F358127

General Info

Members Datasets Scaffolds Average Seq Length
246 161 492 292

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10041011|Ga0105242_100410113
Length 308
Sequence MLNAQNEKYEMLNVAFLGLGVMGSGMAARLLGAGARVAVWNRSAARAEPLQAKGASVAATPAADVIVAMVADDRASREVWLGADGALAGARRGAIALECGTVSPSWVEELARETAARAVDLLDAPVLGSRPHAHDGQLTFLVGGDAAVLDRARPILAPMSRLVIHLGPIGSGARMKLVNNFLAGTQAAALAEALAMAKAAGLDGDAAFSVLANGAPGSPLVKTVGPRMLARDYDVNFALSLMRKDLTYAIEEAAAHGVTLSIAAAARALYDNAIAAGFADVDFAAVAEPLLATALPERATDKHDKGHR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 1.22
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 11.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10041011 3300009176 Bacteria 3731
2 rootL2_10351549 3300003322 Unclassified 1616
3 rootH1_10202047 3300003323 Bacteria 1395
4 Ga0070658_10029691 3300005327 Bacteria 4393
5 Ga0070676_10086563 3300005328 Unclassified 1911
6 Ga0070683_100021235 3300005329 Bacteria 5792
7 Ga0070683_100188686 3300005329 Bacteria 1957
8 Ga0068869_100009877 3300005334 Bacteria 6198
9 Ga0068869_100022436 3300005334 Bacteria 4350
10 Ga0068869_100031094 3300005334 Bacteria 3754
11 Ga0068869_100077357 3300005334 Bacteria 2475
12 Ga0070680_100078520 3300005336 Unclassified 2720
13 Ga0068868_100039542 3300005338 Bacteria 3665
14 Ga0070689_100023711 3300005340 Bacteria 4598
15 Ga0070687_100016615 3300005343 Bacteria 3362
16 Ga0070661_100015282 3300005344 Bacteria 5418
17 Ga0070692_10181891 3300005345 Bacteria 1219
18 Ga0070675_100178186 3300005354 Bacteria 1837
19 Ga0070671_100006741 3300005355 Bacteria 9189
20 Ga0070674_100344524 3300005356 Bacteria 1202
21 Ga0070673_100001630 3300005364 Bacteria 13281
22 Ga0070659_100017358 3300005366 Bacteria 5414
23 Ga0070659_100018049 3300005366 Bacteria 5321
24 Ga0070714_100025171 3300005435 Bacteria 4909
25 Ga0070701_10026190 3300005438 Bacteria 2841
26 Ga0070711_100043713 3300005439 Bacteria 3036
27 Ga0070700_100151478 3300005441 Bacteria 1587
28 Ga0070694_100104279 3300005444 Bacteria 2011
29 Ga0070678_100338131 3300005456 Bacteria 1291
30 Ga0070681_10057750 3300005458 Bacteria 3861
31 Ga0070685_10012018 3300005466 Bacteria 4539
32 Ga0070685_10071146 3300005466 Unclassified 2061
33 Ga0070698_100161503 3300005471 Unclassified 2184
34 Ga0070679_100047204 3300005530 Bacteria 4293
35 Ga0070684_100078393 3300005535 Bacteria 2919
36 Ga0068853_100008375 3300005539 Bacteria 8303
37 Ga0070672_100046651 3300005543 Bacteria 3358
38 Ga0070686_100052963 3300005544 Bacteria 2589
39 Ga0070686_100229097 3300005544 Bacteria 1347
40 Ga0070693_100055012 3300005547 Bacteria 2291
41 Ga0068855_100021257 3300005563 Bacteria 7779
42 Ga0068855_100030253 3300005563 Bacteria 6477
43 Ga0068855_100086662 3300005563 Bacteria 3621
44 Ga0068855_100178082 3300005563 Bacteria 2405
45 Ga0070664_100354835 3300005564 Unclassified 1335
46 Ga0068854_100074170 3300005578 Unclassified 2495
47 Ga0068856_100135879 3300005614 Bacteria 2464
48 Ga0070702_100086549 3300005615 Unclassified 1890
49 Ga0068852_100109784 3300005616 Bacteria 2505
50 Ga0068859_100005339 3300005617 Bacteria 13075
51 Ga0068859_100140344 3300005617 Bacteria 2490
52 Ga0068859_100246185 3300005617 Bacteria 1877
53 Ga0068863_100044237 3300005841 Bacteria 4227
54 Ga0068863_100069691 3300005841 Bacteria 3325
55 Ga0068863_100078670 3300005841 Bacteria 3123
