F358200

General Info

Members Datasets Scaffolds Average Seq Length
246 166 228 300

Family's Representative Sequence

Representative Sequence 3300015690|Ga0183363_1015|Ga0183363_101559
Length 302
Sequence VATLGLSPADKQAVEDFRRDVVEPSMTSLVIIDFWAEWCGPCKALGPVLDKVAAAYADKGVVLAKVDTDKNQFIAAQFQIKSIPTVYAMFQGQLVADLTSARTESQLRTILDQLLKQLPIQSEAADAAAEIEPLIAMGEDVLASGDAERALSIFDQLFEMAPDNPAILSGRIRALVAAGQTDAAQAAIDALPADIKDAGIERAKAALALAQSAPQGEDTAGLAAEVAAHPDDHERRFALANAQMAAGDRDAAADNLLHIIAAERDWNEGAARQQLLKLFEVVGLMDPWVSTQRRRLSAILFG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
8 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
13 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
14 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
15 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
18 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
162 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
163 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
164 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
165 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
166 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.28
Metatranscriptomes 0.41
Isolates 7.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 14.23
Nodule 0
Rhizoplane 0.81
Rhizosphere 71.54
Stem 0
Stem Tuber 0
Unclassified 12.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_335976 2162886007 Bacteria 7116
2 Ga0055536_1001850 3300003781 Bacteria 12368
3 Ga0055536_1006124 3300003781 Bacteria 5691
4 Ga0055536_1007381 3300003781 Bacteria 4934
5 Ga0055530_10000314 3300003791 Bacteria 44028
6 Ga0055531_10006136 3300003794 Bacteria 6878
7 Ga0055531_10014641 3300003794 Bacteria 3517
8 Ga0055531_10027872 3300003794 Bacteria 1965
9 Ga0065704_10071887 3300005289 Bacteria 9673
10 Ga0070658_10000003 3300005327 Bacteria 465963
11 Ga0070658_10000252 3300005327 Bacteria 47079
12 Ga0070658_10000304 3300005327 Bacteria 42569
13 Ga0070670_100001211 3300005331 Bacteria 20488
14 Ga0070666_10002955 3300005335 Bacteria 10299
15 Ga0070666_10056773 3300005335 Bacteria 2645
16 Ga0070660_100000348 3300005339 Bacteria 30900
17 Ga0070660_100018322 3300005339 Bacteria 5114
18 Ga0070692_10000249 3300005345 Bacteria 14903
19 Ga0070668_100000030 3300005347 Bacteria 87912
20 Ga0070668_100121105 3300005347 Bacteria 2091
21 Ga0070669_100000008 3300005353 Bacteria 226764
22 Ga0070669_100111085 3300005353 Bacteria 2080
23 Ga0070669_100145198 3300005353 Bacteria 1833
24 Ga0070671_100000010 3300005355 Bacteria 202799
25 Ga0070671_100001177 3300005355 Bacteria 19551
26 Ga0070667_100000071 3300005367 Bacteria 125713
27 Ga0070662_100051119 3300005457 Bacteria 2983
28 Ga0068853_100142729 3300005539 Bacteria 2150
29 Ga0070665_100051178 3300005548 Bacteria 4143
30 Ga0068855_100043171 3300005563 Bacteria 5342
31 Ga0068855_100199429 3300005563 Bacteria 2254
32 Ga0068854_100001776 3300005578 Bacteria 13129
33 Ga0068856_100005689 3300005614 Bacteria 12276
34 Ga0068852_100000183 3300005616 Bacteria 42580
35 Ga0068852_100000357 3300005616 Bacteria 30774
36 Ga0068864_100000851 3300005618 Bacteria 25734
37 Ga0068864_100002171 3300005618 Bacteria 16197
38 Ga0068861_100001538 3300005719 Bacteria 14628
39 Ga0068863_100004481 3300005841 Bacteria 13774
40 Ga0068863_100125707 3300005841 Bacteria 2446
41 Ga0068858_100015704 3300005842 Bacteria 7123
42 Ga0068860_100000049 3300005843 Bacteria 208782
43 Ga0068862_100000334 3300005844 Bacteria 51308
44 Ga0068862_100006425 3300005844 Bacteria 9771
45 Ga0075367_10001708 3300006178 Bacteria 9606
46 Ga0097620_100004236 3300006931 Bacteria 14649
47 Ga0105251_10014937 3300009011 Bacteria 4264
48 Ga0105240_10008858 3300009093 Bacteria 14330
49 Ga0105240_10028140 3300009093 Bacteria 7347
50 Ga0105240_10066732 3300009093 Bacteria 4462
51 Ga0105247_10001269 3300009101 Bacteria 18684
52 Ga0105237_10002109 3300009545 Bacteria 25103
