F357602
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 245 | 136 | 245 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0301885|Ga0451576_0301885_1034_1438 |
| Length | 127 |
| Sequence | MSERKLRVLVGKPGLDGHDRGAKIISRAFRDAGFEIIYTGLHQTPEQIVSAAIQEDVDCVGLSILSGAHNTLLPQVCELLKDKKADDIIPDDDIPGLKAAGIKEVFTPGTSTEDIVAWVRNNVHPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 87 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 90 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 91 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 92 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 93 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 94 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 95 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 99 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 100 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 103 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 104 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 105 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 106 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 107 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 108 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 109 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 110 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 111 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 114 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 120 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 121 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 122 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 127 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 136 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.41 |
| Nodule | 0 |
| Rhizoplane | 0.82 |
| Rhizosphere | 98.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10406290 | 3300005289 | Bacteria | 746 |
| 2 | Ga0065715_10151285 | 3300005293 | Bacteria | 1693 |
| 3 | Ga0070690_100034230 | 3300005330 | Bacteria | 3183 |
| 4 | Ga0070670_100024763 | 3300005331 | Bacteria | 5162 |
| 5 | Ga0070666_10017929 | 3300005335 | Bacteria | 4543 |
| 6 | Ga0070666_10090624 | 3300005335 | Bacteria | 2100 |
| 7 | Ga0068868_100261254 | 3300005338 | Bacteria | 1460 |
| 8 | Ga0070669_100119825 | 3300005353 | Bacteria | 2006 |
| 9 | Ga0070675_100000064 | 3300005354 | Bacteria | 62850 |
| 10 | Ga0070675_100004222 | 3300005354 | Bacteria | 10927 |
| 11 | Ga0070675_100008110 | 3300005354 | Bacteria | 8143 |
| 12 | Ga0070675_100088231 | 3300005354 | Bacteria | 2595 |
| 13 | Ga0070675_100125026 | 3300005354 | Bacteria | 2187 |
| 14 | Ga0070675_100291906 | 3300005354 | Bacteria | 1435 |
| 15 | Ga0070675_101027986 | 3300005354 | Bacteria | 757 |
| 16 | Ga0070671_100006683 | 3300005355 | Bacteria | 9222 |
| 17 | Ga0070671_100265131 | 3300005355 | Bacteria | 1460 |
| 18 | Ga0070673_100008187 | 3300005364 | Bacteria | 6939 |
| 19 | Ga0070673_100899984 | 3300005364 | Bacteria | 821 |
| 20 | Ga0070673_101138820 | 3300005364 | Bacteria | 730 |
| 21 | Ga0070688_100007483 | 3300005365 | Bacteria | 5891 |
| 22 | Ga0070688_100313508 | 3300005365 | Bacteria | 1138 |
| 23 | Ga0070688_100326657 | 3300005365 | Bacteria | 1116 |
| 24 | Ga0070667_100015428 | 3300005367 | Bacteria | 6317 |
| 25 | Ga0070701_10030561 | 3300005438 | Bacteria | 2666 |
| 26 | Ga0070705_100129150 | 3300005440 | Bacteria | 1646 |
| 27 | Ga0070694_101512574 | 3300005444 | Bacteria | 568 |
| 28 | Ga0070678_100863219 | 3300005456 | Bacteria | 825 |
| 29 | Ga0070662_100211843 | 3300005457 | Bacteria | 1542 |
| 30 | Ga0070662_100393193 | 3300005457 | Bacteria | 1143 |
| 31 | Ga0070681_10398497 | 3300005458 | Bacteria | 1288 |
| 32 | Ga0070685_10037814 | 3300005466 | Bacteria | 2735 |
| 33 | Ga0070685_10729547 | 3300005466 | Bacteria | 725 |
| 34 | Ga0070707_100024196 | 3300005468 | Bacteria | 5748 |
| 35 | Ga0070672_100007422 | 3300005543 | Bacteria | 7435 |
| 36 | Ga0070672_101371254 | 3300005543 | Bacteria | 632 |
| 37 | Ga0070686_100030571 | 3300005544 | Bacteria | 3286 |
| 38 | Ga0070686_100370417 | 3300005544 | Bacteria | 1081 |
| 39 | Ga0070665_100528873 | 3300005548 | Bacteria | 1191 |
| 40 | Ga0070704_100032320 | 3300005549 | Bacteria | 3529 |
| 41 | Ga0070704_100266129 | 3300005549 | Bacteria | 1414 |
| 42 | Ga0070664_100010752 | 3300005564 | Bacteria | 7420 |
| 43 | Ga0070664_100069589 | 3300005564 | Bacteria | 3012 |
| 44 | Ga0070664_100209825 | 3300005564 | Bacteria | 1740 |
