F358159

General Info

Members Datasets Scaffolds Average Seq Length
246 143 492 152

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10117701|Ga0157370_101177013
Length 167
Sequence LAARRLLSGEGDQTQAMTISIGADHAGYEMKQQLMEFMRKLGHTVHDVGTFEPGKPDDYPDYAILVAEEVRSGKAERGLLVCGSGVGVSVAANKFKGIRAGLCHDHYSAQQGVEHDNMNVLVLGSRIIGPMMAQDVTEAFLKATFSGEERHVRRLNKIKGIEEHELC

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.91
Rhizosphere 74.8
Stem 0
Stem Tuber 0
Unclassified 17.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10117701 3300013104 Unclassified 2482
2 Ga0070683_102005978 3300005329 Unclassified 556
3 Ga0070680_100411175 3300005336 Bacteria 1154
4 Ga0070680_100505031 3300005336 Bacteria 1035
5 Ga0070660_100116452 3300005339 Bacteria 2131
6 Ga0070661_100269108 3300005344 Unclassified 1319
7 Ga0070673_101116715 3300005364 Bacteria 737
8 Ga0070659_100102948 3300005366 Bacteria 2299
9 Ga0070659_100120792 3300005366 Bacteria 2122
10 Ga0070709_10162930 3300005434 Bacteria 1552
11 Ga0070714_100374664 3300005435 Bacteria 1341
12 Ga0070714_100389385 3300005435 Bacteria 1315
13 Ga0070713_100701537 3300005436 Bacteria 966
14 Ga0070713_101223616 3300005436 Bacteria 727
15 Ga0070710_10634972 3300005437 Unclassified 747
16 Ga0070705_100442380 3300005440 Bacteria 973
17 Ga0070663_100966548 3300005455 Bacteria 739
18 Ga0070678_100569508 3300005456 Bacteria 1008
19 Ga0070681_10156569 3300005458 Bacteria 2203
20 Ga0070681_10364346 3300005458 Bacteria 1356
21 Ga0070699_100990067 3300005518 Unclassified 771
22 Ga0070679_100326849 3300005530 Bacteria 1482
23 Ga0070684_100890054 3300005535 Bacteria 834
24 Ga0068853_100054131 3300005539 Bacteria 3458
25 Ga0070696_100037133 3300005546 Bacteria 3359
26 Ga0070665_100305812 3300005548 Bacteria 1593
27 Ga0070704_100063495 3300005549 Bacteria 2651
28 Ga0068855_100062582 3300005563 Bacteria 4344
29 Ga0068855_100133785 3300005563 Unclassified 2830
30 Ga0068855_102510081 3300005563 Bacteria 513
31 Ga0070664_100006529 3300005564 Bacteria 9403
32 Ga0068857_100234225 3300005577 Unclassified 1680
33 Ga0068856_100014896 3300005614 Bacteria 7505
34 Ga0068856_100016445 3300005614 Bacteria 7159
35 Ga0068856_100126324 3300005614 Bacteria 2561
36 Ga0068856_100937986 3300005614 Bacteria 884
37 Ga0070702_100300017 3300005615 Bacteria 1111
38 Ga0070702_100346116 3300005615 Bacteria 1045
39 Ga0068852_100757999 3300005616 Bacteria 983
40 Ga0068852_101344529 3300005616 Unclassified 736
41 Ga0068859_100482670 3300005617 Bacteria 1335
42 Ga0068863_100124884 3300005841 Bacteria 2455
43 Ga0068860_100834702 3300005843 Bacteria 936
44 Ga0081455_10044413 3300005937 Bacteria 3876
45 Ga0081538_10027131 3300005981 Bacteria 3980
46 Ga0081539_10000909 3300005985 Bacteria 56067
47 Ga0070717_10021257 3300006028 Bacteria 5113
48 Ga0070717_10066979 3300006028 Bacteria 2987
49 Ga0097621_100044537 3300006237 Bacteria 3580
50 Ga0068871_100106014 3300006358 Bacteria 2359
51 Ga0075428_100023635 3300006844 Bacteria 6803
52 Ga0075428_100386087 3300006844 Bacteria 1501
53 Ga0075433_10012234 3300006852 Bacteria 6920
54 Ga0075434_100052295 3300006871 Bacteria 4058
55 Ga0075434_100052963 3300006871 Bacteria 4033
56 Ga0075434_100119754 3300006871 Bacteria 2647
57 Ga0075434_100731414 3300006871 Bacteria 1007
