38061
56 Ga0070712_100005883 3300006175 Bacteria 7593
57 Ga0070712_100057336 3300006175 Bacteria 2736
58 Ga0097621_100002092 3300006237 Bacteria 13676
59 Ga0068871_100011205 3300006358 Bacteria 6571
60 Ga0097620_100009390 3300006931 Bacteria 9878
61 Ga0105240_10000395 3300009093 Bacteria 81541
62 Ga0105240_10001292 3300009093 Bacteria 43270
63 Ga0105240_10001964 3300009093 Bacteria 33970
64 Ga0105240_10004404 3300009093 Bacteria 21477
65 Ga0105240_10059091 3300009093 Bacteria 4786
66 Ga0105240_10075655 3300009093 Bacteria 4153
67 Ga0105245_10001189 3300009098 Bacteria 23579
68 Ga0105245_10092743 3300009098 Bacteria 2782
69 Ga0105241_10000220 3300009174 Bacteria 43028
70 Ga0105241_10000365 3300009174 Bacteria 34388
71 Ga0105241_10001742 3300009174 Bacteria 16514
72 Ga0105241_10026833 3300009174 Bacteria 4287
73 Ga0105248_10008386 3300009177 Bacteria 11344
74 Ga0105248_10018275 3300009177 Bacteria 7742
75 Ga0105248_10137526 3300009177 Bacteria 2756
76 Ga0105237_10017253 3300009545 Bacteria 7487
77 Ga0105237_10033133 3300009545 Bacteria 5234
78 Ga0105237_10150735 3300009545 Bacteria 2322
79 Ga0105238_10000416 3300009551 Bacteria 44967
80 Ga0105238_10002204 3300009551 Bacteria 19663
81 Ga0105238_10012404 3300009551 Bacteria 8595
82 Ga0105238_10057383 3300009551 Bacteria 3904
83 Ga0105249_10028716 3300009553 Bacteria 5020
84 Ga0105239_10002494 3300010375 Bacteria 23436
85 Ga0105239_10012240 3300010375 Bacteria 9558
86 Ga0105239_10016919 3300010375 Bacteria 8059
87 Ga0105239_10126891 3300010375 Bacteria 2836
88 Ga0105246_10009170 3300011119 Bacteria 6093
89 Ga0157370_10000003 3300013104 Bacteria 367417
90 Ga0157369_10000411 3300013105 Bacteria 56707
91 Ga0157369_10008132 3300013105 Bacteria 12027
92 Ga0157369_10013627 3300013105 Bacteria 9197
93 Ga0157369_10024832 3300013105 Bacteria 6658
94 Ga0157369_10051435 3300013105 Bacteria 4458
95 Ga0157369_10075605 3300013105 Bacteria 3610
96 Ga0157369_10102966 3300013105 Bacteria 3041
97 Ga0157374_10000519 3300013296 Bacteria 34639
98 Ga0157374_10007268 3300013296 Bacteria 9436
99 Ga0157374_10036478 3300013296 Bacteria 4503
100 Ga0157374_10041771 3300013296 Bacteria 4228
101 Ga0157378_10007892 3300013297 Bacteria 9292
102 Ga0163162_10046639 3300013306 Bacteria 4343
103 Ga0157372_10000226 3300013307 Bacteria 62697
104 Ga0157372_10010269 3300013307 Bacteria 9945
105 Ga0157372_10070858 3300013307 Bacteria 3924
106 Ga0157372_10098587 3300013307 Bacteria 3334
107 Ga0157375_10012078 3300013308 Bacteria 7650
108 Ga0163163_10004664 3300014325 Bacteria 11723
109 Ga0182008_10017359 3300014497 Bacteria 3735
110 Ga0157376_10041523 3300014969 Bacteria 3766
111 Ga0163161_10043421 3300017792 Bacteria 3237
112 Ga0213872_10000901 3300021361 Bacteria 21377
113 Ga0213872_10000930 3300021361 Bacteria 20639
114 Ga0213876_10000687 3300021384 Bacteria 23935
115 Ga0213875_10000062 3300021388 Bacteria 130710
116 Ga0213875_10038717 3300021388 Bacteria 2246
117 Ga0207656_10017513 3300025321 Bacteria 2809
118 Ga0207710_10001652 3300025900 Bacteria 10878
119 Ga0207699_10004863 3300025906 Bacteria 6431
120 Ga0207654_10000112 3300025911 Bacteria 53345
121 Ga0207654_10000424 3300025911 Bacteria 24204
122 Ga0207654_10006094 3300025911 Bacteria 6061