56 Ga0068858_100002951 3300005842 Bacteria 17096
57 Ga0068860_100083681 3300005843 Bacteria 3035
58 Ga0081455_10366778 3300005937 Bacteria 1011
59 Ga0070716_100060554 3300006173 Unclassified 2187
60 Ga0097621_100649088 3300006237 Bacteria 968
61 Ga0068871_100246642 3300006358 Bacteria 1554
62 Ga0075428_100103864 3300006844 Bacteria 3099
63 Ga0075428_100268854 3300006844 Bacteria 1834
64 Ga0075430_100000657 3300006846 Bacteria 26393
65 Ga0075430_100065475 3300006846 Bacteria 3053
66 Ga0075430_100161366 3300006846 Bacteria 1866
67 Ga0075431_100016874 3300006847 Bacteria 7414
68 Ga0075431_100022855 3300006847 Bacteria 6392
69 Ga0075433_10004452 3300006852 Bacteria 10917
70 Ga0075434_100685879 3300006871 Bacteria 1042
71 Ga0075429_100000158 3300006880 Bacteria 42731
72 Ga0075429_100013117 3300006880 Bacteria 7189
73 Ga0075429_100026898 3300006880 Bacteria 4994
74 Ga0075429_100140713 3300006880 Unclassified 2112
75 Ga0075429_100251539 3300006880 Bacteria 1547
76 Ga0068865_100016734 3300006881 Bacteria 4699
77 Ga0068865_100119540 3300006881 Bacteria 1957
78 Ga0097620_100005338 3300006931 Bacteria 13075
79 Ga0097620_100140350 3300006931 Bacteria 2490
80 Ga0097620_100246179 3300006931 Bacteria 1877
81 Ga0075435_100007818 3300007076 Bacteria 7648
82 Ga0105240_10075278 3300009093 Bacteria 4164
83 Ga0105240_10107750 3300009093 Bacteria 3377
84 Ga0105240_10232323 3300009093 Bacteria 2143
85 Ga0105240_10495180 3300009093 Bacteria 1360
86 Ga0111539_10000174 3300009094 Bacteria 74442
87 Ga0111539_10001417 3300009094 Bacteria 31957
88 Ga0111539_10055596 3300009094 Bacteria 4705
89 Ga0114129_10007613 3300009147 Bacteria 15412
90 Ga0114129_10008731 3300009147 Bacteria 14448
91 Ga0114129_10078420 3300009147 Bacteria 4594
92 Ga0114129_10092631 3300009147 Bacteria 4187
93 Ga0114129_10297247 3300009147 Unclassified 2153
94 Ga0105243_10132988 3300009148 Bacteria 2113
95 Ga0105243_10173873 3300009148 Unclassified 1868
96 Ga0105242_10007622 3300009176 Bacteria 8331
97 Ga0105248_10071242 3300009177 Bacteria 3904
98 Ga0105248_10346316 3300009177 Unclassified 1673
99 Ga0105237_10208084 3300009545 Bacteria 1956
100 Ga0105238_10055276 3300009551 Bacteria 3985
101 Ga0105239_10012674 3300010375 Bacteria 9380
102 Ga0105239_10265992 3300010375 Bacteria 1928
103 Ga0157369_10015932 3300013105 Bacteria 8464
104 Ga0157369_10420326 3300013105 Bacteria 1386
105 Ga0157374_10030262 3300013296 Bacteria 4912
106 Ga0157378_10037848 3300013297 Bacteria 4275
107 Ga0157378_10440203 3300013297 Bacteria 1292
108 Ga0163162_10001981 3300013306 Bacteria 19234
109 Ga0163162_10663633 3300013306 Bacteria 1166
110 Ga0157372_10084029 3300013307 Bacteria 3607
111 Ga0157372_10216840 3300013307 Bacteria 2218
112 Ga0157372_10251717 3300013307 Bacteria 2051
113 Ga0157372_11033253 3300013307 Unclassified 951
114 Ga0163163_10000034 3300014325 Bacteria 161820
115 Ga0157379_10221188 3300014968 Bacteria 1716
116 Ga0157376_10164851 3300014969 Bacteria 2012
117 Ga0207688_10191464 3300025901 Bacteria 1223
118 Ga0207647_10026076 3300025904 Bacteria 3827
119 Ga0207647_10049819 3300025904 Bacteria 2596
120 Ga0207645_10032834 3300025907 Bacteria 3337
121 Ga0207705_10023515 3300025909 Bacteria 4395
122 Ga0207707_10194483 3300025912 Unclassified 1769
123 Ga0207695_10335712 3300025913 Unclassified 1399