53 Ga0105239_10000266 3300010375 Bacteria 77602
54 Ga0157371_10015280 3300013102 Bacteria 5764
55 Ga0157371_10037288 3300013102 Bacteria 3479
56 Ga0157370_10061123 3300013104 Bacteria 3575
57 Ga0163162_10045865 3300013306 Bacteria 4380
58 Ga0183363_1015 3300015690 Bacteria 74376
59 Ga0163161_10006712 3300017792 Bacteria 7964
60 Ga0206353_11828632 3300020082 Bacteria 4343
61 Ga0213873_10000016 3300021358 Bacteria 124829
62 Ga0213876_10000056 3300021384 Bacteria 135017
63 Ga0213876_10000250 3300021384 Bacteria 51059
64 Ga0209675_1000429 3300025291 Bacteria 33769
65 Ga0209676_1000146 3300025292 Bacteria 174095
66 Ga0209676_1000412 3300025292 Bacteria 77067
67 Ga0209676_1000599 3300025292 Bacteria 53258
68 Ga0209025_1005998 3300025294 Bacteria 9647
69 Ga0209050_1000254 3300025298 Bacteria 114395
70 Ga0209050_1000841 3300025298 Bacteria 42345
71 Ga0209050_1003926 3300025298 Bacteria 10520
72 Ga0209050_1027383 3300025298 Bacteria 1879
73 Ga0209257_1000267 3300025304 Bacteria 119949
74 Ga0209257_1000277 3300025304 Bacteria 114825
75 Ga0209257_1013867 3300025304 Bacteria 3528
76 Ga0207697_10000036 3300025315 Bacteria 49927
77 Ga0207680_10000044 3300025903 Bacteria 64236
78 Ga0207647_10017370 3300025904 Bacteria 4891
79 Ga0207705_10000005 3300025909 Bacteria 673478
80 Ga0207705_10000007 3300025909 Bacteria 597387
81 Ga0207705_10000265 3300025909 Bacteria 50412
82 Ga0207695_10004035 3300025913 Bacteria 20196
83 Ga0207695_10049012 3300025913 Bacteria 4456
84 Ga0207671_10017597 3300025914 Bacteria 5504
85 Ga0207657_10003426 3300025919 Bacteria 16933
86 Ga0207657_10016311 3300025919 Bacteria 7168
87 Ga0207681_10000002 3300025923 Bacteria 985597
88 Ga0207681_10008827 3300025923 Bacteria 6159
89 Ga0207694_10021237 3300025924 Bacteria 4918
90 Ga0207650_10001217 3300025925 Bacteria 18888
91 Ga0207644_10000002 3300025931 Bacteria 942221
92 Ga0207644_10000791 3300025931 Bacteria 20086
93 Ga0207690_10007990 3300025932 Bacteria 6281
94 Ga0207706_10299632 3300025933 Bacteria 1401
95 Ga0207667_10000038 3300025949 Bacteria 280720
96 Ga0207667_10009368 3300025949 Bacteria 11544
97 Ga0207667_10048955 3300025949 Bacteria 4466
98 Ga0207667_10171498 3300025949 Bacteria 2230
99 Ga0207667_10214829 3300025949 Bacteria 1971
100 Ga0207668_10000011 3300025972 Bacteria 184484
101 Ga0207668_10043269 3300025972 Bacteria 3055
102 Ga0207640_10000279 3300025981 Bacteria 34340
103 Ga0207658_10000014 3300025986 Bacteria 218248
104 Ga0207703_10001718 3300026035 Bacteria 19672
105 Ga0207639_10009382 3300026041 Bacteria 6747
106 Ga0207639_10076416 3300026041 Bacteria 2637
107 Ga0207678_10358621 3300026067 Bacteria 1258
108 Ga0207702_10005841 3300026078 Bacteria 10703
109 Ga0207702_10012369 3300026078 Bacteria 7106
110 Ga0207641_10000545 3300026088 Bacteria 42249
111 Ga0207641_10002975 3300026088 Bacteria 15333
112 Ga0207641_10375344 3300026088 Bacteria 1360
113 Ga0207676_10000489 3300026095 Bacteria 33247
114 Ga0207676_10004187 3300026095 Bacteria 10195
115 Ga0207674_10095817 3300026116 Bacteria 2953
116 Ga0207674_10159960 3300026116 Bacteria 2207
117 Ga0207675_100002191 3300026118 Bacteria 19409
118 Ga0207675_100114363 3300026118 Bacteria 2549
119 Ga0207698_10000120 3300026142 Bacteria 49131
120 Ga0207698_10000919 3300026142 Bacteria 17125
121 Ga0207698_10004603 3300026142 Bacteria 8423
122 Ga0209813_10000345 3300027866 Bacteria 11916
123 Ga0268266_10047748 3300028379 Bacteria 3669
124 Ga0268265_10001056 3300028380 Bacteria 24713
125 Ga0268265_10002184 3300028380 Bacteria 15120
126 Ga0268264_10000121 3300028381 Bacteria 190368
127 Ga0316183_1179489 3300030742 Bacteria 1518
128 Ga0307513_10024230 3300031456 Bacteria 7065
129 Ga0307408_100010846 3300031548 Bacteria 6012
130 Ga0307408_100045362 3300031548 Bacteria 3139
131 Ga0307405_10015300 3300031731 Bacteria 4152
132 Ga0307405_10028929 3300031731 Bacteria 3233
133 Ga0307413_10133788 3300031824 Bacteria 1701