| 45 | Ga0070664_100581375 | 3300005564 | Bacteria | 1038 |
| 46 | Ga0070702_100316084 | 3300005615 | Bacteria | 1086 |
| 47 | Ga0068859_100031690 | 3300005617 | Bacteria | 5309 |
| 48 | Ga0068859_100032497 | 3300005617 | Bacteria | 5241 |
| 49 | Ga0068864_100056547 | 3300005618 | Bacteria | 3390 |
| 50 | Ga0068861_100219266 | 3300005719 | Bacteria | 1607 |
| 51 | Ga0068870_10166220 | 3300005840 | Bacteria | 1313 |
| 52 | Ga0068863_100001761 | 3300005841 | Bacteria | 21473 |
| 53 | Ga0068863_100141699 | 3300005841 | Bacteria | 2298 |
| 54 | Ga0068863_102052880 | 3300005841 | Bacteria | 582 |
| 55 | Ga0068858_100002868 | 3300005842 | Bacteria | 17333 |
| 56 | Ga0068860_100172047 | 3300005843 | Bacteria | 2092 |
| 57 | Ga0068860_100870863 | 3300005843 | Bacteria | 916 |
| 58 | Ga0068862_100256964 | 3300005844 | Bacteria | 1593 |
| 59 | Ga0097621_100080761 | 3300006237 | Bacteria | 2705 |
| 60 | Ga0075428_100012524 | 3300006844 | Bacteria | 9433 |
| 61 | Ga0075433_10339504 | 3300006852 | Bacteria | 1328 |
| 62 | Ga0097620_100031690 | 3300006931 | Bacteria | 5309 |
| 63 | Ga0097620_100032497 | 3300006931 | Bacteria | 5241 |
| 64 | Ga0075435_100437310 | 3300007076 | Bacteria | 1127 |
| 65 | Ga0111539_10009746 | 3300009094 | Bacteria | 12123 |
| 66 | Ga0111539_10022706 | 3300009094 | Bacteria | 7706 |
| 67 | Ga0111539_10091449 | 3300009094 | Bacteria | 3575 |
| 68 | Ga0111539_10601319 | 3300009094 | Bacteria | 1281 |
| 69 | Ga0105245_11234379 | 3300009098 | Unclassified | 796 |
| 70 | Ga0105245_12327460 | 3300009098 | Bacteria | 589 |
| 71 | Ga0114129_10057350 | 3300009147 | Bacteria | 5450 |
| 72 | Ga0114129_10305485 | 3300009147 | Bacteria | 2119 |
| 73 | Ga0105242_10831236 | 3300009176 | Bacteria | 917 |
| 74 | Ga0105248_10000363 | 3300009177 | Bacteria | 52947 |
| 75 | Ga0105248_11833781 | 3300009177 | Bacteria | 688 |
| 76 | Ga0105249_11122765 | 3300009553 | Bacteria | 856 |
| 77 | Ga0105246_10367159 | 3300011119 | Bacteria | 1185 |
| 78 | Ga0157374_10877496 | 3300013296 | Bacteria | 914 |
| 79 | Ga0157378_12563067 | 3300013297 | Bacteria | 562 |
| 80 | Ga0163162_10003664 | 3300013306 | Bacteria | 14740 |
| 81 | Ga0163162_11235651 | 3300013306 | Bacteria | 848 |
| 82 | Ga0163162_13227617 | 3300013306 | Bacteria | 523 |
| 83 | Ga0157375_10002253 | 3300013308 | Bacteria | 16679 |
| 84 | Ga0157375_10102371 | 3300013308 | Bacteria | 2948 |
| 85 | Ga0157375_10900406 | 3300013308 | Bacteria | 1029 |
| 86 | Ga0157375_11203437 | 3300013308 | Bacteria | 889 |
| 87 | Ga0163163_10005936 | 3300014325 | Bacteria | 10630 |
| 88 | Ga0163163_10195203 | 3300014325 | Bacteria | 2072 |
| 89 | Ga0157380_10041967 | 3300014326 | Bacteria | 3573 |
| 90 | Ga0157380_10361470 | 3300014326 | Bacteria | 1362 |
| 91 | Ga0157380_10565662 | 3300014326 | Bacteria | 1118 |
| 92 | Ga0157380_12321110 | 3300014326 | Bacteria | 601 |
| 93 | Ga0157377_10243532 | 3300014745 | Bacteria | 1162 |
| 94 | Ga0157377_10659361 | 3300014745 | Unclassified | 754 |
| 95 | Ga0157379_10000421 | 3300014968 | Bacteria | 34236 |
| 96 | Ga0157376_10196711 | 3300014969 | Bacteria | 1852 |
| 97 | Ga0163161_10092328 | 3300017792 | Bacteria | 2241 |
| 98 | Ga0207680_10311398 | 3300025903 | Bacteria | 1099 |
| 99 | Ga0207645_11226854 | 3300025907 | Archaea | 503 |
| 100 | Ga0207643_10133530 | 3300025908 | Bacteria | 1478 |
| 101 | Ga0207660_10371942 | 3300025917 | Bacteria | 1148 |
| 102 | Ga0207646_10543681 | 3300025922 | Bacteria | 1045 |
| 103 | Ga0207650_10026368 | 3300025925 | Bacteria | 4145 |
| 104 | Ga0207650_10262429 | 3300025925 | Bacteria | 1401 |
| 105 | Ga0207650_10576323 | 3300025925 | Bacteria | 945 |
| 106 | Ga0207659_10005526 | 3300025926 | Bacteria | 7668 |
| 107 | Ga0207659_10009871 | 3300025926 | Bacteria | 5975 |
| 108 | Ga0207659_10054233 | 3300025926 | Bacteria | 2862 |
| 109 | Ga0207659_10097928 | 3300025926 | Bacteria | 2204 |
| 110 | Ga0207659_10640216 | 3300025926 | Bacteria | 908 |
| 111 | Ga0207659_10830535 | 3300025926 | Bacteria | 794 |
| 112 | Ga0207687_11503790 | 3300025927 | Unclassified | 578 |
| 113 | Ga0207644_10006542 | 3300025931 | Bacteria | 7594 |
| 114 | Ga0207644_10842208 | 3300025931 | Bacteria | 768 |
| 115 | Ga0207670_10639418 | 3300025936 | Bacteria | 876 |
| 116 | Ga0207691_10002704 | 3300025940 | Bacteria | 17330 |
| 117 | Ga0207711_10000638 | 3300025941 | Bacteria | 35113 |
| 118 | Ga0207679_10006397 | 3300025945 | Bacteria | 7440 |
| 119 | Ga0207679_10124615 | 3300025945 | Bacteria | 2057 |
| 120 | Ga0207679_10232557 | 3300025945 | Bacteria | 1557 |