124 Ga0207663_10035240 3300025916 Bacteria 3000
125 Ga0207662_10013007 3300025918 Bacteria 4648
126 Ga0207649_10015071 3300025920 Bacteria 4341
127 Ga0207652_10055607 3300025921 Bacteria 3405
128 Ga0207652_10107796 3300025921 Bacteria 2468
129 Ga0207694_10012839 3300025924 Bacteria 6308
130 Ga0207694_10017121 3300025924 Bacteria 5476
131 Ga0207659_10147914 3300025926 Bacteria 1831
132 Ga0207664_10093587 3300025929 Bacteria 2468
133 Ga0207644_10080952 3300025931 Bacteria 2399
134 Ga0207690_10014310 3300025932 Bacteria 4791
135 Ga0207686_10012487 3300025934 Unclassified 4669
136 Ga0207709_10101570 3300025935 Bacteria 1902
137 Ga0207704_10020522 3300025938 Bacteria 3498
138 Ga0207665_10345835 3300025939 Bacteria 1122
139 Ga0207691_10011910 3300025940 Bacteria 8345
140 Ga0207711_10109709 3300025941 Bacteria 2453
141 Ga0207711_10210597 3300025941 Unclassified 1775
142 Ga0207689_10001606 3300025942 Bacteria 21385
143 Ga0207689_10037071 3300025942 Bacteria 4046
144 Ga0207689_10038234 3300025942 Bacteria 3976
145 Ga0207661_10057318 3300025944 Bacteria 3132
146 Ga0207679_10378152 3300025945 Bacteria 1241
147 Ga0207667_10045259 3300025949 Bacteria 4662
148 Ga0207667_10060492 3300025949 Unclassified 3964
149 Ga0207651_10212108 3300025960 Bacteria 1559
150 Ga0207712_10343282 3300025961 Unclassified 1239
151 Ga0207640_10054616 3300025981 Bacteria 2612
152 Ga0207703_10009972 3300026035 Bacteria 7451
153 Ga0207703_10157963 3300026035 Bacteria 1983
154 Ga0207639_10017561 3300026041 Bacteria 5074
155 Ga0207639_10484461 3300026041 Bacteria 1128
156 Ga0207708_10012422 3300026075 Bacteria 6349
157 Ga0207641_10041831 3300026088 Bacteria 3842
158 Ga0207641_10070145 3300026088 Bacteria 3011
159 Ga0207641_10196459 3300026088 Bacteria 1857
160 Ga0207648_10002241 3300026089 Bacteria 20937
161 Ga0207648_10142484 3300026089 Unclassified 2113
162 Ga0207648_10402860 3300026089 Bacteria 1240
163 Ga0207674_10288425 3300026116 Bacteria 1590
164 Ga0207675_100144871 3300026118 Bacteria 2258
165 Ga0207683_10072336 3300026121 Bacteria 3049
166 Ga0207428_10001299 3300027907 Bacteria 26621
167 Ga0207428_10032938 3300027907 Bacteria 4260
168 Ga0265337_1001683 3300028556 Bacteria 10731
169 Ga0265337_1006294 3300028556 Bacteria 4600
170 Ga0265319_1016918 3300028563 Bacteria 2787
171 Ga0265334_10021528 3300028573 Bacteria 2633
172 Ga0265336_10010591 3300028666 Bacteria 3157
173 Ga0307515_10049743 3300028794 Bacteria 6296
174 Ga0265338_10003616 3300028800 Bacteria 21554
175 Ga0265338_10029368 3300028800 Bacteria 5451
176 Ga0265338_10117823 3300028800 Bacteria 2124
177 Ga0265338_10130483 3300028800 Bacteria 1986
178 Ga0265338_10245637 3300028800 Bacteria 1323
179 Ga0265324_10019208 3300029957 Unclassified 2463
180 Ga0265320_10000134 3300031240 Bacteria 63576
181 Ga0265320_10002229 3300031240 Bacteria 13594
182 Ga0265320_10002937 3300031240 Bacteria 11683
183 Ga0265331_10017348 3300031250 Bacteria 3758
184 Ga0265316_10089164 3300031344 Bacteria 2354
185 Ga0307408_100008352 3300031548 Bacteria 6838
186 Ga0307408_100094568 3300031548 Bacteria 2263
187 Ga0307408_100265633 3300031548 Bacteria 1422
188 Ga0307405_10033291 3300031731 Bacteria 3055
189 Ga0307405_10053980 3300031731 Bacteria 2506
190 Ga0307407_10394435 3300031903 Unclassified 991
191 Ga0307409_100499322 3300031995 Bacteria 1184
192 Ga0307416_100033614 3300032002 Bacteria 3890
