F357953

General Info

Members Datasets Scaffolds Average Seq Length
246 126 492 119

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100989169|Ga0070659_1009891691
Length 126
Sequence VSFVTRAAFGAALAVAGVTALAQTSPAIMAARQAGIVGERYDGYLGYSASPGERVSREVGAVNIKRRSLYTGLATRRSATVQEVGIAAGCELLAEVRAGESYMLSDGVWRRRAAGQPAPVPSYCGH

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
126 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.44
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100989169 3300005366 Bacteria 738
2 Ga0065712_10250414 3300005290 Bacteria 961
3 Ga0065712_10269980 3300005290 Bacteria 892
4 Ga0070658_10000927 3300005327 Bacteria 25076
5 Ga0070676_10035477 3300005328 Bacteria 2869
6 Ga0070676_10224342 3300005328 Bacteria 1243
7 Ga0070683_100655524 3300005329 Bacteria 1005
8 Ga0070670_100002586 3300005331 Bacteria 14960
9 Ga0070670_100090474 3300005331 Bacteria 2630
10 Ga0070670_100748136 3300005331 Bacteria 881
11 Ga0068869_100075541 3300005334 Bacteria 2504
12 Ga0070680_100001538 3300005336 Bacteria 16820
13 Ga0070682_100056000 3300005337 Bacteria 2478
14 Ga0070682_100520252 3300005337 Unclassified 925
15 Ga0070660_100000184 3300005339 Bacteria 41526
16 Ga0070660_100013225 3300005339 Bacteria 5914
17 Ga0070660_100035683 3300005339 Bacteria 3764
18 Ga0070660_101815523 3300005339 Bacteria 519
19 Ga0070661_100002208 3300005344 Bacteria 13380
20 Ga0070661_100009640 3300005344 Bacteria 6693
21 Ga0070661_100056313 3300005344 Unclassified 2880
22 Ga0070661_100131522 3300005344 Bacteria 1880
23 Ga0070661_100296444 3300005344 Bacteria 1258
24 Ga0070668_100223427 3300005347 Bacteria 1554
25 Ga0070669_100049965 3300005353 Bacteria 3054
26 Ga0070669_100091495 3300005353 Bacteria 2281
27 Ga0070669_100173691 3300005353 Bacteria 1681
28 Ga0070669_100350528 3300005353 Bacteria 1198
29 Ga0070675_100003412 3300005354 Bacteria 12030
30 Ga0070675_100417691 3300005354 Bacteria 1199
31 Ga0070671_100026108 3300005355 Bacteria 4798
32 Ga0070671_100380928 3300005355 Bacteria 1206
33 Ga0070674_101498728 3300005356 Bacteria 606
34 Ga0070673_100049806 3300005364 Bacteria 3272
35 Ga0070659_100080529 3300005366 Bacteria 2600
36 Ga0070659_100153695 3300005366 Bacteria 1878
37 Ga0070659_100244244 3300005366 Bacteria 1487
38 Ga0070667_100028670 3300005367 Bacteria 4636
39 Ga0070667_100746722 3300005367 Bacteria 907
40 Ga0070714_100006333 3300005435 Bacteria 9125
41 Ga0070705_100330583 3300005440 Bacteria 1104
42 Ga0070663_100005406 3300005455 Bacteria 7588
43 Ga0070663_100030392 3300005455 Bacteria 3701
44 Ga0070663_100030787 3300005455 Bacteria 3682
45 Ga0070678_100116819 3300005456 Bacteria 2097
46 Ga0070662_100019292 3300005457 Bacteria 4629
47 Ga0070681_10189912 3300005458 Bacteria 1974
48 Ga0070679_100117216 3300005530 Bacteria 2648
49 Ga0070679_100318890 3300005530 Bacteria 1503
50 Ga0068853_100382216 3300005539 Bacteria 1315
51 Ga0070672_100015783 3300005543 Bacteria 5392
52 Ga0070696_100222395 3300005546 Bacteria 1417
53 Ga0070693_100076739 3300005547 Bacteria 1981
54 Ga0070693_100118954 3300005547 Bacteria 1636
55 Ga0070665_100081754 3300005548 Bacteria 3236
56 Ga0068855_100000907 3300005563 Bacteria 36754
57 Ga0070664_100003923 3300005564 Bacteria 12001
58 Ga0070664_100016043 3300005564 Bacteria 6137