| 121 | Ga0207651_10169032 | 3300025960 | Bacteria | 1722 |
| 122 | Ga0207651_11358906 | 3300025960 | Bacteria | 639 |
| 123 | Ga0207712_11129210 | 3300025961 | Bacteria | 698 |
| 124 | Ga0207658_10006886 | 3300025986 | Bacteria | 7739 |
| 125 | Ga0207677_10160750 | 3300026023 | Bacteria | 1745 |
| 126 | Ga0207703_10003184 | 3300026035 | Bacteria | 13810 |
| 127 | Ga0207641_10000514 | 3300026088 | Bacteria | 43419 |
| 128 | Ga0207641_10492124 | 3300026088 | Bacteria | 1190 |
| 129 | Ga0207641_10558493 | 3300026088 | Bacteria | 1117 |
| 130 | Ga0207648_10623806 | 3300026089 | Bacteria | 995 |
| 131 | Ga0207676_10433128 | 3300026095 | Bacteria | 1236 |
| 132 | Ga0207674_10368981 | 3300026116 | Bacteria | 1388 |
| 133 | Ga0207674_11925190 | 3300026116 | Bacteria | 557 |
| 134 | Ga0207675_100496600 | 3300026118 | Bacteria | 1214 |
| 135 | Ga0207675_101012869 | 3300026118 | Bacteria | 849 |
| 136 | Ga0207683_10021594 | 3300026121 | Bacteria | 5516 |
| 137 | Ga0207683_10967894 | 3300026121 | Bacteria | 790 |
| 138 | Ga0209982_1028995 | 3300027552 | Bacteria | 867 |
| 139 | Ga0209974_10021733 | 3300027876 | Bacteria | 2126 |
| 140 | Ga0207428_10036788 | 3300027907 | Bacteria | 3988 |
| 141 | Ga0207428_10145509 | 3300027907 | Bacteria | 1806 |
| 142 | Ga0268266_11032146 | 3300028379 | Bacteria | 796 |
| 143 | Ga0268264_10013759 | 3300028381 | Bacteria | 6656 |
| 144 | Ga0268264_10203449 | 3300028381 | Bacteria | 1813 |
| 145 | Ga0268264_10283501 | 3300028381 | Bacteria | 1553 |
| 146 | Ga0268264_11562310 | 3300028381 | Bacteria | 670 |
| 147 | Ga0265318_10009112 | 3300028577 | Bacteria | 4386 |
| 148 | Ga0265322_10059677 | 3300028654 | Bacteria | 1082 |
| 149 | Ga0265327_10013049 | 3300031251 | Bacteria | 5549 |
| 150 | Ga0265327_10280407 | 3300031251 | Bacteria | 737 |
| 151 | Ga0265316_10005406 | 3300031344 | Bacteria | 12416 |
| 152 | Ga0316575_10126128 | 3300031665 | Bacteria | 1048 |
| 153 | Ga0316579_10017868 | 3300031691 | Bacteria | 3116 |
| 154 | Ga0316579_10055272 | 3300031691 | Bacteria | 1862 |
| 155 | Ga0316576_10005504 | 3300031727 | Bacteria | 7749 |
| 156 | Ga0316576_10258812 | 3300031727 | Bacteria | 1306 |
| 157 | Ga0316576_10446794 | 3300031727 | Bacteria | 955 |
| 158 | Ga0316578_10055845 | 3300031728 | Bacteria | 2318 |
| 159 | Ga0316577_10000725 | 3300031733 | Bacteria | 14032 |
| 160 | Ga0316577_10065773 | 3300031733 | Bacteria | 2024 |
| 161 | Ga0316577_10834318 | 3300031733 | Archaea | 523 |
| 162 | Ga0307409_101398731 | 3300031995 | Bacteria | 726 |
| 163 | Ga0307416_100655033 | 3300032002 | Bacteria | 1135 |
| 164 | Ga0307415_100862553 | 3300032126 | Bacteria | 832 |
| 165 | Ga0316583_10002044 | 3300032133 | Unclassified | 6912 |
| 166 | Ga0316583_10069277 | 3300032133 | Bacteria | 1234 |
| 167 | Ga0373928_0006529 | 3300035084 | Bacteria | 2242 |
| 168 | Ga0373956_0138478 | 3300035119 | Bacteria | 1142 |
| 169 | Ga0373946_0032974 | 3300035171 | Bacteria | 2082 |
| 170 | Ga0316574_0066656 | 3300035398 | Bacteria | 2269 |
| 171 | Ga0373931_1006239 | 3300035691 | Bacteria | 564 |
| 172 | Ga0373933_0497858 | 3300035724 | Bacteria | 798 |
| 173 | Ga0316582_0077883 | 3300036647 | Bacteria | 2159 |
| 174 | Ga0316582_0101057 | 3300036647 | Bacteria | 1910 |
| 175 | Ga0316582_0129132 | 3300036647 | Unclassified | 1696 |
| 176 | Ga0316582_0256960 | 3300036647 | Unclassified | 1197 |
| 177 | Ga0316582_0978986 | 3300036647 | Unclassified | 578 |
| 178 | Ga0316584_0007999 | 3300036712 | Bacteria | 7259 |
| 179 | Ga0316584_0084734 | 3300036712 | Bacteria | 2373 |
| 180 | Ga0316581_0025401 | 3300037588 | Unclassified | 1762 |
| 181 | Ga0436362_0398418 | 3300039453 | Bacteria | 536 |
| 182 | Ga0451791_1274883 | 3300041451 | Bacteria | 598 |
| 183 | Ga0450896_025168 | 3300042133 | Bacteria | 884 |
| 184 | Ga0439446_0140169 | 3300042156 | Bacteria | 789 |
| 185 | Ga0451577_0000636 | 3300042876 | Bacteria | 56018 |
| 186 | Ga0451577_0023400 | 3300042876 | Bacteria | 5634 |
| 187 | Ga0451577_0028120 | 3300042876 | Bacteria | 5088 |
| 188 | Ga0451577_0109958 | 3300042876 | Bacteria | 2465 |
| 189 | Ga0451577_0133712 | 3300042876 | Bacteria | 2226 |
| 190 | Ga0451577_0625124 | 3300042876 | Bacteria | 977 |
| 191 | Ga0451577_0963145 | 3300042876 | Bacteria | 767 |
| 192 | Ga0453683_0000107 | 3300044673 | Bacteria | 124376 |
| 193 | Ga0453683_0000475 | 3300044673 | Bacteria | 46138 |
| 194 | Ga0453683_0000773 | 3300044673 | Bacteria | 31774 |
| 195 | Ga0453683_0047708 | 3300044673 | Bacteria | 2686 |