193 Ga0307416_100149794 3300032002 Bacteria 2138
194 Ga0307416_100645766 3300032002 Bacteria 1142
195 Ga0307411_10325213 3300032005 Unclassified 1243
196 Ga0307415_100254594 3300032126 Unclassified 1429
197 Ga0373952_0031743 3300035092 Bacteria 1176
198 Ga0373947_0173014 3300035725 Unclassified 1402
199 Ga0436364_1132422 3300037853 Bacteria 4993
200 Ga0439464_0011290 3300042439 Bacteria 2365
201 Ga0466963_0106119 3300044694 Bacteria 1926
202 Ga0451576_0096990 3300045051 Bacteria 3066
203 Ga0495638_0000048 3300046460 Bacteria 209787
204 Ga0495638_0015062 3300046460 Bacteria 5204
205 Ga0495580_0331377 3300046472 Bacteria 1034
206 Ga0495622_0019737 3300046557 Bacteria 3138
207 Ga0495625_0000315 3300046660 Bacteria 73951
208 Ga0495658_0161452 3300046683 Bacteria 1382
209 Ga0495686_0015595 3300047472 Bacteria 5182
210 Ga0496102_0505520 3300048905 Bacteria 1131
211 Ga0496110_0159389 3300048913 Bacteria 2045
212 Ga0496112_0001428 3300048915 Bacteria 18307
213 Ga0501033_0003561 3300049570 Bacteria 12735
214 Ga0501034_0129373 3300049571 Bacteria 2508
215 Ga0501037_0019522 3300049573 Bacteria 5000
216 Ga0501040_0131225 3300049576 Bacteria 1762
217 Ga0501043_0384365 3300049579 Bacteria 1062
218 Ga0501046_0003292 3300049580 Bacteria 14841
219 Ga0501047_0005823 3300049581 Bacteria 11601
220 Ga0501047_0272819 3300049581 Bacteria 1537
221 Ga0501070_0223333 3300049586 Bacteria 1544
222 Ga0501233_041911 3300049668 Unclassified 1079
223 Ga0501080_0007661 3300049742 Bacteria 9764
224 Ga0501035_0007482 3300049822 Bacteria 10202
225 Ga0501044_0000704 3300049823 Bacteria 40368
226 Ga0501044_0065529 3300049823 Bacteria 3704
227 Ga0501044_0181244 3300049823 Bacteria 2073
228 nmdc:mga05p37_218312_c1 3300050507 Bacteria 2302
229 nmdc:mga05p37_2875_c1 3300050507 Bacteria 19989
230 nmdc:mga05p37_292904_c1 3300050507 Bacteria 1937
231 nmdc:mga05p37_376046_c1 3300050507 Unclassified 1666
232 nmdc:mga09592_1343_c2 3300050508 Bacteria 11749
233 nmdc:mga09592_2062_c1 3300050508 Bacteria 16200
234 nmdc:mga09592_689771_c1 3300050508 Bacteria 870
235 nmdc:mga09592_97993_c1 3300050508 Bacteria 2509
236 nmdc:mga0qj67_15463_c1 3300050509 Bacteria 5778
237 nmdc:mga0qj67_208294_c1 3300050509 Bacteria 1588
238 nmdc:mga0qj67_45305_c1 3300050509 Bacteria 3471
239 nmdc:mga06r32_15816_c1 3300050510 Bacteria 6862
240 nmdc:mga06r32_24642_c1 3300050510 Bacteria 5588
241 nmdc:mga06r32_294368_c1 3300050510 Bacteria 1610
242 nmdc:mga08y16_3256_c1 3300050511 Bacteria 16807
243 nmdc:mga08y16_35051_c1 3300050511 Bacteria 5272
244 nmdc:mga0a205_11425_c1 3300050515 Bacteria 8174
245 Ga0495619_0397916 3300053085 Unclassified 951
246 Ga0500658_0001795 3300053134 Bacteria 8476
247 Ga0105242_10041011
248 rootL2_10351549
249 rootH1_10202047
250 Ga0070658_10029691
251 Ga0070676_10086563
252 Ga0070683_100021235
253 Ga0070683_100188686
254 Ga0068869_100009877
255 Ga0068869_100022436
256 Ga0068869_100031094
257 Ga0068869_100077357
258 Ga0070680_100078520
259 Ga0068868_100039542
260 Ga0070689_100023711
261 Ga0070687_100016615
262 Ga0070661_100015282
263 Ga0070692_10181891
264 Ga0070675_100178186
265 Ga0070671_100006741
266 Ga0070674_100344524
267 Ga0070673_100001630
268 Ga0070659_100017358
269 Ga0070659_100018049
270 Ga0070714_100025171
271 Ga0070701_10026190
272 Ga0070711_100043713