59 Ga0070664_100214672 3300005564 Bacteria 1720
60 Ga0068857_100057750 3300005577 Bacteria 3444
61 Ga0068854_100765699 3300005578 Bacteria 839
62 Ga0068856_100758017 3300005614 Bacteria 991
63 Ga0068852_100285799 3300005616 Bacteria 1591
64 Ga0068852_100984474 3300005616 Bacteria 862
65 Ga0068859_100162511 3300005617 Bacteria 2312
66 Ga0068859_100716172 3300005617 Bacteria 1091
67 Ga0068864_100021540 3300005618 Bacteria 5400
68 Ga0068864_100314354 3300005618 Bacteria 1469
69 Ga0068861_100199716 3300005719 Bacteria 1678
70 Ga0068863_100014665 3300005841 Bacteria 7544
71 Ga0068858_100020526 3300005842 Bacteria 6174
72 Ga0068858_100589575 3300005842 Bacteria 1078
73 Ga0068860_100701879 3300005843 Unclassified 1021
74 Ga0068862_100093340 3300005844 Bacteria 2624
75 Ga0075434_101349185 3300006871 Bacteria 723
76 Ga0097620_100162519 3300006931 Bacteria 2312
77 Ga0097620_100716103 3300006931 Bacteria 1091
78 Ga0105243_10161300 3300009148 Bacteria 1933
79 Ga0105248_10003027 3300009177 Bacteria 18646
80 Ga0105248_10982318 3300009177 Bacteria 954
81 Ga0105249_10121432 3300009553 Bacteria 2483
82 Ga0157373_11101592 3300013100 Unclassified 596
83 Ga0157371_10000705 3300013102 Bacteria 39219
84 Ga0157371_10208580 3300013102 Bacteria 1402
85 Ga0157371_10677270 3300013102 Bacteria 771
86 Ga0157370_10111211 3300013104 Bacteria 2561
87 Ga0157370_10311052 3300013104 Bacteria 1454
88 Ga0157370_10350840 3300013104 Bacteria 1360
89 Ga0157370_10760162 3300013104 Bacteria 883
90 Ga0157369_10590332 3300013105 Bacteria 1147
91 Ga0163162_11245342 3300013306 Bacteria 845
92 Ga0157375_11735967 3300013308 Bacteria 739
93 Ga0163163_10274780 3300014325 Bacteria 1736
94 Ga0207705_10000050 3300025909 Bacteria 170078
95 Ga0207705_10022168 3300025909 Bacteria 4531
96 Ga0207705_10105612 3300025909 Bacteria 2076
97 Ga0207654_10119268 3300025911 Bacteria 1654
98 Ga0207707_10147117 3300025912 Bacteria 2060
99 Ga0207662_10033903 3300025918 Bacteria 2979
100 Ga0207657_10000301 3300025919 Bacteria 52361
101 Ga0207657_10002433 3300025919 Bacteria 20101
102 Ga0207657_10124619 3300025919 Bacteria 2117
103 Ga0207657_10159436 3300025919 Bacteria 1833
104 Ga0207649_10005618 3300025920 Bacteria 6783
105 Ga0207649_10052300 3300025920 Bacteria 2534
106 Ga0207649_10075368 3300025920 Bacteria 2168
107 Ga0207649_10262693 3300025920 Bacteria 1248
108 Ga0207652_10045902 3300025921 Bacteria 3726
109 Ga0207652_10681304 3300025921 Bacteria 918
110 Ga0207681_10034648 3300025923 Bacteria 3321
111 Ga0207681_10121231 3300025923 Bacteria 1918
112 Ga0207681_10237240 3300025923 Bacteria 1418
113 Ga0207681_10930634 3300025923 Unclassified 728
114 Ga0207650_10060073 3300025925 Bacteria 2836
115 Ga0207650_11029945 3300025925 Unclassified 700
116 Ga0207659_10009896 3300025926 Bacteria 5966
117 Ga0207659_10451633 3300025926 Bacteria 1083
118 Ga0207644_10019571 3300025931 Bacteria 4593
119 Ga0207644_10920117 3300025931 Bacteria 733
120 Ga0207690_10011841 3300025932 Bacteria 5216
121 Ga0207690_10069444 3300025932 Bacteria 2424
122 Ga0207690_10191096 3300025932 Bacteria 1549
123 Ga0207706_10027837 3300025933 Bacteria 5052
124 Ga0207709_10290075 3300025935 Bacteria 1212
125 Ga0207669_11404538 3300025937 Bacteria 594