58 Ga0075434_100742759 3300006871 Bacteria 998
59 Ga0075429_100070430 3300006880 Bacteria 3045
60 Ga0075436_100850538 3300006914 Bacteria 681
61 Ga0097620_100482598 3300006931 Bacteria 1335
62 Ga0075435_100057709 3300007076 Bacteria 3141
63 Ga0075435_100088302 3300007076 Bacteria 2555
64 Ga0075435_100955912 3300007076 Bacteria 748
65 Ga0111539_10066810 3300009094 Bacteria 4247
66 Ga0111539_11675142 3300009094 Unclassified 737
67 Ga0105247_10381380 3300009101 Bacteria 1000
68 Ga0114129_10000975 3300009147 Bacteria 37455
69 Ga0114129_10000982 3300009147 Bacteria 37269
70 Ga0114129_10922312 3300009147 Bacteria 1105
71 Ga0114129_11708235 3300009147 Bacteria 768
72 Ga0105237_10483660 3300009545 Bacteria 1244
73 Ga0105239_10419647 3300010375 Bacteria 1515
74 Ga0105239_12051368 3300010375 Bacteria 664
75 Ga0157373_10043188 3300013100 Bacteria 3220
76 Ga0157371_10008437 3300013102 Bacteria 8204
77 Ga0157370_10039305 3300013104 Bacteria 4572
78 Ga0157370_10101638 3300013104 Bacteria 2693
79 Ga0157370_10271776 3300013104 Bacteria 1566
80 Ga0157369_10002853 3300013105 Bacteria 20642
81 Ga0157369_10027531 3300013105 Bacteria 6300
82 Ga0157369_10643704 3300013105 Bacteria 1093
83 Ga0157374_10007754 3300013296 Bacteria 9163
84 Ga0157374_10009046 3300013296 Bacteria 8536
85 Ga0157378_10730111 3300013297 Bacteria 1012
86 Ga0157372_10046287 3300013307 Bacteria 4829
87 Ga0157372_10113332 3300013307 Unclassified 3108
88 Ga0157372_10581569 3300013307 Unclassified 1305
89 Ga0157372_10736632 3300013307 Bacteria 1146
90 Ga0157376_11368685 3300014969 Bacteria 739
91 Ga0206351_10740068 3300020077 Unclassified 743
92 Ga0213872_10000209 3300021361 Bacteria 52209
93 Ga0213874_10033384 3300021377 Bacteria 1500
94 Ga0213874_10102244 3300021377 Unclassified 954
95 Ga0213876_10015869 3300021384 Unclassified 3986
96 Ga0213876_10125346 3300021384 Bacteria 1364
97 Ga0213876_10131371 3300021384 Unclassified 1331
98 Ga0213876_10220660 3300021384 Bacteria 1008
99 Ga0213876_10365040 3300021384 Unclassified 768
100 Ga0213875_10000018 3300021388 Bacteria 233445
101 Ga0213875_10000689 3300021388 Bacteria 26175
102 Ga0213875_10004458 3300021388 Bacteria 7680
103 Ga0213875_10020167 3300021388 Bacteria 3198
104 Ga0213875_10114495 3300021388 Bacteria 1260
105 Ga0213875_10157732 3300021388 Bacteria 1064
106 Ga0213875_10164387 3300021388 Bacteria 1041
107 Ga0213871_10092610 3300021441 Bacteria 877
108 Ga0207710_10227996 3300025900 Bacteria 926
109 Ga0207647_10387773 3300025904 Unclassified 788
110 Ga0207699_10121692 3300025906 Bacteria 1689
111 Ga0207707_11492136 3300025912 Bacteria 536
112 Ga0207671_10349070 3300025914 Bacteria 1173
113 Ga0207660_10461604 3300025917 Bacteria 1028
114 Ga0207657_10107666 3300025919 Bacteria 2305
115 Ga0207652_10057721 3300025921 Bacteria 3343
116 Ga0207652_10182785 3300025921 Bacteria 1885
117 Ga0207700_10900909 3300025928 Bacteria 791
118 Ga0207664_10018608 3300025929 Bacteria 5118
119 Ga0207664_10321549 3300025929 Bacteria 1365
120 Ga0207664_10423399 3300025929 Bacteria 1186
121 Ga0207690_10075929 3300025932 Bacteria 2332
122 Ga0207690_10126401 3300025932 Bacteria 1865
123 Ga0207661_10456210 3300025944 Bacteria 1165
124 Ga0207679_10117520 3300025945 Bacteria 2110