134 Ga0307410_10043320 3300031852 Bacteria 2982
135 Ga0307406_10022321 3300031901 Bacteria 3753
136 Ga0307406_10291517 3300031901 Bacteria 1249
137 Ga0307407_10073443 3300031903 Bacteria 2044
138 Ga0307412_10005431 3300031911 Bacteria 7152
139 Ga0307412_10017372 3300031911 Bacteria 4306
140 Ga0307412_10037889 3300031911 Bacteria 3100
141 Ga0307412_10191129 3300031911 Bacteria 1548
142 Ga0307409_100194171 3300031995 Bacteria 1810
143 Ga0307416_100056218 3300032002 Bacteria 3174
144 Ga0307416_100108446 3300032002 Bacteria 2439
145 Ga0307414_10000122 3300032004 Bacteria 55018
146 Ga0307414_10069075 3300032004 Bacteria 2538
147 Ga0307414_10097843 3300032004 Bacteria 2200
148 Ga0307414_10337390 3300032004 Bacteria 1289
149 Ga0307411_10076536 3300032005 Bacteria 2288
150 Ga0307411_10204845 3300032005 Bacteria 1518
151 Ga0307415_100053207 3300032126 Bacteria 2757
152 Ga0436365_0062931 3300039437 Bacteria 52276
153 Ga0436365_0869628 3300039437 Bacteria 66366
154 Ga0436362_0580304 3300039453 Bacteria 124869
155 Ga0439445_0017270 3300042004 Bacteria 1783
156 Ga0439435_0024562 3300042436 Bacteria 1591
157 Ga0466972_0021601 3300044658 Bacteria 3207
158 Ga0466966_0177909 3300044684 Bacteria 1291
159 Ga0466961_0027358 3300044693 Bacteria 3667
160 Ga0466964_0093781 3300044706 Bacteria 1311
161 Ga0466971_0136455 3300044719 Bacteria 1141
162 Ga0466970_0026510 3300044765 Bacteria 3037
163 Ga0466960_0144126 3300044901 Bacteria 1267
164 Ga0466958_0233673 3300045836 Bacteria 1174
165 Ga0495627_000024 3300046453 Bacteria 250480
166 Ga0495627_009569 3300046453 Bacteria 3560
167 Ga0495584_0066955 3300046491 Bacteria 1806
168 Ga0495596_0002823 3300046500 Bacteria 9077
169 Ga0495606_0110972 3300046507 Bacteria 1654
170 Ga0495610_0000053 3300046512 Bacteria 142545
171 Ga0495610_0004173 3300046512 Bacteria 10803
172 Ga0495632_0000075 3300046519 Bacteria 102051
173 Ga0495632_0000306 3300046519 Bacteria 47401
174 Ga0495637_0000123 3300046520 Bacteria 57717
175 Ga0495643_0000009 3300046522 Bacteria 344767
176 Ga0495643_0000042 3300046522 Bacteria 229665
177 Ga0495643_0018114 3300046522 Bacteria 4101
178 Ga0495648_0052088 3300046524 Bacteria 2489
179 Ga0495663_0000003 3300046525 Bacteria 362694
180 Ga0495654_0041881 3300046530 Bacteria 2276
181 Ga0495598_0001924 3300046537 Bacteria 4207
182 Ga0495633_0005135 3300046558 Bacteria 8116
183 Ga0495633_0049138 3300046558 Bacteria 1991
184 Ga0495633_0100369 3300046558 Bacteria 1344
185 Ga0495668_0000015 3300046616 Bacteria 441932
186 Ga0495625_0000190 3300046660 Bacteria 97529
187 Ga0495661_0014114 3300046665 Bacteria 5353
188 Ga0495671_0000013 3300046692 Bacteria 344767
189 Ga0495681_0000099 3300047470 Bacteria 75808
190 Ga0495681_0001560 3300047470 Bacteria 17078
191 Ga0495686_0000091 3300047472 Bacteria 190563
192 Ga0495626_0000139 3300048091 Bacteria 92719
193 Ga0496108_0001530 3300048911 Bacteria 18310
194 Ga0496110_0060615 3300048913 Bacteria 3338
195 Ga0496116_0000045 3300048919 Bacteria 324307
196 Ga0496117_0057895 3300048920 Bacteria 2688
197 Ga0496118_0011213 3300048921 Bacteria 8776
198 Ga0496121_0000190 3300048924 Bacteria 136607
199 Ga0496121_0000930 3300048924 Bacteria 52952
200 Ga0496121_0005432 3300048924 Bacteria 16336
201 Ga0496121_0012164 3300048924 Bacteria 9442
202 Ga0496122_0005345 3300048925 Bacteria 15345
203 Ga0496122_0196950 3300048925 Bacteria 1182
204 Ga0496123_0001952 3300048926 Bacteria 26806
205 Ga0496124_0003632 3300048927 Bacteria 18723
206 Ga0496124_0013710 3300048927 Bacteria 7893
207 Ga0496125_0010180 3300048928 Bacteria 9531
208 Ga0496125_0016914 3300048928 Bacteria 6979
209 Ga0496126_0000519 3300048929 Bacteria 74968
210 Ga0496126_0002859 3300048929 Bacteria 22569
211 Ga0496126_0032193 3300048929 Bacteria 4943
212 Ga0496126_0062457 3300048929 Bacteria 3342
213 Ga0495678_011003 3300049459 Bacteria 4354
214 Ga0501034_0493524 3300049571 Bacteria 1139