| 196 | Ga0453683_0056419 | 3300044673 | Bacteria | 2458 |
| 197 | Ga0453683_0090814 | 3300044673 | Bacteria | 1915 |
| 198 | Ga0453683_0174224 | 3300044673 | Bacteria | 1363 |
| 199 | Ga0453683_0468656 | 3300044673 | Bacteria | 816 |
| 200 | Ga0453683_0558364 | 3300044673 | Bacteria | 745 |
| 201 | Ga0453683_0600347 | 3300044673 | Bacteria | 718 |
| 202 | Ga0453683_0801654 | 3300044673 | Bacteria | 620 |
| 203 | Ga0453684_0000406 | 3300044712 | Bacteria | 177405 |
| 204 | Ga0453684_0000690 | 3300044712 | Bacteria | 120137 |
| 205 | Ga0453684_0001524 | 3300044712 | Bacteria | 64854 |
| 206 | Ga0453684_0003817 | 3300044712 | Bacteria | 33232 |
| 207 | Ga0453684_0036054 | 3300044712 | Bacteria | 6823 |
| 208 | Ga0453684_0054719 | 3300044712 | Bacteria | 5195 |
| 209 | Ga0453684_0113714 | 3300044712 | Bacteria | 3283 |
| 210 | Ga0453684_0414089 | 3300044712 | Bacteria | 1507 |
| 211 | Ga0453684_1061984 | 3300044712 | Bacteria | 858 |
| 212 | Ga0453684_1371379 | 3300044712 | Bacteria | 734 |
| 213 | Ga0453684_1505467 | 3300044712 | Bacteria | 694 |
| 214 | Ga0451576_0000686 | 3300045051 | Bacteria | 68943 |
| 215 | Ga0451576_0029836 | 3300045051 | Bacteria | 5834 |
| 216 | Ga0451576_0035194 | 3300045051 | Bacteria | 5314 |
| 217 | Ga0451576_0069195 | 3300045051 | Bacteria | 3673 |
| 218 | Ga0451576_0202366 | 3300045051 | Bacteria | 2074 |
| 219 | Ga0451576_0301885 | 3300045051 | Bacteria | 1675 |
| 220 | Ga0451576_0821629 | 3300045051 | Bacteria | 976 |
| 221 | Ga0451576_2388802 | 3300045051 | Unclassified | 541 |
| 222 | Ga0495582_0347424 | 3300046473 | Bacteria | 854 |
| 223 | Ga0495586_0424806 | 3300046535 | Bacteria | 766 |
| 224 | Ga0495621_0316193 | 3300046539 | Bacteria | 650 |
| 225 | Ga0496104_0368133 | 3300048907 | Bacteria | 1350 |
| 226 | Ga0496125_0279955 | 3300048928 | Bacteria | 1034 |
| 227 | Ga0501291_031615 | 3300049514 | Bacteria | 895 |
| 228 | Ga0501034_0820929 | 3300049571 | Bacteria | 821 |
| 229 | Ga0501071_0114044 | 3300049587 | Bacteria | 1999 |
| 230 | Ga0501075_0258579 | 3300049591 | Bacteria | 1327 |
| 231 | Ga0501075_0623988 | 3300049591 | Bacteria | 822 |
| 232 | Ga0501076_1523988 | 3300049592 | Bacteria | 549 |
| 233 | Ga0501235_108140 | 3300049669 | Bacteria | 685 |
| 234 | Ga0501079_0510765 | 3300049741 | Bacteria | 945 |
| 235 | Ga0501080_0441296 | 3300049742 | Bacteria | 1168 |
| 236 | Ga0501081_0395485 | 3300049743 | Bacteria | 1023 |
| 237 | Ga0501083_0960903 | 3300049744 | Unclassified | 556 |
| 238 | nmdc:mga05p37_218655_c1 | 3300050507 | Bacteria | 2300 |
| 239 | nmdc:mga08y16_32634_c1 | 3300050511 | Bacteria | 5473 |
| 240 | nmdc:mga08y16_9301_c1 | 3300050511 | Bacteria | 10308 |
| 241 | nmdc:mga0n895_886444_c1 | 3300050512 | Bacteria | 878 |
| 242 | nmdc:mga0n895_89198_c1 | 3300050512 | Bacteria | 3084 |
| 243 | nmdc:mga0a205_56528_c1 | 3300050515 | Bacteria | 3788 |
| 244 | Ga0500643_003198 | 3300053087 | Bacteria | 7995 |
| 245 | Ga0530510_0380254 | 3300061734 | Bacteria | 1063 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0625124 | Ga0451577_0625124_10_411 | 109 |
| 2 | 3300025925 | Ga0207650_10576323 | Ga0207650_105763232 | 123 |
| 3 | 3300031691 | Ga0316579_10017868 | Ga0316579_100178684 | 125 |
| 4 | 3300031733 | Ga0316577_10065773 | Ga0316577_100657731 | 125 |
| 5 | 3300037588 | Ga0316581_0025401 | Ga0316581_0025401_1120_1503 | 125 |
| 6 | 3300042876 | Ga0451577_0133712 | Ga0451577_0133712_1203_1583 | 125 |
| 7 | 3300044712 | Ga0453684_1061984 | Ga0453684_1061984_156_536 | 125 |
| 8 | 3300045051 | Ga0451576_0301885 | Ga0451576_0301885_1034_1438 | 125 |
| 9 | 3300032126 | Ga0307415_100862553 | Ga0307415_1008625532 | 126 |
| 10 | 3300044673 | Ga0453683_0558364 | Ga0453683_0558364_143_535 | 129 |
| 11 | 3300005843 | Ga0068860_100172047 | Ga0068860_1001720472 | 130 |
| 12 | 3300028381 | Ga0268264_10283501 | Ga0268264_102835012 | 130 |
| 13 | 3300005354 | Ga0070675_101027986 | Ga0070675_1010279861 | 131 |
| 14 | 3300005355 | Ga0070671_100265131 | Ga0070671_1002651312 | 131 |
| 15 | 3300007076 | Ga0075435_100437310 | Ga0075435_1004373102 | 131 |
| 16 | 3300025926 | Ga0207659_10830535 | Ga0207659_108305352 | 131 |
| 17 | 3300026118 | Ga0207675_100496600 | Ga0207675_1004966003 | 131 |
| 18 | 3300026121 | Ga0207683_10021594 | Ga0207683_100215944 | 131 |
| 19 | 3300035171 | Ga0373946_0032974 | Ga0373946_0032974_1492_1902 | 131 |
| 20 | 3300044673 | Ga0453683_0600347 | Ga0453683_0600347_70_477 | 131 |
| 21 | 3300046535 | Ga0495586_0424806 | Ga0495586_0424806_225_635 | 131 |