125 Ga0207667_10090017 3300025949 Bacteria 3171
126 Ga0207667_10714984 3300025949 Unclassified 1003
127 Ga0207640_10095506 3300025981 Bacteria 2070
128 Ga0207639_10014326 3300026041 Bacteria 5574
129 Ga0207702_10006201 3300026078 Bacteria 10336
130 Ga0207702_10096101 3300026078 Bacteria 2605
131 Ga0207702_10223463 3300026078 Bacteria 1756
132 Ga0207702_10722763 3300026078 Bacteria 982
133 Ga0207683_10303391 3300026121 Bacteria 1461
134 Ga0207698_10185345 3300026142 Bacteria 1848
135 Ga0207428_10324563 3300027907 Bacteria 1136
136 Ga0268266_10253595 3300028379 Bacteria 1628
137 Ga0268265_12533757 3300028380 Unclassified 519
138 Ga0268264_10634910 3300028381 Bacteria 1055
139 Ga0268264_10666797 3300028381 Unclassified 1031
140 Ga0265325_10077281 3300031241 Unclassified 1660
141 Ga0373923_0205106 3300035111 Bacteria 912
142 Ga0373943_0008712 3300035170 Bacteria 4547
143 Ga0373943_0338040 3300035170 Unclassified 861
144 Ga0373935_0091883 3300035692 Bacteria 1988
145 Ga0373927_0088887 3300035695 Bacteria 2006
146 Ga0373947_0001539 3300035725 Bacteria 14143
147 Ga0373925_0055384 3300037068 Unclassified 2969
148 Ga0436364_0037308 3300037853 Unclassified 1238
149 Ga0436364_0158068 3300037853 Bacteria 183638
150 Ga0436364_0281378 3300037853 Bacteria 6909
151 Ga0436364_0281724 3300037853 Bacteria 2580
152 Ga0436364_0330602 3300037853 Bacteria 3389
153 Ga0436364_0465728 3300037853 Bacteria 809
154 Ga0436364_0468475 3300037853 Bacteria 813
155 Ga0436364_0593000 3300037853 Bacteria 2265
156 Ga0436364_0611669 3300037853 Bacteria 2905
157 Ga0436364_0655343 3300037853 Bacteria 5783
158 Ga0436364_0776527 3300037853 Bacteria 12869
159 Ga0436364_0849129 3300037853 Bacteria 1429
160 Ga0436364_0873695 3300037853 Unclassified 2595
161 Ga0436364_0890864 3300037853 Bacteria 67172
162 Ga0436364_1063404 3300037853 Bacteria 7719
163 Ga0436364_1152233 3300037853 Bacteria 5657
164 Ga0436364_1368584 3300037853 Bacteria 10951
165 Ga0436364_1536360 3300037853 Unclassified 2869
166 Ga0436365_0326468 3300039437 Unclassified 1666
167 Ga0436365_0442403 3300039437 Bacteria 2012
168 Ga0436365_0443312 3300039437 Unclassified 722
169 Ga0436365_0691325 3300039437 Unclassified 1695
170 Ga0436365_0841820 3300039437 Unclassified 2099
171 Ga0436365_0894525 3300039437 Bacteria 4429
172 Ga0436365_1137015 3300039437 Bacteria 2839
173 Ga0436365_1563385 3300039437 Bacteria 30237
174 Ga0436365_1814587 3300039437 Bacteria 1810
175 Ga0436360_0213140 3300039438 Bacteria 1030
176 Ga0436360_0689379 3300039438 Unclassified 2038
177 Ga0436361_0424273 3300039447 Bacteria 91642
178 Ga0436361_0798341 3300039447 Bacteria 676
179 Ga0436363_0788279 3300039450 Bacteria 4328
180 Ga0436363_0791800 3300039450 Unclassified 4878
181 Ga0436363_1087906 3300039450 Bacteria 1786
182 Ga0436363_1157709 3300039450 Bacteria 1603
183 Ga0436362_0140242 3300039453 Bacteria 2482
184 Ga0436362_0194782 3300039453 Bacteria 3577
185 Ga0436362_0431003 3300039453 Bacteria 952
186 Ga0436362_0493858 3300039453 Bacteria 1254
187 Ga0436362_0637726 3300039453 Unclassified 560
188 Ga0436362_0682351 3300039453 Bacteria 606
189 Ga0436362_0806667 3300039453 Unclassified 1036
190 Ga0436362_0999391 3300039453 Bacteria 1882
191 Ga0439448_0008749 3300042005 Bacteria 2968