123 Ga0207707_10012971 3300025912 Bacteria 7256
124 Ga0207707_10028219 3300025912 Bacteria 4906
125 Ga0207695_10000194 3300025913 Bacteria 171422
126 Ga0207695_10000601 3300025913 Bacteria 72201
127 Ga0207695_10001251 3300025913 Bacteria 43364
128 Ga0207695_10001665 3300025913 Bacteria 35766
129 Ga0207695_10002131 3300025913 Bacteria 29985
130 Ga0207695_10044408 3300025913 Bacteria 4727
131 Ga0207695_10044836 3300025913 Bacteria 4700
132 Ga0207671_10001550 3300025914 Bacteria 26296
133 Ga0207671_10003207 3300025914 Bacteria 16472
134 Ga0207693_10000440 3300025915 Bacteria 37946
135 Ga0207693_10034620 3300025915 Bacteria 3984
136 Ga0207693_10075365 3300025915 Bacteria 2642
137 Ga0207660_10048423 3300025917 Bacteria 3008
138 Ga0207660_10052734 3300025917 Unclassified 2896
139 Ga0207657_10060784 3300025919 Bacteria 3242
140 Ga0207694_10000301 3300025924 Bacteria 46518
141 Ga0207694_10000534 3300025924 Bacteria 34495
142 Ga0207694_10005093 3300025924 Bacteria 10157
143 Ga0207694_10012798 3300025924 Bacteria 6319
144 Ga0207687_10054337 3300025927 Bacteria 2801
145 Ga0207687_10055284 3300025927 Bacteria 2781
146 Ga0207700_10005382 3300025928 Bacteria 7647
147 Ga0207700_10025314 3300025928 Bacteria 4119
148 Ga0207700_10041760 3300025928 Bacteria 3358
149 Ga0207700_10071275 3300025928 Bacteria 2675
150 Ga0207644_10004440 3300025931 Bacteria 9109
151 Ga0207665_10014462 3300025939 Bacteria 5197
152 Ga0207665_10017382 3300025939 Bacteria 4726
153 Ga0207711_10006280 3300025941 Bacteria 10024
154 Ga0207689_10007805 3300025942 Bacteria 9365
155 Ga0207661_10006494 3300025944 Bacteria 8269
156 Ga0207661_10015897 3300025944 Bacteria 5544
157 Ga0207667_10001848 3300025949 Bacteria 26581
158 Ga0207667_10005489 3300025949 Bacteria 15462
159 Ga0207667_10067895 3300025949 Bacteria 3714
160 Ga0207667_10086122 3300025949 Bacteria 3252
161 Ga0207667_10170750 3300025949 Bacteria 2235
162 Ga0207712_10061918 3300025961 Bacteria 2658
163 Ga0207640_10021602 3300025981 Bacteria 3839
164 Ga0207658_10030225 3300025986 Bacteria 3833
165 Ga0207677_10011444 3300026023 Bacteria 5061
166 Ga0207703_10009846 3300026035 Bacteria 7497
167 Ga0207703_10026305 3300026035 Bacteria 4578
168 Ga0207639_10000200 3300026041 Bacteria 45090
169 Ga0207702_10004058 3300026078 Bacteria 13135
170 Ga0207702_10004380 3300026078 Bacteria 12583
171 Ga0207702_10030063 3300026078 Bacteria 4525
172 Ga0207702_10040236 3300026078 Bacteria 3919
173 Ga0207702_10051262 3300026078 Bacteria 3486
174 Ga0207702_10121366 3300026078 Bacteria 2339
175 Ga0207641_10010547 3300026088 Bacteria 7581
176 Ga0207641_10125315 3300026088 Bacteria 2299
177 Ga0207676_10083119 3300026095 Bacteria 2607
178 Ga0207674_10010382 3300026116 Bacteria 10554
179 Ga0207674_10035717 3300026116 Bacteria 5186
180 Ga0207674_10044621 3300026116 Bacteria 4566
181 Ga0207674_10166529 3300026116 Unclassified 2158
182 Ga0207698_10000017 3300026142 Bacteria 178846
183 Ga0207698_10001068 3300026142 Bacteria 15946
184 Ga0207698_10013104 3300026142 Bacteria 5458
185 Ga0207698_10038570 3300026142 Bacteria 3531
186 Ga0268264_10004123 3300028381 Bacteria 12434
187 Ga0265338_10023331 3300028800 Bacteria 6366
188 Ga0265338_10042596 3300028800 Bacteria 4225