273 Ga0070700_100151478
274 Ga0070694_100104279
275 Ga0070678_100338131
276 Ga0070681_10057750
277 Ga0070685_10012018
278 Ga0070685_10071146
279 Ga0070698_100161503
280 Ga0070679_100047204
281 Ga0070684_100078393
282 Ga0068853_100008375
283 Ga0070672_100046651
284 Ga0070686_100052963
285 Ga0070686_100229097
286 Ga0070693_100055012
287 Ga0068855_100021257
288 Ga0068855_100030253
289 Ga0068855_100086662
290 Ga0068855_100178082
291 Ga0070664_100354835
292 Ga0068854_100074170
293 Ga0068856_100135879
294 Ga0070702_100086549
295 Ga0068852_100109784
296 Ga0068859_100005339
297 Ga0068859_100140344
298 Ga0068859_100246185
299 Ga0068863_100044237
300 Ga0068863_100069691
301 Ga0068863_100078670
302 Ga0068858_100002951
303 Ga0068860_100083681
304 Ga0081455_10366778
305 Ga0070716_100060554
306 Ga0097621_100649088
307 Ga0068871_100246642
308 Ga0075428_100103864
309 Ga0075428_100268854
310 Ga0075430_100000657
311 Ga0075430_100065475
312 Ga0075430_100161366
313 Ga0075431_100016874
314 Ga0075431_100022855
315 Ga0075433_10004452
316 Ga0075434_100685879
317 Ga0075429_100000158
318 Ga0075429_100013117
319 Ga0075429_100026898
320 Ga0075429_100140713
321 Ga0075429_100251539
322 Ga0068865_100016734
323 Ga0068865_100119540
324 Ga0097620_100005338
325 Ga0097620_100140350
326 Ga0097620_100246179
327 Ga0075435_100007818
328 Ga0105240_10075278
329 Ga0105240_10107750
330 Ga0105240_10232323
331 Ga0105240_10495180
332 Ga0111539_10000174
333 Ga0111539_10001417
334 Ga0111539_10055596
335 Ga0114129_10007613
336 Ga0114129_10008731
337 Ga0114129_10078420
338 Ga0114129_10092631
339 Ga0114129_10297247
340 Ga0105243_10132988
341 Ga0105243_10173873
342 Ga0105242_10007622
343 Ga0105248_10071242
344 Ga0105248_10346316
345 Ga0105237_10208084
346 Ga0105238_10055276
347 Ga0105239_10012674
348 Ga0105239_10265992
349 Ga0157369_10015932
350 Ga0157369_10420326
351 Ga0157374_10030262
352 Ga0157378_10037848
353 Ga0157378_10440203
354 Ga0163162_10001981
355 Ga0163162_10663633
356 Ga0157372_10084029
357 Ga0157372_10216840
358 Ga0157372_10251717
359 Ga0157372_11033253
360 Ga0163163_10000034
361 Ga0157379_10221188
362 Ga0157376_10164851
363 Ga0207688_10191464
364 Ga0207647_10026076
365 Ga0207647_10049819
366 Ga0207645_10032834
367 Ga0207705_10023515
368 Ga0207707_10194483
369 Ga0207695_10335712
370 Ga0207663_10035240
371 Ga0207662_10013007
372 Ga0207649_10015071
373 Ga0207652_10055607
374 Ga0207652_10107796
375 Ga0207694_10012839
376 Ga0207694_10017121
377 Ga0207659_10147914
378 Ga0207664_10093587
379 Ga0207644_10080952
380 Ga0207690_10014310
381 Ga0207686_10012487
382 Ga0207709_10101570
383 Ga0207704_10020522
384 Ga0207665_10345835
385 Ga0207691_10011910
386 Ga0207711_10109709
387 Ga0207711_10210597
388 Ga0207689_10001606
389 Ga0207689_10037071
390 Ga0207689_10038234
391 Ga0207661_10057318
392 Ga0207679_10378152
393 Ga0207667_10045259
394 Ga0207667_10060492
395 Ga0207651_10212108
396 Ga0207712_10343282
397 Ga0207640_10054616
398 Ga0207703_10009972
399 Ga0207703_10157963
400 Ga0207639_10017561
401 Ga0207639_10484461
402 Ga0207708_10012422
403 Ga0207641_10041831
404 Ga0207641_10070145
405 Ga0207641_10196459
406 Ga0207648_10002241
407 Ga0207648_10142484
408 Ga0207648_10402860
409 Ga0207674_10288425
410 Ga0207675_100144871
411 Ga0207683_10072336
412 Ga0207428_10001299
413 Ga0207428_10032938
414 Ga0265337_1001683