192 Ga0451577_1369553 3300042876 Unclassified 628
193 Ga0466966_0162245 3300044684 Bacteria 1361
194 Ga0466966_0213150 3300044684 Bacteria 1167
195 Ga0466971_0069622 3300044719 Unclassified 1597
196 Ga0466957_0537382 3300044842 Bacteria 814
197 Ga0466959_0330669 3300045049 Unclassified 1041
198 Ga0466958_0182741 3300045836 Bacteria 1331
199 Ga0495629_0321432 3300046459 Bacteria 1058
200 Ga0495582_0213675 3300046473 Bacteria 1103
201 Ga0495665_0081612 3300046531 Bacteria 1700
202 Ga0495674_0560265 3300047319 Bacteria 909
203 Ga0496101_0034894 3300048904 Bacteria 3555
204 Ga0496102_0116682 3300048905 Bacteria 2491
205 Ga0496103_0099598 3300048906 Bacteria 1839
206 Ga0496104_0021061 3300048907 Bacteria 5981
207 Ga0496105_1052208 3300048908 Bacteria 606
208 Ga0496106_0122219 3300048909 Bacteria 2036
209 Ga0496106_0658924 3300048909 Bacteria 836
210 Ga0496108_0002161 3300048911 Bacteria 15757
211 Ga0496109_0003048 3300048912 Bacteria 13964
212 Ga0496110_0053186 3300048913 Bacteria 3559
213 Ga0496111_0081088 3300048914 Bacteria 2368
214 Ga0496112_0004137 3300048915 Bacteria 12210
215 Ga0496112_0059471 3300048915 Bacteria 3766
216 Ga0496112_0551582 3300048915 Unclassified 1086
217 Ga0496113_0001141 3300048916 Bacteria 14441
218 Ga0496113_0167561 3300048916 Bacteria 1739
219 Ga0496115_0006054 3300048918 Bacteria 8831
220 Ga0501032_0412768 3300049569 Bacteria 867
221 Ga0501033_0035410 3300049570 Bacteria 3743
222 Ga0501034_0012262 3300049571 Bacteria 8859
223 Ga0501037_0067327 3300049573 Bacteria 2608
224 Ga0501043_0013762 3300049579 Bacteria 6331
225 Ga0501046_0757522 3300049580 Unclassified 682
226 Ga0501047_0050557 3300049581 Bacteria 4014
227 Ga0501070_0037150 3300049586 Unclassified 4066
228 Ga0501073_0125339 3300049589 Unclassified 1780
229 Ga0501074_0051478 3300049590 Unclassified 2972
230 Ga0501080_0668107 3300049742 Bacteria 918
231 Ga0501035_0050916 3300049822 Bacteria 3709
232 Ga0501044_0055786 3300049823 Unclassified 4057
233 nmdc:mga05p37_12580_c1 3300050507 Bacteria 10106
234 nmdc:mga05p37_1458168_c1 3300050507 Bacteria 685
235 nmdc:mga05p37_4367_c1 3300050507 Bacteria 16507
236 nmdc:mga09592_66416_c1 3300050508 Bacteria 3057
237 nmdc:mga08y16_1105176_c1 3300050511 Unclassified 768
238 nmdc:mga0n895_10966_c1 3300050512 Bacteria 8054
239 nmdc:mga0n895_29189_c1 3300050512 Bacteria 5257
240 nmdc:mga0rr50_1009730_c1 3300050513 Bacteria 709
241 nmdc:mga0rr50_1604451_c1 3300050513 Bacteria 549
242 nmdc:mga08x19_407606_c1 3300050514 Bacteria 954
243 nmdc:mga0a205_136548_c1 3300050515 Bacteria 2353
244 nmdc:mga0a205_22289_c1 3300050515 Bacteria 5998
245 nmdc:mga0a205_55088_c1 3300050515 Bacteria 3841
246 Ga0495612_0018129 3300053078 Bacteria 2818
247 Ga0157370_10117701
248 Ga0070683_102005978
249 Ga0070680_100411175
250 Ga0070680_100505031
251 Ga0070660_100116452
252 Ga0070661_100269108
253 Ga0070673_101116715
254 Ga0070659_100102948
255 Ga0070659_100120792
256 Ga0070709_10162930
257 Ga0070714_100374664
258 Ga0070714_100389385
259 Ga0070713_100701537
260 Ga0070713_101223616
261 Ga0070710_10634972
262 Ga0070705_100442380
263 Ga0070663_100966548
264 Ga0070678_100569508
265 Ga0070681_10156569
266 Ga0070681_10364346
267 Ga0070699_100990067
268 Ga0070679_100326849