189 Ga0265338_10056227 3300028800 Bacteria 3492
190 Ga0265338_10057702 3300028800 Bacteria 3433
191 Ga0265762_1000238 3300030760 Bacteria 8907
192 Ga0265765_1001350 3300030879 Bacteria 2239
193 Ga0265760_10021796 3300031090 Unclassified 1856
194 Ga0265330_10004299 3300031235 Bacteria 7245
195 Ga0265325_10001458 3300031241 Bacteria 16628
196 Ga0265325_10006631 3300031241 Bacteria 7004
197 Ga0265325_10026342 3300031241 Bacteria 3150
198 Ga0265340_10006697 3300031247 Bacteria 6313
199 Ga0265340_10036065 3300031247 Bacteria 2453
200 Ga0265339_10000013 3300031249 Bacteria 197953
201 Ga0265339_10006520 3300031249 Bacteria 7650
202 Ga0265316_10000673 3300031344 Bacteria 38001
203 Ga0265316_10002036 3300031344 Bacteria 21271
204 Ga0265316_10023764 3300031344 Bacteria 5146
205 Ga0265313_10003431 3300031595 Bacteria 12829
206 Ga0265314_10005557 3300031711 Bacteria 11338
207 Ga0265342_10000447 3300031712 Bacteria 45112
208 Ga0265342_10016156 3300031712 Bacteria 4884
209 Ga0373955_0094689 3300035172 Bacteria 1707
210 Ga0373935_0098398 3300035692 Bacteria 1925
211 Ga0436364_0133805 3300037853 Bacteria 37744
212 Ga0436364_0662653 3300037853 Bacteria 3473
213 Ga0436364_1246022 3300037853 Bacteria 5343
214 Ga0436364_1424606 3300037853 Bacteria 107493
215 Ga0436364_1438067 3300037853 Bacteria 21544
216 Ga0436364_1543557 3300037853 Bacteria 5747
217 Ga0436365_0599547 3300039437 Bacteria 9704
218 Ga0436365_1607355 3300039437 Unclassified 1737
219 Ga0436365_1772755 3300039437 Bacteria 2978
220 Ga0436360_1251243 3300039438 Bacteria 3253
221 Ga0436361_0079738 3300039447 Bacteria 122121
222 Ga0436361_0779674 3300039447 Bacteria 61407
223 Ga0436363_1609341 3300039450 Bacteria 16276
224 Ga0436362_0100242 3300039453 Bacteria 7277
225 Ga0466967_0003539 3300045976 Bacteria 10226
226 Ga0495603_0039800 3300046455 Bacteria 2815
227 Ga0495629_0056134 3300046459 Bacteria 2754
228 Ga0495629_0104789 3300046459 Bacteria 1973
229 Ga0495580_0006177 3300046472 Bacteria 9791
230 Ga0495594_0023451 3300046499 Bacteria 3307
231 Ga0495583_0007278 3300046506 Bacteria 6996
232 Ga0495644_0000293 3300046523 Bacteria 23152
233 Ga0495652_0085925 3300046529 Bacteria 2584
234 Ga0495587_0066737 3300046536 Bacteria 2098
235 Ga0495625_0025539 3300046660 Bacteria 4479
236 Ga0495669_0008273 3300046684 Bacteria 4369
237 Ga0496104_0016350 3300048907 Bacteria 6738
238 Ga0496104_0065518 3300048907 Bacteria 3448
239 Ga0496115_0022816 3300048918 Bacteria 4852
240 Ga0501034_0226237 3300049571 Bacteria 1821
241 Ga0501047_0026027 3300049581 Bacteria 5626
242 Ga0501070_0112677 3300049586 Unclassified 2248
243 Ga0501073_0083655 3300049589 Unclassified 2220
244 Ga0501044_0000905 3300049823 Bacteria 35694
245 Ga0501044_0004616 3300049823 Bacteria 15413
246 Ga0501044_0008111 3300049823 Bacteria 11528
247 Ga0207707_10051333
248 LJNas_1000195
249 Ga0070658_10082254
250 Ga0070683_100004013
251 Ga0070683_100007825
252 Ga0070683_100094489
253 Ga0068869_100003743
254 Ga0070680_100046588
255 Ga0068868_100004113
256 Ga0070660_100016490
257 Ga0070660_100060695
258 Ga0070661_100002577
259 Ga0070661_100016065
260 Ga0070671_100010075
261 Ga0070667_100004921
262 Ga0070709_10000249
263 Ga0070714_100023712
264 Ga0070713_100001177
265 Ga0070713_100009701