126 Ga0207691_10016307 3300025940 Bacteria 7054
127 Ga0207711_10011253 3300025941 Bacteria 7434
128 Ga0207711_11009328 3300025941 Bacteria 772
129 Ga0207689_10073436 3300025942 Bacteria 2810
130 Ga0207661_10551461 3300025944 Bacteria 1056
131 Ga0207661_11718017 3300025944 Bacteria 573
132 Ga0207679_10004997 3300025945 Bacteria 8281
133 Ga0207679_10081752 3300025945 Bacteria 2471
134 Ga0207667_10000327 3300025949 Bacteria 66205
135 Ga0207667_11116312 3300025949 Bacteria 771
136 Ga0207651_10004463 3300025960 Bacteria 7058
137 Ga0207651_10500644 3300025960 Bacteria 1050
138 Ga0207712_11218895 3300025961 Bacteria 672
139 Ga0207668_10270889 3300025972 Bacteria 1388
140 Ga0207668_10620106 3300025972 Bacteria 944
141 Ga0207668_11177705 3300025972 Bacteria 688
142 Ga0207658_10024663 3300025986 Bacteria 4209
143 Ga0207703_10163523 3300026035 Bacteria 1951
144 Ga0207703_11420708 3300026035 Bacteria 667
145 Ga0207678_10002367 3300026067 Bacteria 17102
146 Ga0207678_10148222 3300026067 Bacteria 2003
147 Ga0207702_11136581 3300026078 Bacteria 775
148 Ga0207676_10049564 3300026095 Bacteria 3268
149 Ga0207676_10682618 3300026095 Bacteria 993
150 Ga0207674_10005415 3300026116 Bacteria 15173
151 Ga0207675_100628643 3300026118 Bacteria 1079
152 Ga0207683_10339808 3300026121 Bacteria 1377
153 Ga0207698_10341780 3300026142 Bacteria 1410
154 Ga0268266_10056464 3300028379 Bacteria 3378
155 Ga0268265_10058445 3300028380 Bacteria 2944
156 Ga0268265_10787316 3300028380 Unclassified 926
157 Ga0307408_100075149 3300031548 Bacteria 2510
158 Ga0307408_100104777 3300031548 Bacteria 2161
159 Ga0307408_102249116 3300031548 Unclassified 527
160 Ga0307405_10065226 3300031731 Bacteria 2317
161 Ga0307405_10129881 3300031731 Bacteria 1739
162 Ga0307405_10299528 3300031731 Bacteria 1219
163 Ga0307405_10327810 3300031731 Bacteria 1172
164 Ga0307413_10008367 3300031824 Bacteria 4880
165 Ga0307413_10214573 3300031824 Bacteria 1400
166 Ga0307413_10296824 3300031824 Bacteria 1223
167 Ga0307410_10055786 3300031852 Bacteria 2683
168 Ga0307410_11150081 3300031852 Bacteria 674
169 Ga0307406_10018474 3300031901 Bacteria 4075
170 Ga0307406_11577209 3300031901 Bacteria 579
171 Ga0307407_10088709 3300031903 Bacteria 1890
172 Ga0307407_10264455 3300031903 Bacteria 1184
173 Ga0307407_11025777 3300031903 Bacteria 638
174 Ga0307407_11196715 3300031903 Bacteria 593
175 Ga0307412_10017333 3300031911 Bacteria 4310
176 Ga0307412_10045245 3300031911 Bacteria 2876
177 Ga0307412_10049151 3300031911 Bacteria 2778
178 Ga0307412_11354175 3300031911 Bacteria 642
179 Ga0307409_100006447 3300031995 Bacteria 6896
180 Ga0307409_100168581 3300031995 Bacteria 1924
181 Ga0307409_100188014 3300031995 Bacteria 1835
182 Ga0307409_100360903 3300031995 Bacteria 1374
183 Ga0307409_101205102 3300031995 Bacteria 780
184 Ga0307416_100050318 3300032002 Bacteria 3320
185 Ga0307416_100341550 3300032002 Bacteria 1510
186 Ga0307416_100730866 3300032002 Bacteria 1081
187 Ga0307416_101105779 3300032002 Bacteria 897
188 Ga0307414_10041141 3300032004 Bacteria 3127
189 Ga0307414_10358715 3300032004 Bacteria 1253
190 Ga0307414_10679108 3300032004 Bacteria 931
191 Ga0307414_11135099 3300032004 Bacteria 722
192 Ga0307414_11705784 3300032004 Bacteria 587
193 Ga0307411_10015120 3300032005 Bacteria 4322