| 22 | 3300005289 | Ga0065704_10406290 | Ga0065704_104062902 | 132 |
| 23 | 3300005293 | Ga0065715_10151285 | Ga0065715_101512852 | 132 |
| 24 | 3300005330 | Ga0070690_100034230 | Ga0070690_1000342302 | 132 |
| 25 | 3300005331 | Ga0070670_100024763 | Ga0070670_1000247633 | 132 |
| 26 | 3300005335 | Ga0070666_10017929 | Ga0070666_100179292 | 132 |
| 27 | 3300005335 | Ga0070666_10090624 | Ga0070666_100906242 | 132 |
| 28 | 3300005338 | Ga0068868_100261254 | Ga0068868_1002612542 | 132 |
| 29 | 3300005353 | Ga0070669_100119825 | Ga0070669_1001198252 | 132 |
| 30 | 3300005354 | Ga0070675_100000064 | Ga0070675_10000006422 | 132 |
| 31 | 3300005354 | Ga0070675_100004222 | Ga0070675_1000042228 | 132 |
| 32 | 3300005354 | Ga0070675_100008110 | Ga0070675_1000081107 | 132 |
| 33 | 3300005354 | Ga0070675_100088231 | Ga0070675_1000882313 | 132 |
| 34 | 3300005354 | Ga0070675_100125026 | Ga0070675_1001250262 | 132 |
| 35 | 3300005354 | Ga0070675_100291906 | Ga0070675_1002919061 | 132 |
| 36 | 3300005355 | Ga0070671_100006683 | Ga0070671_1000066835 | 132 |
| 37 | 3300005364 | Ga0070673_100008187 | Ga0070673_1000081876 | 132 |
| 38 | 3300005364 | Ga0070673_100899984 | Ga0070673_1008999842 | 132 |
| 39 | 3300005364 | Ga0070673_101138820 | Ga0070673_1011388201 | 132 |
| 40 | 3300005365 | Ga0070688_100007483 | Ga0070688_1000074836 | 132 |
| 41 | 3300005365 | Ga0070688_100313508 | Ga0070688_1003135082 | 132 |
| 42 | 3300005365 | Ga0070688_100326657 | Ga0070688_1003266572 | 132 |
| 43 | 3300005367 | Ga0070667_100015428 | Ga0070667_1000154285 | 132 |
| 44 | 3300005438 | Ga0070701_10030561 | Ga0070701_100305612 | 132 |
| 45 | 3300005440 | Ga0070705_100129150 | Ga0070705_1001291502 | 132 |
| 46 | 3300005444 | Ga0070694_101512574 | Ga0070694_1015125741 | 132 |
| 47 | 3300005456 | Ga0070678_100863219 | Ga0070678_1008632192 | 132 |
| 48 | 3300005457 | Ga0070662_100211843 | Ga0070662_1002118432 | 132 |
| 49 | 3300005457 | Ga0070662_100393193 | Ga0070662_1003931932 | 132 |
| 50 | 3300005458 | Ga0070681_10398497 | Ga0070681_103984972 | 132 |
| 51 | 3300005466 | Ga0070685_10037814 | Ga0070685_100378142 | 132 |
| 52 | 3300005466 | Ga0070685_10729547 | Ga0070685_107295471 | 132 |
| 53 | 3300005468 | Ga0070707_100024196 | Ga0070707_1000241962 | 132 |
| 54 | 3300005543 | Ga0070672_100007422 | Ga0070672_1000074222 | 132 |
| 55 | 3300005543 | Ga0070672_101371254 | Ga0070672_1013712542 | 132 |
| 56 | 3300005544 | Ga0070686_100030571 | Ga0070686_1000305714 | 132 |
| 57 | 3300005544 | Ga0070686_100370417 | Ga0070686_1003704172 | 132 |
| 58 | 3300005548 | Ga0070665_100528873 | Ga0070665_1005288732 | 132 |
| 59 | 3300005549 | Ga0070704_100032320 | Ga0070704_1000323202 | 132 |
| 60 | 3300005549 | Ga0070704_100266129 | Ga0070704_1002661292 | 132 |
| 61 | 3300005564 | Ga0070664_100010752 | Ga0070664_1000107525 | 132 |
| 62 | 3300005564 | Ga0070664_100069589 | Ga0070664_1000695893 | 132 |
| 63 | 3300005564 | Ga0070664_100209825 | Ga0070664_1002098252 | 132 |
| 64 | 3300005564 | Ga0070664_100581375 | Ga0070664_1005813752 | 132 |
| 65 | 3300005615 | Ga0070702_100316084 | Ga0070702_1003160842 | 132 |
| 66 | 3300005617 | Ga0068859_100031690 | Ga0068859_1000316904 | 132 |
| 67 | 3300005617 | Ga0068859_100032497 | Ga0068859_1000324976 | 132 |
| 68 | 3300005618 | Ga0068864_100056547 | Ga0068864_1000565473 | 132 |
| 69 | 3300005719 | Ga0068861_100219266 | Ga0068861_1002192662 | 132 |
| 70 | 3300005840 | Ga0068870_10166220 | Ga0068870_101662202 | 132 |
| 71 | 3300005841 | Ga0068863_100001761 | Ga0068863_1000017617 | 132 |
| 72 | 3300005841 | Ga0068863_100141699 | Ga0068863_1001416993 | 132 |
| 73 | 3300005841 | Ga0068863_102052880 | Ga0068863_1020528802 | 132 |
| 74 | 3300005842 | Ga0068858_100002868 | Ga0068858_10000286813 | 132 |
| 75 | 3300005843 | Ga0068860_100870863 | Ga0068860_1008708632 | 132 |
| 76 | 3300005844 | Ga0068862_100256964 | Ga0068862_1002569642 | 132 |
| 77 | 3300006237 | Ga0097621_100080761 | Ga0097621_1000807612 | 132 |
| 78 | 3300006844 | Ga0075428_100012524 | Ga0075428_1000125243 | 132 |
| 79 | 3300006852 | Ga0075433_10339504 | Ga0075433_103395042 | 132 |
| 80 | 3300006931 | Ga0097620_100031690 | Ga0097620_1000316904 | 132 |
| 81 | 3300006931 | Ga0097620_100032497 | Ga0097620_1000324976 | 132 |
| 82 | 3300009094 | Ga0111539_10009746 | Ga0111539_100097469 | 132 |
| 83 | 3300009094 | Ga0111539_10022706 | Ga0111539_100227062 | 132 |
| 84 | 3300009094 | Ga0111539_10091449 | Ga0111539_100914492 | 132 |