215 nmdc:mga06z11_348_c1 3300050494 Bacteria 17434
216 nmdc:mga04h51_137_c1 3300050495 Bacteria 21470
217 nmdc:mga07m45_38630_c1 3300050496 Bacteria 2664
218 nmdc:mga0sz30_37694_c1 3300050516 Bacteria 1203
219 Ga0500592_003700 3300053116 Bacteria 2437
220 Ga0500618_012816 3300053125 Bacteria 2185
221 Ga0500568_0000634 3300053139 Bacteria 25303
222 Ga0500604_0038873 3300053151 Bacteria 1429
223 Ga0500624_000003 3300053157 Bacteria 253364
224 Ga0500624_000042 3300053157 Bacteria 90289
225 Ga0500624_000173 3300053157 Bacteria 25864
226 Ga0500627_0000008 3300053158 Bacteria 161914
227 Ga0500636_0007644 3300053177 Bacteria 6252
228 Ga0500637_0000073 3300053178 Bacteria 35884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025932 Ga0207690_10007990 Ga0207690_100079904 270
2 3300048919 Ga0496116_0000045 Ga0496116_0000045_296294_297196 272
3 3300048925 Ga0496122_0005345 Ga0496122_0005345_9027_9929 272
4 3300048926 Ga0496123_0001952 Ga0496123_0001952_23277_24179 272
5 3300048929 Ga0496126_0000519 Ga0496126_0000519_46370_47272 272
6 3300046491 Ga0495584_0066955 Ga0495584_0066955_673_1584 273
7 3300046519 Ga0495632_0000075 Ga0495632_0000075_74060_74971 273
8 3300046520 Ga0495637_0000123 Ga0495637_0000123_27094_28005 273
9 3300046522 Ga0495643_0000009 Ga0495643_0000009_292120_293031 273
10 3300046525 Ga0495663_0000003 Ga0495663_0000003_120744_121655 273
11 3300046558 Ga0495633_0005135 Ga0495633_0005135_4350_5261 273
12 3300046692 Ga0495671_0000013 Ga0495671_0000013_292120_293031 273
13 3300047470 Ga0495681_0001560 Ga0495681_0001560_10495_11406 273
14 3300005339 Ga0070660_100000348 Ga0070660_1000003487 274
15 3300025919 Ga0207657_10003426 Ga0207657_100034263 274
16 3300003781 Ga0055536_1006124 Ga0055536_10061245 275
17 3300025292 Ga0209676_1000146 Ga0209676_100014628 275
18 3300025298 Ga0209050_1003926 Ga0209050_10039266 275
19 3300005327 Ga0070658_10000003 Ga0070658_10000003168 276
20 3300025909 Ga0207705_10000005 Ga0207705_10000005171 276
21 3300031911 Ga0307412_10017372 Ga0307412_100173724 276
22 3300046500 Ga0495596_0002823 Ga0495596_0002823_330_1232 277
23 3300046512 Ga0495610_0004173 Ga0495610_0004173_3111_4013 277
24 3300048091 Ga0495626_0000139 Ga0495626_0000139_54090_54992 277
25 3300005345 Ga0070692_10000249 Ga0070692_1000024913 283
26 3300048924 Ga0496121_0012164 Ga0496121_0012164_2710_3606 283
27 3300048924 Ga0496121_0005432 Ga0496121_0005432_4230_5132 286
28 3300003794 Ga0055531_10027872 Ga0055531_100278721 287
29 3300025304 Ga0209257_1013867 Ga0209257_10138674 287
30 3300048927 Ga0496124_0013710 Ga0496124_0013710_1663_2565 288
31 3300015690 Ga0183363_1015 Ga0183363_101559 297
32 iso_pu_bacteria 2990265787 2990268163 297
33 iso_pu_bacteria 2993693658 2993696812 297
34 2162886007 SwRhRL2b_contig_335976 SwRhRL2b_0456.00000090 298
35 3300003781 Ga0055536_1001850 Ga0055536_100185010 298
36 3300003781 Ga0055536_1007381 Ga0055536_10073814 298
37 3300003791 Ga0055530_10000314 Ga0055530_1000031438 298
38 3300003794 Ga0055531_10006136 Ga0055531_100061361 298
39 3300003794 Ga0055531_10014641 Ga0055531_100146411 298
40 3300005289 Ga0065704_10071887 Ga0065704_1007188711 298
41 3300005327 Ga0070658_10000252 Ga0070658_1000025259 298
42 3300005327 Ga0070658_10000304 Ga0070658_1000030428 298
43 3300005331 Ga0070670_100001211 Ga0070670_1000012115 298
44 3300005335 Ga0070666_10002955 Ga0070666_100029551 298
45 3300005335 Ga0070666_10056773 Ga0070666_100567732 298
46 3300005339 Ga0070660_100018322 Ga0070660_1000183225 298
47 3300005347 Ga0070668_100000030 Ga0070668_10000003016 298
48 3300005347 Ga0070668_100121105 Ga0070668_1001211052 298
49 3300005353 Ga0070669_100000008 Ga0070669_100000008119 298
50 3300005353 Ga0070669_100111085 Ga0070669_1001110852 298
51 3300005353 Ga0070669_100145198 Ga0070669_1001451982 298
52 3300005355 Ga0070671_100000010 Ga0070671_100000010152 298