194 Ga0307411_10149507 3300032005 Bacteria 1733
195 Ga0307411_10647342 3300032005 Bacteria 914
196 Ga0307415_100053200 3300032126 Bacteria 2757
197 Ga0307415_100059656 3300032126 Bacteria 2632
198 Ga0307415_100076596 3300032126 Bacteria 2372
199 Ga0307415_101479916 3300032126 Bacteria 649
200 Ga0373932_0369344 3300035112 Unclassified 549
201 Ga0395899_0005982 3300037312 Bacteria 9447
202 Ga0395899_0016719 3300037312 Bacteria 5592
203 Ga0395899_0089844 3300037312 Bacteria 2228
204 Ga0395899_0994660 3300037312 Unclassified 506
205 Ga0395900_0154585 3300037418 Bacteria 2343
206 Ga0395900_0190173 3300037418 Bacteria 2082
207 Ga0395900_0217101 3300037418 Bacteria 1929
208 Ga0395900_0353400 3300037418 Bacteria 1443
209 Ga0395900_0748435 3300037418 Bacteria 908
210 Ga0395898_0089702 3300037466 Bacteria 2959
211 Ga0395898_1073391 3300037466 Bacteria 739
212 Ga0395905_0009843 3300037471 Bacteria 9318
213 Ga0395905_0171299 3300037471 Bacteria 2039
214 Ga0395905_0276049 3300037471 Bacteria 1566
215 Ga0395905_0340328 3300037471 Bacteria 1391
216 Ga0395905_1615275 3300037471 Bacteria 553
217 Ga0395901_0254086 3300038443 Bacteria 1830
218 Ga0395901_0356774 3300038443 Bacteria 1508
219 Ga0395901_0449364 3300038443 Bacteria 1318
220 Ga0395901_0948819 3300038443 Bacteria 839
221 Ga0450916_075903 3300042530 Unclassified 567
222 Ga0466963_0043952 3300044694 Bacteria 2939
223 Ga0495663_0030415 3300046525 Bacteria 1600
224 Ga0495598_0000161 3300046537 Bacteria 11501
225 Ga0495621_0001303 3300046539 Bacteria 6442
226 Ga0495621_0033085 3300046539 Bacteria 1781
227 Ga0495668_0036609 3300046616 Bacteria 2749
228 Ga0495668_0198935 3300046616 Unclassified 1097
229 Ga0495669_0001331 3300046684 Bacteria 10219
230 Ga0495669_0010801 3300046684 Bacteria 3864
231 Ga0495669_0023919 3300046684 Bacteria 2661
232 Ga0495669_0074323 3300046684 Bacteria 1554
233 Ga0495669_0126167 3300046684 Bacteria 1202
234 Ga0495669_0243971 3300046684 Bacteria 862
235 Ga0495670_0004815 3300046691 Bacteria 6628
236 Ga0495683_0348795 3300047323 Unclassified 625
237 Ga0495677_0047158 3300047445 Bacteria 1582
238 Ga0495685_158225 3300047447 Bacteria 734
239 Ga0496107_1013564 3300048910 Unclassified 602
240 Ga0496109_0035100 3300048912 Bacteria 4521
241 Ga0496109_1262239 3300048912 Bacteria 675
242 Ga0496110_0005559 3300048913 Bacteria 9893
243 Ga0496111_0009177 3300048914 Bacteria 6585
244 Ga0496113_0559427 3300048916 Bacteria 917
245 Ga0501242_020036 3300049674 Bacteria 858
246 Ga0501221_218113 3300049704 Bacteria 537
247 Ga0070659_100989169
248 Ga0065712_10250414
249 Ga0065712_10269980
250 Ga0070658_10000927
251 Ga0070676_10035477
252 Ga0070676_10224342
253 Ga0070683_100655524
254 Ga0070670_100002586
255 Ga0070670_100090474
256 Ga0070670_100748136
257 Ga0068869_100075541
258 Ga0070680_100001538
259 Ga0070682_100056000
260 Ga0070682_100520252
261 Ga0070660_100000184
262 Ga0070660_100013225
263 Ga0070660_100035683
264 Ga0070660_101815523
265 Ga0070661_100002208
266 Ga0070661_100009640
267 Ga0070661_100056313
268 Ga0070661_100131522
269 Ga0070661_100296444
270 Ga0070668_100223427
271 Ga0070669_100049965
272 Ga0070669_100091495
273 Ga0070669_100173691
274 Ga0070669_100350528
275 Ga0070675_100003412
276 Ga0070675_100417691