| 85 | 3300009094 | Ga0111539_10601319 | Ga0111539_106013192 | 132 |
| 86 | 3300009098 | Ga0105245_11234379 | Ga0105245_112343792 | 132 |
| 87 | 3300009098 | Ga0105245_12327460 | Ga0105245_123274602 | 132 |
| 88 | 3300009147 | Ga0114129_10057350 | Ga0114129_100573501 | 132 |
| 89 | 3300009147 | Ga0114129_10305485 | Ga0114129_103054852 | 132 |
| 90 | 3300009176 | Ga0105242_10831236 | Ga0105242_108312362 | 132 |
| 91 | 3300009177 | Ga0105248_10000363 | Ga0105248_1000036319 | 132 |
| 92 | 3300009177 | Ga0105248_11833781 | Ga0105248_118337812 | 132 |
| 93 | 3300009553 | Ga0105249_11122765 | Ga0105249_111227652 | 132 |
| 94 | 3300011119 | Ga0105246_10367159 | Ga0105246_103671592 | 132 |
| 95 | 3300013296 | Ga0157374_10877496 | Ga0157374_108774962 | 132 |
| 96 | 3300013297 | Ga0157378_12563067 | Ga0157378_125630672 | 132 |
| 97 | 3300013306 | Ga0163162_10003664 | Ga0163162_100036643 | 132 |
| 98 | 3300013306 | Ga0163162_11235651 | Ga0163162_112356512 | 132 |
| 99 | 3300013306 | Ga0163162_13227617 | Ga0163162_132276171 | 132 |
| 100 | 3300013308 | Ga0157375_10002253 | Ga0157375_100022537 | 132 |
| 101 | 3300013308 | Ga0157375_10102371 | Ga0157375_101023712 | 132 |
| 102 | 3300013308 | Ga0157375_10900406 | Ga0157375_109004062 | 132 |
| 103 | 3300013308 | Ga0157375_11203437 | Ga0157375_112034372 | 132 |
| 104 | 3300014325 | Ga0163163_10005936 | Ga0163163_100059368 | 132 |
| 105 | 3300014325 | Ga0163163_10195203 | Ga0163163_101952032 | 132 |
| 106 | 3300014326 | Ga0157380_10041967 | Ga0157380_100419672 | 132 |
| 107 | 3300014326 | Ga0157380_10361470 | Ga0157380_103614702 | 132 |
| 108 | 3300014326 | Ga0157380_10565662 | Ga0157380_105656622 | 132 |
| 109 | 3300014326 | Ga0157380_12321110 | Ga0157380_123211101 | 132 |
| 110 | 3300014745 | Ga0157377_10243532 | Ga0157377_102435322 | 132 |
| 111 | 3300014745 | Ga0157377_10659361 | Ga0157377_106593612 | 132 |
| 112 | 3300014968 | Ga0157379_10000421 | Ga0157379_100004219 | 132 |
| 113 | 3300014969 | Ga0157376_10196711 | Ga0157376_101967112 | 132 |
| 114 | 3300017792 | Ga0163161_10092328 | Ga0163161_100923282 | 132 |
| 115 | 3300025903 | Ga0207680_10311398 | Ga0207680_103113982 | 132 |
| 116 | 3300025907 | Ga0207645_11226854 | Ga0207645_112268541 | 132 |
| 117 | 3300025908 | Ga0207643_10133530 | Ga0207643_101335302 | 132 |
| 118 | 3300025917 | Ga0207660_10371942 | Ga0207660_103719421 | 132 |
| 119 | 3300025922 | Ga0207646_10543681 | Ga0207646_105436811 | 132 |
| 120 | 3300025925 | Ga0207650_10026368 | Ga0207650_100263683 | 132 |
| 121 | 3300025925 | Ga0207650_10262429 | Ga0207650_102624292 | 132 |
| 122 | 3300025926 | Ga0207659_10005526 | Ga0207659_100055266 | 132 |
| 123 | 3300025926 | Ga0207659_10009871 | Ga0207659_100098716 | 132 |
| 124 | 3300025926 | Ga0207659_10054233 | Ga0207659_100542332 | 132 |
| 125 | 3300025926 | Ga0207659_10097928 | Ga0207659_100979282 | 132 |
| 126 | 3300025926 | Ga0207659_10640216 | Ga0207659_106402162 | 132 |
| 127 | 3300025927 | Ga0207687_11503790 | Ga0207687_115037902 | 132 |
| 128 | 3300025931 | Ga0207644_10006542 | Ga0207644_100065427 | 132 |
| 129 | 3300025931 | Ga0207644_10842208 | Ga0207644_108422082 | 132 |
| 130 | 3300025936 | Ga0207670_10639418 | Ga0207670_106394182 | 132 |
| 131 | 3300025940 | Ga0207691_10002704 | Ga0207691_1000270413 | 132 |
| 132 | 3300025941 | Ga0207711_10000638 | Ga0207711_100006387 | 132 |
| 133 | 3300025945 | Ga0207679_10006397 | Ga0207679_100063975 | 132 |
| 134 | 3300025945 | Ga0207679_10124615 | Ga0207679_101246151 | 132 |
| 135 | 3300025945 | Ga0207679_10232557 | Ga0207679_102325572 | 132 |
| 136 | 3300025960 | Ga0207651_10169032 | Ga0207651_101690322 | 132 |
| 137 | 3300025960 | Ga0207651_11358906 | Ga0207651_113589062 | 132 |
| 138 | 3300025961 | Ga0207712_11129210 | Ga0207712_111292102 | 132 |
| 139 | 3300025986 | Ga0207658_10006886 | Ga0207658_100068866 | 132 |
| 140 | 3300026023 | Ga0207677_10160750 | Ga0207677_101607502 | 132 |
| 141 | 3300026035 | Ga0207703_10003184 | Ga0207703_100031844 | 132 |
| 142 | 3300026088 | Ga0207641_10000514 | Ga0207641_1000051419 | 132 |
| 143 | 3300026088 | Ga0207641_10492124 | Ga0207641_104921242 | 132 |
| 144 | 3300026088 | Ga0207641_10558493 | Ga0207641_105584932 | 132 |
| 145 | 3300026089 | Ga0207648_10623806 | Ga0207648_106238062 | 132 |
| 146 | 3300026095 | Ga0207676_10433128 | Ga0207676_104331281 | 132 |
| 147 | 3300026116 | Ga0207674_10368981 | Ga0207674_103689812 | 132 |
| 148 | 3300026116 | Ga0207674_11925190 | Ga0207674_119251901 | 132 |
| 149 | 3300026118 | Ga0207675_101012869 | Ga0207675_1010128692 | 132 |