266 Ga0070713_100035675
267 Ga0070710_10017266
268 Ga0070711_100039269
269 Ga0070681_10008177
270 Ga0070681_10042314
271 Ga0070681_10050822
272 Ga0070681_10052624
273 Ga0070679_100126787
274 Ga0068853_100013614
275 Ga0068853_100024299
276 Ga0068855_100001832
277 Ga0068855_100002423
278 Ga0068855_100076869
279 Ga0068855_100089193
280 Ga0068855_100207129
281 Ga0070664_100069491
282 Ga0068857_100021546
283 Ga0068854_100042374
284 Ga0068856_100003264
285 Ga0068856_100003655
286 Ga0068856_100004941
287 Ga0068856_100019131
288 Ga0068856_100030730
289 Ga0068856_100185783
290 Ga0068852_100000066
291 Ga0068852_100226043
292 Ga0068859_100009391
293 Ga0068864_100000341
294 Ga0068851_10003164
295 Ga0068863_100023560
296 Ga0068858_100024180
297 Ga0068860_100000322
298 Ga0070717_10007116
299 Ga0070717_10059394
300 Ga0070717_10101871
301 Ga0070712_100000137
302 Ga0070712_100005883
303 Ga0070712_100057336
304 Ga0097621_100002092
305 Ga0068871_100011205
306 Ga0097620_100009390
307 Ga0105240_10000395
308 Ga0105240_10001292
309 Ga0105240_10001964
310 Ga0105240_10004404
311 Ga0105240_10059091
312 Ga0105240_10075655
313 Ga0105245_10001189
314 Ga0105245_10092743
315 Ga0105241_10000220
316 Ga0105241_10000365
317 Ga0105241_10001742
318 Ga0105241_10026833
319 Ga0105248_10008386
320 Ga0105248_10018275
321 Ga0105248_10137526
322 Ga0105237_10017253
323 Ga0105237_10033133
324 Ga0105237_10150735
325 Ga0105238_10000416
326 Ga0105238_10002204
327 Ga0105238_10012404
328 Ga0105238_10057383
329 Ga0105249_10028716
330 Ga0105239_10002494
331 Ga0105239_10012240
332 Ga0105239_10016919
333 Ga0105239_10126891
334 Ga0105246_10009170
335 Ga0157370_10000003
336 Ga0157369_10000411
337 Ga0157369_10008132
338 Ga0157369_10013627
339 Ga0157369_10024832
340 Ga0157369_10051435
341 Ga0157369_10075605
342 Ga0157369_10102966
343 Ga0157374_10000519
344 Ga0157374_10007268
345 Ga0157374_10036478
346 Ga0157374_10041771
347 Ga0157378_10007892
348 Ga0163162_10046639
349 Ga0157372_10000226
350 Ga0157372_10010269
351 Ga0157372_10070858
352 Ga0157372_10098587
353 Ga0157375_10012078
354 Ga0163163_10004664
355 Ga0182008_10017359
356 Ga0157376_10041523
357 Ga0163161_10043421
358 Ga0213872_10000901
359 Ga0213872_10000930
360 Ga0213876_10000687
361 Ga0213875_10000062
362 Ga0213875_10038717
363 Ga0207656_10017513
364 Ga0207710_10001652
365 Ga0207699_10004863
366 Ga0207654_10000112
367 Ga0207654_10000424
368 Ga0207654_10006094
369 Ga0207707_10012971
370 Ga0207707_10028219
371 Ga0207695_10000194
372 Ga0207695_10000601
373 Ga0207695_10001251
374 Ga0207695_10001665
375 Ga0207695_10002131
376 Ga0207695_10044408
377 Ga0207695_10044836
378 Ga0207671_10001550
379 Ga0207671_10003207
380 Ga0207693_10000440
381 Ga0207693_10034620
382 Ga0207693_10075365
383 Ga0207660_10048423
384 Ga0207660_10052734
385 Ga0207657_10060784
386 Ga0207694_10000301
387 Ga0207694_10000534
388 Ga0207694_10005093
389 Ga0207694_10012798
390 Ga0207687_10054337
391 Ga0207687_10055284
392 Ga0207700_10005382
393 Ga0207700_10025314
394 Ga0207700_10041760
395 Ga0207700_10071275
396 Ga0207644_10004440
397 Ga0207665_10014462
398 Ga0207665_10017382
399 Ga0207711_10006280
400 Ga0207689_10007805
401 Ga0207661_10006494
402 Ga0207661_10015897
403 Ga0207667_10001848