277 Ga0070671_100026108
278 Ga0070671_100380928
279 Ga0070674_101498728
280 Ga0070673_100049806
281 Ga0070659_100080529
282 Ga0070659_100153695
283 Ga0070659_100244244
284 Ga0070667_100028670
285 Ga0070667_100746722
286 Ga0070714_100006333
287 Ga0070705_100330583
288 Ga0070663_100005406
289 Ga0070663_100030392
290 Ga0070663_100030787
291 Ga0070678_100116819
292 Ga0070662_100019292
293 Ga0070681_10189912
294 Ga0070679_100117216
295 Ga0070679_100318890
296 Ga0068853_100382216
297 Ga0070672_100015783
298 Ga0070696_100222395
299 Ga0070693_100076739
300 Ga0070693_100118954
301 Ga0070665_100081754
302 Ga0068855_100000907
303 Ga0070664_100003923
304 Ga0070664_100016043
305 Ga0070664_100214672
306 Ga0068857_100057750
307 Ga0068854_100765699
308 Ga0068856_100758017
309 Ga0068852_100285799
310 Ga0068852_100984474
311 Ga0068859_100162511
312 Ga0068859_100716172
313 Ga0068864_100021540
314 Ga0068864_100314354
315 Ga0068861_100199716
316 Ga0068863_100014665
317 Ga0068858_100020526
318 Ga0068858_100589575
319 Ga0068860_100701879
320 Ga0068862_100093340
321 Ga0075434_101349185
322 Ga0097620_100162519
323 Ga0097620_100716103
324 Ga0105243_10161300
325 Ga0105248_10003027
326 Ga0105248_10982318
327 Ga0105249_10121432
328 Ga0157373_11101592
329 Ga0157371_10000705
330 Ga0157371_10208580
331 Ga0157371_10677270
332 Ga0157370_10111211
333 Ga0157370_10311052
334 Ga0157370_10350840
335 Ga0157370_10760162
336 Ga0157369_10590332
337 Ga0163162_11245342
338 Ga0157375_11735967
339 Ga0163163_10274780
340 Ga0207705_10000050
341 Ga0207705_10022168
342 Ga0207705_10105612
343 Ga0207654_10119268
344 Ga0207707_10147117
345 Ga0207662_10033903
346 Ga0207657_10000301
347 Ga0207657_10002433
348 Ga0207657_10124619
349 Ga0207657_10159436
350 Ga0207649_10005618
351 Ga0207649_10052300
352 Ga0207649_10075368
353 Ga0207649_10262693
354 Ga0207652_10045902
355 Ga0207652_10681304
356 Ga0207681_10034648
357 Ga0207681_10121231
358 Ga0207681_10237240
359 Ga0207681_10930634
360 Ga0207650_10060073
361 Ga0207650_11029945
362 Ga0207659_10009896
363 Ga0207659_10451633
364 Ga0207644_10019571
365 Ga0207644_10920117
366 Ga0207690_10011841
367 Ga0207690_10069444
368 Ga0207690_10191096
369 Ga0207706_10027837
370 Ga0207709_10290075
371 Ga0207669_11404538
372 Ga0207691_10016307
373 Ga0207711_10011253
374 Ga0207711_11009328
375 Ga0207689_10073436
376 Ga0207661_10551461
377 Ga0207661_11718017
378 Ga0207679_10004997
379 Ga0207679_10081752
380 Ga0207667_10000327
381 Ga0207667_11116312
382 Ga0207651_10004463
383 Ga0207651_10500644
384 Ga0207712_11218895
385 Ga0207668_10270889
386 Ga0207668_10620106
387 Ga0207668_11177705
388 Ga0207658_10024663
389 Ga0207703_10163523
390 Ga0207703_11420708
391 Ga0207678_10002367
392 Ga0207678_10148222
393 Ga0207702_11136581
394 Ga0207676_10049564
395 Ga0207676_10682618
396 Ga0207674_10005415
397 Ga0207675_100628643
398 Ga0207683_10339808
399 Ga0207698_10341780
400 Ga0268266_10056464
401 Ga0268265_10058445
402 Ga0268265_10787316
403 Ga0307408_100075149
404 Ga0307408_100104777
405 Ga0307408_102249116
406 Ga0307405_10065226
407 Ga0307405_10129881
408 Ga0307405_10299528
409 Ga0307405_10327810
410 Ga0307413_10008367
411 Ga0307413_10214573
412 Ga0307413_10296824
413 Ga0307410_10055786
414 Ga0307410_11150081
415 Ga0307406_10018474