| 150 | 3300026121 | Ga0207683_10967894 | Ga0207683_109678941 | 132 |
| 151 | 3300027552 | Ga0209982_1028995 | Ga0209982_10289952 | 132 |
| 152 | 3300027876 | Ga0209974_10021733 | Ga0209974_100217332 | 132 |
| 153 | 3300027907 | Ga0207428_10036788 | Ga0207428_100367885 | 132 |
| 154 | 3300027907 | Ga0207428_10145509 | Ga0207428_101455092 | 132 |
| 155 | 3300028379 | Ga0268266_11032146 | Ga0268266_110321462 | 132 |
| 156 | 3300028381 | Ga0268264_10013759 | Ga0268264_100137594 | 132 |
| 157 | 3300028381 | Ga0268264_10203449 | Ga0268264_102034493 | 132 |
| 158 | 3300028381 | Ga0268264_11562310 | Ga0268264_115623102 | 132 |
| 159 | 3300028577 | Ga0265318_10009112 | Ga0265318_100091122 | 132 |
| 160 | 3300028654 | Ga0265322_10059677 | Ga0265322_100596772 | 132 |
| 161 | 3300031251 | Ga0265327_10013049 | Ga0265327_100130496 | 132 |
| 162 | 3300031251 | Ga0265327_10280407 | Ga0265327_102804071 | 132 |
| 163 | 3300031344 | Ga0265316_10005406 | Ga0265316_1000540613 | 132 |
| 164 | 3300031665 | Ga0316575_10126128 | Ga0316575_101261282 | 132 |
| 165 | 3300031691 | Ga0316579_10055272 | Ga0316579_100552722 | 132 |
| 166 | 3300031727 | Ga0316576_10005504 | Ga0316576_100055043 | 132 |
| 167 | 3300031727 | Ga0316576_10258812 | Ga0316576_102588121 | 132 |
| 168 | 3300031727 | Ga0316576_10446794 | Ga0316576_104467942 | 132 |
| 169 | 3300031728 | Ga0316578_10055845 | Ga0316578_100558452 | 132 |
| 170 | 3300031733 | Ga0316577_10000725 | Ga0316577_100007257 | 132 |
| 171 | 3300031733 | Ga0316577_10834318 | Ga0316577_108343181 | 132 |
| 172 | 3300031995 | Ga0307409_101398731 | Ga0307409_1013987311 | 132 |
| 173 | 3300032002 | Ga0307416_100655033 | Ga0307416_1006550332 | 132 |
| 174 | 3300032133 | Ga0316583_10002044 | Ga0316583_100020442 | 132 |
| 175 | 3300032133 | Ga0316583_10069277 | Ga0316583_100692772 | 132 |
| 176 | 3300035084 | Ga0373928_0006529 | Ga0373928_0006529_154_558 | 132 |
| 177 | 3300035119 | Ga0373956_0138478 | Ga0373956_0138478_244_648 | 132 |
| 178 | 3300035398 | Ga0316574_0066656 | Ga0316574_0066656_1303_1719 | 132 |
| 179 | 3300035691 | Ga0373931_1006239 | Ga0373931_1006239_103_507 | 132 |
| 180 | 3300035724 | Ga0373933_0497858 | Ga0373933_0497858_196_615 | 132 |
| 181 | 3300036647 | Ga0316582_0077883 | Ga0316582_0077883_424_837 | 132 |
| 182 | 3300036647 | Ga0316582_0101057 | Ga0316582_0101057_346_762 | 132 |
| 183 | 3300036647 | Ga0316582_0129132 | Ga0316582_0129132_724_1131 | 132 |
| 184 | 3300036647 | Ga0316582_0256960 | Ga0316582_0256960_556_966 | 132 |
| 185 | 3300036647 | Ga0316582_0978986 | Ga0316582_0978986_71_478 | 132 |
| 186 | 3300036712 | Ga0316584_0007999 | Ga0316584_0007999_6245_6661 | 132 |
| 187 | 3300036712 | Ga0316584_0084734 | Ga0316584_0084734_981_1397 | 132 |
| 188 | 3300039453 | Ga0436362_0398418 | Ga0436362_0398418_85_486 | 132 |
| 189 | 3300041451 | Ga0451791_1274883 | Ga0451791_1274883_28_474 | 132 |
| 190 | 3300042133 | Ga0450896_025168 | Ga0450896_025168_50_478 | 132 |
| 191 | 3300042156 | Ga0439446_0140169 | Ga0439446_0140169_117_545 | 132 |
| 192 | 3300042876 | Ga0451577_0000636 | Ga0451577_0000636_10049_10483 | 132 |
| 193 | 3300042876 | Ga0451577_0023400 | Ga0451577_0023400_4301_4705 | 132 |
| 194 | 3300042876 | Ga0451577_0028120 | Ga0451577_0028120_1832_2236 | 132 |
| 195 | 3300042876 | Ga0451577_0109958 | Ga0451577_0109958_1067_1522 | 132 |
| 196 | 3300042876 | Ga0451577_0963145 | Ga0451577_0963145_142_546 | 132 |
| 197 | 3300044673 | Ga0453683_0000107 | Ga0453683_0000107_11395_11799 | 132 |
| 198 | 3300044673 | Ga0453683_0000475 | Ga0453683_0000475_5428_5829 | 132 |
| 199 | 3300044673 | Ga0453683_0000773 | Ga0453683_0000773_29446_29850 | 132 |
| 200 | 3300044673 | Ga0453683_0047708 | Ga0453683_0047708_406_810 | 132 |
| 201 | 3300044673 | Ga0453683_0056419 | Ga0453683_0056419_1995_2399 | 132 |
| 202 | 3300044673 | Ga0453683_0090814 | Ga0453683_0090814_976_1380 | 132 |
| 203 | 3300044673 | Ga0453683_0174224 | Ga0453683_0174224_167_571 | 132 |
| 204 | 3300044673 | Ga0453683_0468656 | Ga0453683_0468656_379_783 | 132 |
| 205 | 3300044673 | Ga0453683_0801654 | Ga0453683_0801654_33_437 | 132 |
| 206 | 3300044712 | Ga0453684_0000406 | Ga0453684_0000406_52044_52448 | 132 |
| 207 | 3300044712 | Ga0453684_0000690 | Ga0453684_0000690_96782_97186 | 132 |
| 208 | 3300044712 | Ga0453684_0001524 | Ga0453684_0001524_53056_53460 | 132 |
| 209 | 3300044712 | Ga0453684_0003817 | Ga0453684_0003817_14964_15398 | 132 |
| 210 | 3300044712 | Ga0453684_0036054 | Ga0453684_0036054_3957_4361 | 132 |