404 Ga0207667_10005489
405 Ga0207667_10067895
406 Ga0207667_10086122
407 Ga0207667_10170750
408 Ga0207712_10061918
409 Ga0207640_10021602
410 Ga0207658_10030225
411 Ga0207677_10011444
412 Ga0207703_10009846
413 Ga0207703_10026305
414 Ga0207639_10000200
415 Ga0207702_10004058
416 Ga0207702_10004380
417 Ga0207702_10030063
418 Ga0207702_10040236
419 Ga0207702_10051262
420 Ga0207702_10121366
421 Ga0207641_10010547
422 Ga0207641_10125315
423 Ga0207676_10083119
424 Ga0207674_10010382
425 Ga0207674_10035717
426 Ga0207674_10044621
427 Ga0207674_10166529
428 Ga0207698_10000017
429 Ga0207698_10001068
430 Ga0207698_10013104
431 Ga0207698_10038570
432 Ga0268264_10004123
433 Ga0265338_10023331
434 Ga0265338_10042596
435 Ga0265338_10056227
436 Ga0265338_10057702
437 Ga0265762_1000238
438 Ga0265765_1001350
439 Ga0265760_10021796
440 Ga0265330_10004299
441 Ga0265325_10001458
442 Ga0265325_10006631
443 Ga0265325_10026342
444 Ga0265340_10006697
445 Ga0265340_10036065
446 Ga0265339_10000013
447 Ga0265339_10006520
448 Ga0265316_10000673
449 Ga0265316_10002036
450 Ga0265316_10023764
451 Ga0265313_10003431
452 Ga0265314_10005557
453 Ga0265342_10000447
454 Ga0265342_10016156
455 Ga0373955_0094689
456 Ga0373935_0098398
457 Ga0436364_0133805
458 Ga0436364_0662653
459 Ga0436364_1246022
460 Ga0436364_1424606
461 Ga0436364_1438067
462 Ga0436364_1543557
463 Ga0436365_0599547
464 Ga0436365_1607355
465 Ga0436365_1772755
466 Ga0436360_1251243
467 Ga0436361_0079738
468 Ga0436361_0779674
469 Ga0436363_1609341
470 Ga0436362_0100242
471 Ga0466967_0003539
472 Ga0495603_0039800
473 Ga0495629_0056134
474 Ga0495629_0104789
475 Ga0495580_0006177
476 Ga0495594_0023451
477 Ga0495583_0007278
478 Ga0495644_0000293
479 Ga0495652_0085925
480 Ga0495587_0066737
481 Ga0495625_0025539
482 Ga0495669_0008273
483 Ga0496104_0016350
484 Ga0496104_0065518
485 Ga0496115_0022816
486 Ga0501034_0226237
487 Ga0501047_0026027
488 Ga0501070_0112677
489 Ga0501073_0083655
490 Ga0501044_0000905
491 Ga0501044_0004616
492 Ga0501044_0008111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

6

83

0.94

PF07690

MFS_1

Major Facilitator Superfamily

77

378

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8527 11 518
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8508 22 518
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8443 22 518
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8339 23 517
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8338 11 518
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9685 27 215 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9565 23 199 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9548 28 270 1.20.1250.20
af_Q2FVL1_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9531 45 229 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9528 26 264 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9769 31 167 GO:0005886
GO:0022857
AF-A0A537NMT5-F1-model_v4 MFS transporter 0.9702 20 175 GO:0005886
GO:0022857
AF-A0A242MTR8-F1-model_v4 MFS permease 0.9672 18 173 GO:0016020
GO:0022857
AF-A0A538CW67-F1-model_v4 MFS transporter 0.967 22 202 GO:0016020
GO:0022857
AF-A0A519QCY8-F1-model_v4 MFS transporter 0.9668 27 129 GO:0005886
GO:0022857
GO:1990961

Map