269 Ga0070684_100890054
270 Ga0068853_100054131
271 Ga0070696_100037133
272 Ga0070665_100305812
273 Ga0070704_100063495
274 Ga0068855_100062582
275 Ga0068855_100133785
276 Ga0068855_102510081
277 Ga0070664_100006529
278 Ga0068857_100234225
279 Ga0068856_100014896
280 Ga0068856_100016445
281 Ga0068856_100126324
282 Ga0068856_100937986
283 Ga0070702_100300017
284 Ga0070702_100346116
285 Ga0068852_100757999
286 Ga0068852_101344529
287 Ga0068859_100482670
288 Ga0068863_100124884
289 Ga0068860_100834702
290 Ga0081455_10044413
291 Ga0081538_10027131
292 Ga0081539_10000909
293 Ga0070717_10021257
294 Ga0070717_10066979
295 Ga0097621_100044537
296 Ga0068871_100106014
297 Ga0075428_100023635
298 Ga0075428_100386087
299 Ga0075433_10012234
300 Ga0075434_100052295
301 Ga0075434_100052963
302 Ga0075434_100119754
303 Ga0075434_100731414
304 Ga0075434_100742759
305 Ga0075429_100070430
306 Ga0075436_100850538
307 Ga0097620_100482598
308 Ga0075435_100057709
309 Ga0075435_100088302
310 Ga0075435_100955912
311 Ga0111539_10066810
312 Ga0111539_11675142
313 Ga0105247_10381380
314 Ga0114129_10000975
315 Ga0114129_10000982
316 Ga0114129_10922312
317 Ga0114129_11708235
318 Ga0105237_10483660
319 Ga0105239_10419647
320 Ga0105239_12051368
321 Ga0157373_10043188
322 Ga0157371_10008437
323 Ga0157370_10039305
324 Ga0157370_10101638
325 Ga0157370_10271776
326 Ga0157369_10002853
327 Ga0157369_10027531
328 Ga0157369_10643704
329 Ga0157374_10007754
330 Ga0157374_10009046
331 Ga0157378_10730111
332 Ga0157372_10046287
333 Ga0157372_10113332
334 Ga0157372_10581569
335 Ga0157372_10736632
336 Ga0157376_11368685
337 Ga0206351_10740068
338 Ga0213872_10000209
339 Ga0213874_10033384
340 Ga0213874_10102244
341 Ga0213876_10015869
342 Ga0213876_10125346
343 Ga0213876_10131371
344 Ga0213876_10220660
345 Ga0213876_10365040
346 Ga0213875_10000018
347 Ga0213875_10000689
348 Ga0213875_10004458
349 Ga0213875_10020167
350 Ga0213875_10114495
351 Ga0213875_10157732
352 Ga0213875_10164387
353 Ga0213871_10092610
354 Ga0207710_10227996
355 Ga0207647_10387773
356 Ga0207699_10121692
357 Ga0207707_11492136
358 Ga0207671_10349070
359 Ga0207660_10461604
360 Ga0207657_10107666
361 Ga0207652_10057721
362 Ga0207652_10182785
363 Ga0207700_10900909
364 Ga0207664_10018608
365 Ga0207664_10321549
366 Ga0207664_10423399
367 Ga0207690_10075929
368 Ga0207690_10126401
369 Ga0207661_10456210
370 Ga0207679_10117520
371 Ga0207667_10090017
372 Ga0207667_10714984
373 Ga0207640_10095506
374 Ga0207639_10014326
375 Ga0207702_10006201
376 Ga0207702_10096101
377 Ga0207702_10223463
378 Ga0207702_10722763
379 Ga0207683_10303391
380 Ga0207698_10185345
381 Ga0207428_10324563
382 Ga0268266_10253595
383 Ga0268265_12533757
384 Ga0268264_10634910
385 Ga0268264_10666797
386 Ga0265325_10077281
387 Ga0373923_0205106
388 Ga0373943_0008712
389 Ga0373943_0338040
390 Ga0373935_0091883
391 Ga0373927_0088887
392 Ga0373947_0001539
393 Ga0373925_0055384
394 Ga0436364_0037308
395 Ga0436364_0158068
396 Ga0436364_0281378
397 Ga0436364_0281724
398 Ga0436364_0330602
399 Ga0436364_0465728
400 Ga0436364_0468475
401 Ga0436364_0593000
402 Ga0436364_0611669
403 Ga0436364_0655343
404 Ga0436364_0776527
405 Ga0436364_0849129
406 Ga0436364_0873695
407 Ga0436364_0890864
408 Ga0436364_1063404