416 Ga0307406_11577209
417 Ga0307407_10088709
418 Ga0307407_10264455
419 Ga0307407_11025777
420 Ga0307407_11196715
421 Ga0307412_10017333
422 Ga0307412_10045245
423 Ga0307412_10049151
424 Ga0307412_11354175
425 Ga0307409_100006447
426 Ga0307409_100168581
427 Ga0307409_100188014
428 Ga0307409_100360903
429 Ga0307409_101205102
430 Ga0307416_100050318
431 Ga0307416_100341550
432 Ga0307416_100730866
433 Ga0307416_101105779
434 Ga0307414_10041141
435 Ga0307414_10358715
436 Ga0307414_10679108
437 Ga0307414_11135099
438 Ga0307414_11705784
439 Ga0307411_10015120
440 Ga0307411_10149507
441 Ga0307411_10647342
442 Ga0307415_100053200
443 Ga0307415_100059656
444 Ga0307415_100076596
445 Ga0307415_101479916
446 Ga0373932_0369344
447 Ga0395899_0005982
448 Ga0395899_0016719
449 Ga0395899_0089844
450 Ga0395899_0994660
451 Ga0395900_0154585
452 Ga0395900_0190173
453 Ga0395900_0217101
454 Ga0395900_0353400
455 Ga0395900_0748435
456 Ga0395898_0089702
457 Ga0395898_1073391
458 Ga0395905_0009843
459 Ga0395905_0171299
460 Ga0395905_0276049
461 Ga0395905_0340328
462 Ga0395905_1615275
463 Ga0395901_0254086
464 Ga0395901_0356774
465 Ga0395901_0449364
466 Ga0395901_0948819
467 Ga0450916_075903
468 Ga0466963_0043952
469 Ga0495663_0030415
470 Ga0495598_0000161
471 Ga0495621_0001303
472 Ga0495621_0033085
473 Ga0495668_0036609
474 Ga0495668_0198935
475 Ga0495669_0001331
476 Ga0495669_0010801
477 Ga0495669_0023919
478 Ga0495669_0074323
479 Ga0495669_0126167
480 Ga0495669_0243971
481 Ga0495670_0004815
482 Ga0495683_0348795
483 Ga0495677_0047158
484 Ga0495685_158225
485 Ga0496107_1013564
486 Ga0496109_0035100
487 Ga0496109_1262239
488 Ga0496110_0005559
489 Ga0496111_0009177
490 Ga0496113_0559427
491 Ga0501242_020036
492 Ga0501221_218113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07027

DUF1318

Protein of unknown function (DUF1318)

21

112

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.9108 61 90
6sfx-assembly1.cif.gz_A cryo-em structure of clpp1/2 in the lmclpxp1/2 complex 0.8044 40 82
3c19-assembly1.cif.gz_A crystal structure of protein mk0293 from methanopyrus kandleri av19 0.6499 62 106
2o08-assembly1.cif.gz_B crystal structure of a putative hd superfamily hydrolase (bh1327) from bacillus halodurans at 1.90 a resolution 0.6412 58 84
8e0o-assembly1.cif.gz_B heterotrimeric variant of tctrp9, hetbgl03-15-18 0.4901 45 90
ID Description Score Start End Superfamily
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.9108 61 90 3.40.390.30
af_Q19199_1_192_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6771 46 86 1.20.140.150
2pjqC01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6132 59 83 1.10.472.50
af_Q54LX0_1_183_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5768 59 82 1.10.238.10
5dqwB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.5577 59 88 1.10.472.50
ID Description Score Start End GO Terms
AF-A0A661DTT8-F1-model_v4 DUF1318 domain-containing protein 0.9771 23 106
AF-A0A2G2HLZ8-F1-model_v4 DUF1318 domain-containing protein 0.972 20 106
AF-A0A2A5WB94-F1-model_v4 DUF1318 domain-containing protein 0.963 23 106
AF-A0A420WFT2-F1-model_v4 DUF1318 domain-containing protein 0.9628 22 106
AF-A0A011QJ43-F1-model_v4 DUF1318 domain-containing protein 0.9618 20 106

Map