53 3300005355 Ga0070671_100001177 Ga0070671_10000117722 298
54 3300005367 Ga0070667_100000071 Ga0070667_100000071137 298
55 3300005457 Ga0070662_100051119 Ga0070662_1000511193 298
56 3300005539 Ga0068853_100142729 Ga0068853_1001427293 298
57 3300005548 Ga0070665_100051178 Ga0070665_1000511785 298
58 3300005563 Ga0068855_100043171 Ga0068855_1000431715 298
59 3300005563 Ga0068855_100199429 Ga0068855_1001994292 298
60 3300005578 Ga0068854_100001776 Ga0068854_1000017769 298
61 3300005614 Ga0068856_100005689 Ga0068856_1000056899 298
62 3300005616 Ga0068852_100000183 Ga0068852_1000001835 298
63 3300005616 Ga0068852_100000357 Ga0068852_10000035711 298
64 3300005618 Ga0068864_100000851 Ga0068864_10000085113 298
65 3300005618 Ga0068864_100002171 Ga0068864_1000021718 298
66 3300005719 Ga0068861_100001538 Ga0068861_1000015385 298
67 3300005841 Ga0068863_100004481 Ga0068863_1000044814 298
68 3300005841 Ga0068863_100125707 Ga0068863_1001257072 298
69 3300005842 Ga0068858_100015704 Ga0068858_1000157043 298
70 3300005843 Ga0068860_100000049 Ga0068860_10000004982 298
71 3300005844 Ga0068862_100000334 Ga0068862_10000033416 298
72 3300005844 Ga0068862_100006425 Ga0068862_1000064259 298
73 3300006178 Ga0075367_10001708 Ga0075367_100017083 298
74 3300006931 Ga0097620_100004236 Ga0097620_1000042369 298
75 3300009011 Ga0105251_10014937 Ga0105251_100149372 298
76 3300009093 Ga0105240_10008858 Ga0105240_100088582 298
77 3300009093 Ga0105240_10028140 Ga0105240_100281408 298
78 3300009093 Ga0105240_10066732 Ga0105240_100667325 298
79 3300009101 Ga0105247_10001269 Ga0105247_1000126913 298
80 3300009545 Ga0105237_10002109 Ga0105237_100021097 298
81 3300010375 Ga0105239_10000266 Ga0105239_1000026669 298
82 3300013102 Ga0157371_10015280 Ga0157371_100152802 298
83 3300013102 Ga0157371_10037288 Ga0157371_100372885 298
84 3300013104 Ga0157370_10061123 Ga0157370_100611232 298
85 3300013306 Ga0163162_10045865 Ga0163162_100458655 298
86 3300017792 Ga0163161_10006712 Ga0163161_100067125 298
87 3300020082 Ga0206353_11828632 Ga0206353_118286324 298
88 3300021358 Ga0213873_10000016 Ga0213873_1000001624 298
89 3300021384 Ga0213876_10000056 Ga0213876_10000056114 298
90 3300021384 Ga0213876_10000250 Ga0213876_1000025020 298
91 3300025291 Ga0209675_1000429 Ga0209675_10004293 298
92 3300025292 Ga0209676_1000412 Ga0209676_100041243 298
93 3300025292 Ga0209676_1000599 Ga0209676_100059928 298
94 3300025294 Ga0209025_1005998 Ga0209025_10059984 298
95 3300025298 Ga0209050_1000254 Ga0209050_100025425 298
96 3300025298 Ga0209050_1000841 Ga0209050_100084135 298
97 3300025298 Ga0209050_1027383 Ga0209050_10273832 298
98 3300025304 Ga0209257_1000267 Ga0209257_100026753 298
99 3300025304 Ga0209257_1000277 Ga0209257_100027766 298
100 3300025315 Ga0207697_10000036 Ga0207697_100000364 298
101 3300025903 Ga0207680_10000044 Ga0207680_100000448 298
102 3300025904 Ga0207647_10017370 Ga0207647_100173704 298
103 3300025909 Ga0207705_10000007 Ga0207705_10000007434 298
104 3300025909 Ga0207705_10000265 Ga0207705_1000026564 298
105 3300025913 Ga0207695_10004035 Ga0207695_1000403517 298
106 3300025913 Ga0207695_10049012 Ga0207695_100490125 298
107 3300025914 Ga0207671_10017597 Ga0207671_100175971 298
108 3300025919 Ga0207657_10016311 Ga0207657_100163114 298
109 3300025923 Ga0207681_10000002 Ga0207681_10000002212 298
110 3300025923 Ga0207681_10008827 Ga0207681_100088275 298
111 3300025924 Ga0207694_10021237 Ga0207694_100212374 298
112 3300025925 Ga0207650_10001217 Ga0207650_1000121719 298
113 3300025931 Ga0207644_10000002 Ga0207644_10000002211 298
114 3300025931 Ga0207644_10000791 Ga0207644_100007915 298
115 3300025933 Ga0207706_10299632 Ga0207706_102996322 298
116 3300025949 Ga0207667_10000038 Ga0207667_1000003856 298
117 3300025949 Ga0207667_10009368 Ga0207667_1000936817 298
118 3300025949 Ga0207667_10048955 Ga0207667_100489554 298
119 3300025949 Ga0207667_10171498 Ga0207667_101714982 298