409 Ga0436364_1152233
410 Ga0436364_1368584
411 Ga0436364_1536360
412 Ga0436365_0326468
413 Ga0436365_0442403
414 Ga0436365_0443312
415 Ga0436365_0691325
416 Ga0436365_0841820
417 Ga0436365_0894525
418 Ga0436365_1137015
419 Ga0436365_1563385
420 Ga0436365_1814587
421 Ga0436360_0213140
422 Ga0436360_0689379
423 Ga0436361_0424273
424 Ga0436361_0798341
425 Ga0436363_0788279
426 Ga0436363_0791800
427 Ga0436363_1087906
428 Ga0436363_1157709
429 Ga0436362_0140242
430 Ga0436362_0194782
431 Ga0436362_0431003
432 Ga0436362_0493858
433 Ga0436362_0637726
434 Ga0436362_0682351
435 Ga0436362_0806667
436 Ga0436362_0999391
437 Ga0439448_0008749
438 Ga0451577_1369553
439 Ga0466966_0162245
440 Ga0466966_0213150
441 Ga0466971_0069622
442 Ga0466957_0537382
443 Ga0466959_0330669
444 Ga0466958_0182741
445 Ga0495629_0321432
446 Ga0495582_0213675
447 Ga0495665_0081612
448 Ga0495674_0560265
449 Ga0496101_0034894
450 Ga0496102_0116682
451 Ga0496103_0099598
452 Ga0496104_0021061
453 Ga0496105_1052208
454 Ga0496106_0122219
455 Ga0496106_0658924
456 Ga0496108_0002161
457 Ga0496109_0003048
458 Ga0496110_0053186
459 Ga0496111_0081088
460 Ga0496112_0004137
461 Ga0496112_0059471
462 Ga0496112_0551582
463 Ga0496113_0001141
464 Ga0496113_0167561
465 Ga0496115_0006054
466 Ga0501032_0412768
467 Ga0501033_0035410
468 Ga0501034_0012262
469 Ga0501037_0067327
470 Ga0501043_0013762
471 Ga0501046_0757522
472 Ga0501047_0050557
473 Ga0501070_0037150
474 Ga0501073_0125339
475 Ga0501074_0051478
476 Ga0501080_0668107
477 Ga0501035_0050916
478 Ga0501044_0055786
479 nmdc:mga05p37_12580_c1
480 nmdc:mga05p37_1458168_c1
481 nmdc:mga05p37_4367_c1
482 nmdc:mga09592_66416_c1
483 nmdc:mga08y16_1105176_c1
484 nmdc:mga0n895_10966_c1
485 nmdc:mga0n895_29189_c1
486 nmdc:mga0rr50_1009730_c1
487 nmdc:mga0rr50_1604451_c1
488 nmdc:mga08x19_407606_c1
489 nmdc:mga0a205_136548_c1
490 nmdc:mga0a205_22289_c1
491 nmdc:mga0a205_55088_c1
492 Ga0495612_0018129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

19

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9565 4 151
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9557 5 150
3s5p-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.9527 3 133
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9514 4 132
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9474 4 147
ID Description Score Start End Superfamily
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9527 3 133 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9515 4 132 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9478 4 150 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9468 4 147 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9437 4 132 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A6L7UTL0-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9686 4 152 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V5NPU5-F1-model_v4 Ribose 5-phosphate isomerase B 0.9679 4 150 GO:0005975
GO:0016861
AF-A0A1H7KTS9-F1-model_v4 Ribose 5-phosphate isomerase B 0.9678 4 151 GO:0005975
GO:0016861
AF-A0A3B1CLF9-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9678 5 151 GO:0004751
GO:0005975
AF-A0A2H6IE98-F1-model_v4 Putative sugar phosphate isomerase YwlF 0.9676 4 151 GO:0005975
GO:0016861

Map