415 Ga0265337_1006294
416 Ga0265319_1016918
417 Ga0265334_10021528
418 Ga0265336_10010591
419 Ga0307515_10049743
420 Ga0265338_10003616
421 Ga0265338_10029368
422 Ga0265338_10117823
423 Ga0265338_10130483
424 Ga0265338_10245637
425 Ga0265324_10019208
426 Ga0265320_10000134
427 Ga0265320_10002229
428 Ga0265320_10002937
429 Ga0265331_10017348
430 Ga0265316_10089164
431 Ga0307408_100008352
432 Ga0307408_100094568
433 Ga0307408_100265633
434 Ga0307405_10033291
435 Ga0307405_10053980
436 Ga0307407_10394435
437 Ga0307409_100499322
438 Ga0307416_100033614
439 Ga0307416_100149794
440 Ga0307416_100645766
441 Ga0307411_10325213
442 Ga0307415_100254594
443 Ga0373952_0031743
444 Ga0373947_0173014
445 Ga0436364_1132422
446 Ga0439464_0011290
447 Ga0466963_0106119
448 Ga0451576_0096990
449 Ga0495638_0000048
450 Ga0495638_0015062
451 Ga0495580_0331377
452 Ga0495622_0019737
453 Ga0495625_0000315
454 Ga0495658_0161452
455 Ga0495686_0015595
456 Ga0496102_0505520
457 Ga0496110_0159389
458 Ga0496112_0001428
459 Ga0501033_0003561
460 Ga0501034_0129373
461 Ga0501037_0019522
462 Ga0501040_0131225
463 Ga0501043_0384365
464 Ga0501046_0003292
465 Ga0501047_0005823
466 Ga0501047_0272819
467 Ga0501070_0223333
468 Ga0501233_041911
469 Ga0501080_0007661
470 Ga0501035_0007482
471 Ga0501044_0000704
472 Ga0501044_0065529
473 Ga0501044_0181244
474 nmdc:mga05p37_218312_c1
475 nmdc:mga05p37_2875_c1
476 nmdc:mga05p37_292904_c1
477 nmdc:mga05p37_376046_c1
478 nmdc:mga09592_1343_c2
479 nmdc:mga09592_2062_c1
480 nmdc:mga09592_689771_c1
481 nmdc:mga09592_97993_c1
482 nmdc:mga0qj67_15463_c1
483 nmdc:mga0qj67_208294_c1
484 nmdc:mga0qj67_45305_c1
485 nmdc:mga06r32_15816_c1
486 nmdc:mga06r32_24642_c1
487 nmdc:mga06r32_294368_c1
488 nmdc:mga08y16_3256_c1
489 nmdc:mga08y16_35051_c1
490 nmdc:mga0a205_11425_c1
491 Ga0495619_0397916
492 Ga0500658_0001795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

13

167

0.98

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

170

290

0.98

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

14

79

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

13

73

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9638 2 286
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9635 2 286
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9632 2 32
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.962 2 32
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.959 2 34
ID Description Score Start End Superfamily
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9835 2 164 3.40.50.720
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9787 2 163 3.40.50.720
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9755 2 161 3.40.50.720
af_F4IAP5_318_484_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9725 3 162 3.40.50.720
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.971 5 163 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0E4FY61-F1-model_v4 Putative oxidoreductase 0.9888 2 114 GO:0016491
GO:0050661
AF-A0A6I1IXN9-F1-model_v4 deleted 0.9882 32 176
AF-A0A2V7HW24-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9879 3 122 GO:0016616
GO:0050661
AF-A0A7C4VLM6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9866 1 287 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A2D6XVF3-F1-model_v4 deleted 0.9849 3 114

Map