120 3300025949 Ga0207667_10214829 Ga0207667_102148292 298
121 3300025972 Ga0207668_10000011 Ga0207668_10000011136 298
122 3300025972 Ga0207668_10043269 Ga0207668_100432693 298
123 3300025981 Ga0207640_10000279 Ga0207640_1000027925 298
124 3300025986 Ga0207658_10000014 Ga0207658_1000001490 298
125 3300026035 Ga0207703_10001718 Ga0207703_100017187 298
126 3300026041 Ga0207639_10009382 Ga0207639_100093824 298
127 3300026041 Ga0207639_10076416 Ga0207639_100764162 298
128 3300026067 Ga0207678_10358621 Ga0207678_103586212 298
129 3300026078 Ga0207702_10005841 Ga0207702_100058415 298
130 3300026078 Ga0207702_10012369 Ga0207702_100123694 298
131 3300026088 Ga0207641_10000545 Ga0207641_1000054532 298
132 3300026088 Ga0207641_10002975 Ga0207641_1000297510 298
133 3300026088 Ga0207641_10375344 Ga0207641_103753442 298
134 3300026095 Ga0207676_10000489 Ga0207676_1000048922 298
135 3300026095 Ga0207676_10004187 Ga0207676_100041873 298
136 3300026116 Ga0207674_10095817 Ga0207674_100958173 298
137 3300026116 Ga0207674_10159960 Ga0207674_101599602 298
138 3300026118 Ga0207675_100002191 Ga0207675_10000219111 298
139 3300026118 Ga0207675_100114363 Ga0207675_1001143634 298
140 3300026142 Ga0207698_10000120 Ga0207698_1000012051 298
141 3300026142 Ga0207698_10000919 Ga0207698_1000091913 298
142 3300026142 Ga0207698_10004603 Ga0207698_1000460310 298
143 3300027866 Ga0209813_10000345 Ga0209813_100003456 298
144 3300028379 Ga0268266_10047748 Ga0268266_100477485 298
145 3300028380 Ga0268265_10001056 Ga0268265_1000105616 298
146 3300028380 Ga0268265_10002184 Ga0268265_100021845 298
147 3300028381 Ga0268264_10000121 Ga0268264_1000012170 298
148 3300030742 Ga0316183_1179489 Ga0316183_11794892 298
149 3300031456 Ga0307513_10024230 Ga0307513_100242304 298
150 3300031548 Ga0307408_100010846 Ga0307408_1000108464 298
151 3300031548 Ga0307408_100045362 Ga0307408_1000453624 298
152 3300031731 Ga0307405_10015300 Ga0307405_100153007 298
153 3300031731 Ga0307405_10028929 Ga0307405_100289292 298
154 3300031824 Ga0307413_10133788 Ga0307413_101337882 298
155 3300031852 Ga0307410_10043320 Ga0307410_100433203 298
156 3300031901 Ga0307406_10022321 Ga0307406_100223213 298
157 3300031901 Ga0307406_10291517 Ga0307406_102915172 298
158 3300031903 Ga0307407_10073443 Ga0307407_100734431 298
159 3300031911 Ga0307412_10005431 Ga0307412_100054315 298
160 3300031911 Ga0307412_10037889 Ga0307412_100378893 298
161 3300031911 Ga0307412_10191129 Ga0307412_101911292 298
162 3300031995 Ga0307409_100194171 Ga0307409_1001941712 298
163 3300032002 Ga0307416_100056218 Ga0307416_1000562184 298
164 3300032002 Ga0307416_100108446 Ga0307416_1001084463 298
165 3300032004 Ga0307414_10000122 Ga0307414_1000012219 298
166 3300032004 Ga0307414_10069075 Ga0307414_100690753 298
167 3300032004 Ga0307414_10097843 Ga0307414_100978433 298
168 3300032004 Ga0307414_10337390 Ga0307414_103373902 298
169 3300032005 Ga0307411_10076536 Ga0307411_100765362 298
170 3300032005 Ga0307411_10204845 Ga0307411_102048452 298
171 3300032126 Ga0307415_100053207 Ga0307415_1000532074 298
172 3300039437 Ga0436365_0062931 Ga0436365_0062931_13105_14001 298
173 3300039437 Ga0436365_0869628 Ga0436365_0869628_22434_23330 298
174 3300039453 Ga0436362_0580304 Ga0436362_0580304_22434_23330 298
175 3300042004 Ga0439445_0017270 Ga0439445_0017270_258_1166 298
176 3300042436 Ga0439435_0024562 Ga0439435_0024562_24_926 298
177 3300044658 Ga0466972_0021601 Ga0466972_0021601_2046_2942 298
178 3300044684 Ga0466966_0177909 Ga0466966_0177909_129_1025 298
179 3300044693 Ga0466961_0027358 Ga0466961_0027358_1476_2372 298
180 3300044706 Ga0466964_0093781 Ga0466964_0093781_74_970 298
181 3300044719 Ga0466971_0136455 Ga0466971_0136455_140_1036 298
182 3300044765 Ga0466970_0026510 Ga0466970_0026510_1094_1990 298
183 3300044901 Ga0466960_0144126 Ga0466960_0144126_133_1029 298
184 3300045836 Ga0466958_0233673 Ga0466958_0233673_230_1126 298
185 3300046453 Ga0495627_000024 Ga0495627_000024_88476_89387 298
186 3300046453 Ga0495627_009569 Ga0495627_009569_854_1804 298
187 3300046507 Ga0495606_0110972 Ga0495606_0110972_511_1407 298
188 3300046512 Ga0495610_0000053 Ga0495610_0000053_107152_108102 298
189 3300046519 Ga0495632_0000306 Ga0495632_0000306_14635_15537 298
190 3300046522 Ga0495643_0000042 Ga0495643_0000042_21625_22527 298
191 3300046522 Ga0495643_0018114 Ga0495643_0018114_2622_3647 298
192 3300046524 Ga0495648_0052088 Ga0495648_0052088_324_1235 298
193 3300046530 Ga0495654_0041881 Ga0495654_0041881_455_1357 298
194 3300046537 Ga0495598_0001924 Ga0495598_0001924_2022_2924 298
195 3300046558 Ga0495633_0049138 Ga0495633_0049138_481_1377 298
196 3300046558 Ga0495633_0100369 Ga0495633_0100369_429_1331 298
197 3300046616 Ga0495668_0000015 Ga0495668_0000015_141913_142824 298
198 3300046660 Ga0495625_0000190 Ga0495625_0000190_50093_51004 298
199 3300046665 Ga0495661_0014114 Ga0495661_0014114_2322_3272 298
200 3300047470 Ga0495681_0000099 Ga0495681_0000099_58017_58967 298
201 3300047472 Ga0495686_0000091 Ga0495686_0000091_63724_64620 298
202 3300048911 Ga0496108_0001530 Ga0496108_0001530_9288_10184 298
203 3300048913 Ga0496110_0060615 Ga0496110_0060615_1760_2656 298
204 3300048920 Ga0496117_0057895 Ga0496117_0057895_91_987 298
205 3300048921 Ga0496118_0011213 Ga0496118_0011213_5674_6570 298
206 3300048924 Ga0496121_0000190 Ga0496121_0000190_22316_23212 298
207 3300048924 Ga0496121_0000930 Ga0496121_0000930_46497_47393 298
208 3300048925 Ga0496122_0196950 Ga0496122_0196950_245_1141 298
209 3300048927 Ga0496124_0003632 Ga0496124_0003632_6911_7813 298
210 3300048928 Ga0496125_0010180 Ga0496125_0010180_4409_5311 298
211 3300048928 Ga0496125_0016914 Ga0496125_0016914_682_1578 298
212 3300048929 Ga0496126_0002859 Ga0496126_0002859_14628_15524 298
213 3300048929 Ga0496126_0032193 Ga0496126_0032193_3504_4415 298
214 3300048929 Ga0496126_0062457 Ga0496126_0062457_1056_1952 298
215 3300049459 Ga0495678_011003 Ga0495678_011003_1736_2686 298
216 3300049571 Ga0501034_0493524 Ga0501034_0493524_103_1044 298
217 3300050494 nmdc:mga06z11_348_c1 nmdc:mga06z11_348_c1_4039_4950 298
218 3300050495 nmdc:mga04h51_137_c1 nmdc:mga04h51_137_c1_8075_8986 298
219 3300050496 nmdc:mga07m45_38630_c1 nmdc:mga07m45_38630_c1_394_1305 298
220 3300050516 nmdc:mga0sz30_37694_c1 nmdc:mga0sz30_37694_c1_263_1165 298
221 3300053116 Ga0500592_003700 Ga0500592_003700_1220_2164 298
222 3300053125 Ga0500618_012816 Ga0500618_012816_822_1736 298
223 3300053139 Ga0500568_0000634 Ga0500568_0000634_21696_22607 298
224 3300053151 Ga0500604_0038873 Ga0500604_0038873_279_1190 298
225 3300053157 Ga0500624_000003 Ga0500624_000003_64507_65418 298
226 3300053157 Ga0500624_000042 Ga0500624_000042_88952_89848 298
227 3300053157 Ga0500624_000173 Ga0500624_000173_22831_23745 298
228 3300053158 Ga0500627_0000008 Ga0500627_0000008_119249_120193 298
229 3300053177 Ga0500636_0007644 Ga0500636_0007644_1487_2401 298
230 3300053178 Ga0500637_0000073 Ga0500637_0000073_26490_27401 298
231 iso_pu_bacteria 2512564014 2512645617 298
232 iso_pu_bacteria 2643221560 2643820414 298
233 iso_pu_bacteria 2643221563 2643834835 298
234 iso_pu_bacteria 2643221588 2643951676 298
235 iso_pu_bacteria 2643221608 2644055762 298
236 iso_pu_bacteria 2739367664 2739651107 298
237 iso_pu_bacteria 2739367865 2740029580 298
238 iso_pu_bacteria 2808606401 2809062598 298
239 iso_pu_bacteria 2808606404 2809078718 298
240 iso_pu_bacteria 2808606405 2809082987 298
241 iso_pu_bacteria 2818991438 2819551419 298
242 iso_pu_bacteria 2852653556 2852656110 298
243 iso_pu_bacteria 2852680915 2852682837 298
244 iso_pu_bacteria 2880518877 2880521596 298
245 iso_pu_bacteria 2919709256 2919709530 298
246 iso_pu_bacteria 8054302542 8054305104 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14561

TPR_20

Tetratricopeptide repeat

212

301

0.97

PF00085

Thioredoxin

Thioredoxin

9

113

0.93

PF14559

TPR_19

Tetratricopeptide repeat

141

211

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.9498 126 182
7ysi-assembly1.cif.gz_A crystal structure of thioredoxin 2 0.9478 22 108
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9449 10 108
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9435 127 182
1txx-assembly1.cif.gz_A active-site variant of e.coli thioredoxin 0.9405 10 110
ID Description Score Start End Superfamily
af_P9WG61_44_154_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9382 10 111 3.40.30.10
1uvzD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9336 10 110 3.40.30.10
1thxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9323 10 110 3.40.30.10
af_O15050_4_90_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9296 122 182 1.25.40.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.922 10 111 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q2X321-F1-model_v4 deleted 0.9999 1 113
AF-A0A4Q2X321-F1-model_v4 deleted 0.9911 1 113
AF-A0A7C5S7A3-F1-model_v4 Thioredoxin 0.9461 10 111 GO:0005737
GO:0015035
AF-A0A497QSS7-F1-model_v4 Thioredoxin 0.9326 11 111 GO:0005737
GO:0015035
AF-A0A842VPL2-F1-model_v4 Thioredoxin domain-containing protein 0.9304 9 109 GO:0005737
GO:0015035

Feature Viewer

pLDDT pTM Quality
88.32 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map