| 211 | 3300044712 | Ga0453684_0054719 | Ga0453684_0054719_3724_4128 | 132 |
| 212 | 3300044712 | Ga0453684_0113714 | Ga0453684_0113714_64_468 | 132 |
| 213 | 3300044712 | Ga0453684_0414089 | Ga0453684_0414089_809_1213 | 132 |
| 214 | 3300044712 | Ga0453684_1371379 | Ga0453684_1371379_114_518 | 132 |
| 215 | 3300044712 | Ga0453684_1505467 | Ga0453684_1505467_199_609 | 132 |
| 216 | 3300045051 | Ga0451576_0000686 | Ga0451576_0000686_52241_52645 | 132 |
| 217 | 3300045051 | Ga0451576_0029836 | Ga0451576_0029836_282_686 | 132 |
| 218 | 3300045051 | Ga0451576_0035194 | Ga0451576_0035194_4663_5067 | 132 |
| 219 | 3300045051 | Ga0451576_0069195 | Ga0451576_0069195_2016_2471 | 132 |
| 220 | 3300045051 | Ga0451576_0202366 | Ga0451576_0202366_300_734 | 132 |
| 221 | 3300045051 | Ga0451576_0821629 | Ga0451576_0821629_464_868 | 132 |
| 222 | 3300045051 | Ga0451576_2388802 | Ga0451576_2388802_22_426 | 132 |
| 223 | 3300046473 | Ga0495582_0347424 | Ga0495582_0347424_433_843 | 132 |
| 224 | 3300046539 | Ga0495621_0316193 | Ga0495621_0316193_39_461 | 132 |
| 225 | 3300048907 | Ga0496104_0368133 | Ga0496104_0368133_650_1048 | 132 |
| 226 | 3300048928 | Ga0496125_0279955 | Ga0496125_0279955_184_582 | 132 |
| 227 | 3300049514 | Ga0501291_031615 | Ga0501291_031615_251_664 | 132 |
| 228 | 3300049571 | Ga0501034_0820929 | Ga0501034_0820929_250_687 | 132 |
| 229 | 3300049587 | Ga0501071_0114044 | Ga0501071_0114044_613_1035 | 132 |
| 230 | 3300049591 | Ga0501075_0258579 | Ga0501075_0258579_685_1104 | 132 |
| 231 | 3300049591 | Ga0501075_0623988 | Ga0501075_0623988_81_503 | 132 |
| 232 | 3300049592 | Ga0501076_1523988 | Ga0501076_1523988_53_475 | 132 |
| 233 | 3300049669 | Ga0501235_108140 | Ga0501235_108140_110_523 | 132 |
| 234 | 3300049741 | Ga0501079_0510765 | Ga0501079_0510765_210_632 | 132 |
| 235 | 3300049742 | Ga0501080_0441296 | Ga0501080_0441296_318_737 | 132 |
| 236 | 3300049743 | Ga0501081_0395485 | Ga0501081_0395485_384_815 | 132 |
| 237 | 3300049744 | Ga0501083_0960903 | Ga0501083_0960903_72_494 | 132 |
| 238 | 3300050507 | nmdc:mga05p37_218655_c1 | nmdc:mga05p37_218655_c1_1390_1791 | 132 |
| 239 | 3300050511 | nmdc:mga08y16_32634_c1 | nmdc:mga08y16_32634_c1_918_1334 | 132 |
| 240 | 3300050511 | nmdc:mga08y16_9301_c1 | nmdc:mga08y16_9301_c1_796_1194 | 132 |
| 241 | 3300050512 | nmdc:mga0n895_886444_c1 | nmdc:mga0n895_886444_c1_27_428 | 132 |
| 242 | 3300050512 | nmdc:mga0n895_89198_c1 | nmdc:mga0n895_89198_c1_1942_2361 | 132 |
| 243 | 3300050515 | nmdc:mga0a205_56528_c1 | nmdc:mga0a205_56528_c1_1212_1631 | 132 |
| 244 | 3300053087 | Ga0500643_003198 | Ga0500643_003198_970_1368 | 132 |
| 245 | 3300061734 | Ga0530510_0380254 | Ga0530510_0380254_219_641 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r3u-assembly1.cif.gz_C | crystal structure of 2-hydroxyisobutyryl-coa mutase | 0.9642 | 3 | 132 |
| 5cjw-assembly1.cif.gz_A | isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate pivalyl-coenzyme a | 0.9532 | 2 | 114 |
| 5cjt-assembly1.cif.gz_A | isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isobutyryl-coenzyme a | 0.9531 | 2 | 114 |
| 6oxd-assembly1.cif.gz_A | structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin | 0.9516 | 4 | 127 |
| 2yxb-assembly1.cif.gz_A | crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix | 0.9508 | 4 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9692 | 3 | 129 | 3.40.50.280 |
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9474 | 3 | 129 | 3.40.50.280 |
| af_A4I2L1_581_723_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9337 | 4 | 127 | 3.40.50.280 |
| 3bicB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9051 | 3 | 131 | 3.40.50.280 |
| 3bicB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.88 | 3 | 131 | 3.40.50.280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8C997-F1-model_v4 | Methylmalonyl-CoA mutase | 0.9957 | 29 | 129 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A7W0U635-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9929 | 26 | 129 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A842YD92-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9916 | 33 | 129 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A7V9I1Z1-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9888 | 2 | 129 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A5N9AL57-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9888 | 4 | 127 |
GO:0016853
GO:0031419 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar