F357602

General Info

Members Datasets Scaffolds Average Seq Length
245 136 245 135

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0301885|Ga0451576_0301885_1034_1438
Length 127
Sequence MSERKLRVLVGKPGLDGHDRGAKIISRAFRDAGFEIIYTGLHQTPEQIVSAAIQEDVDCVGLSILSGAHNTLLPQVCELLKDKKADDIIPDDDIPGLKAAGIKEVFTPGTSTEDIVAWVRNNVHPRA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
110 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10406290 3300005289 Bacteria 746
2 Ga0065715_10151285 3300005293 Bacteria 1693
3 Ga0070690_100034230 3300005330 Bacteria 3183
4 Ga0070670_100024763 3300005331 Bacteria 5162
5 Ga0070666_10017929 3300005335 Bacteria 4543
6 Ga0070666_10090624 3300005335 Bacteria 2100
7 Ga0068868_100261254 3300005338 Bacteria 1460
8 Ga0070669_100119825 3300005353 Bacteria 2006
9 Ga0070675_100000064 3300005354 Bacteria 62850
10 Ga0070675_100004222 3300005354 Bacteria 10927
11 Ga0070675_100008110 3300005354 Bacteria 8143
12 Ga0070675_100088231 3300005354 Bacteria 2595
13 Ga0070675_100125026 3300005354 Bacteria 2187
14 Ga0070675_100291906 3300005354 Bacteria 1435
15 Ga0070675_101027986 3300005354 Bacteria 757
16 Ga0070671_100006683 3300005355 Bacteria 9222
17 Ga0070671_100265131 3300005355 Bacteria 1460
18 Ga0070673_100008187 3300005364 Bacteria 6939
19 Ga0070673_100899984 3300005364 Bacteria 821
20 Ga0070673_101138820 3300005364 Bacteria 730
21 Ga0070688_100007483 3300005365 Bacteria 5891
22 Ga0070688_100313508 3300005365 Bacteria 1138
23 Ga0070688_100326657 3300005365 Bacteria 1116
24 Ga0070667_100015428 3300005367 Bacteria 6317
25 Ga0070701_10030561 3300005438 Bacteria 2666
26 Ga0070705_100129150 3300005440 Bacteria 1646
27 Ga0070694_101512574 3300005444 Bacteria 568
28 Ga0070678_100863219 3300005456 Bacteria 825
29 Ga0070662_100211843 3300005457 Bacteria 1542
30 Ga0070662_100393193 3300005457 Bacteria 1143
31 Ga0070681_10398497 3300005458 Bacteria 1288
32 Ga0070685_10037814 3300005466 Bacteria 2735
33 Ga0070685_10729547 3300005466 Bacteria 725
34 Ga0070707_100024196 3300005468 Bacteria 5748
35 Ga0070672_100007422 3300005543 Bacteria 7435
36 Ga0070672_101371254 3300005543 Bacteria 632
37 Ga0070686_100030571 3300005544 Bacteria 3286
38 Ga0070686_100370417 3300005544 Bacteria 1081
39 Ga0070665_100528873 3300005548 Bacteria 1191
40 Ga0070704_100032320 3300005549 Bacteria 3529
41 Ga0070704_100266129 3300005549 Bacteria 1414
42 Ga0070664_100010752 3300005564 Bacteria 7420
43 Ga0070664_100069589 3300005564 Bacteria 3012
44 Ga0070664_100209825 3300005564 Bacteria 1740
45 Ga0070664_100581375 3300005564 Bacteria 1038
46 Ga0070702_100316084 3300005615 Bacteria 1086
47 Ga0068859_100031690 3300005617 Bacteria 5309
48 Ga0068859_100032497 3300005617 Bacteria 5241
49 Ga0068864_100056547 3300005618 Bacteria 3390
50 Ga0068861_100219266 3300005719 Bacteria 1607
51 Ga0068870_10166220 3300005840 Bacteria 1313
52 Ga0068863_100001761 3300005841 Bacteria 21473
53 Ga0068863_100141699 3300005841 Bacteria 2298
54 Ga0068863_102052880 3300005841 Bacteria 582
55 Ga0068858_100002868 3300005842 Bacteria 17333
56 Ga0068860_100172047 3300005843 Bacteria 2092
57 Ga0068860_100870863 3300005843 Bacteria 916
58 Ga0068862_100256964 3300005844 Bacteria 1593
59 Ga0097621_100080761 3300006237 Bacteria 2705
60 Ga0075428_100012524 3300006844 Bacteria 9433
61 Ga0075433_10339504 3300006852 Bacteria 1328
62 Ga0097620_100031690 3300006931 Bacteria 5309
63 Ga0097620_100032497 3300006931 Bacteria 5241
64 Ga0075435_100437310 3300007076 Bacteria 1127
65 Ga0111539_10009746 3300009094 Bacteria 12123
66 Ga0111539_10022706 3300009094 Bacteria 7706
67 Ga0111539_10091449 3300009094 Bacteria 3575
68 Ga0111539_10601319 3300009094 Bacteria 1281
69 Ga0105245_11234379 3300009098 Unclassified 796
70 Ga0105245_12327460 3300009098 Bacteria 589
71 Ga0114129_10057350 3300009147 Bacteria 5450
72 Ga0114129_10305485 3300009147 Bacteria 2119
73 Ga0105242_10831236 3300009176 Bacteria 917
74 Ga0105248_10000363 3300009177 Bacteria 52947
75 Ga0105248_11833781 3300009177 Bacteria 688
76 Ga0105249_11122765 3300009553 Bacteria 856
77 Ga0105246_10367159 3300011119 Bacteria 1185
78 Ga0157374_10877496 3300013296 Bacteria 914
79 Ga0157378_12563067 3300013297 Bacteria 562
80 Ga0163162_10003664 3300013306 Bacteria 14740
81 Ga0163162_11235651 3300013306 Bacteria 848
82 Ga0163162_13227617 3300013306 Bacteria 523
83 Ga0157375_10002253 3300013308 Bacteria 16679
84 Ga0157375_10102371 3300013308 Bacteria 2948
85 Ga0157375_10900406 3300013308 Bacteria 1029
86 Ga0157375_11203437 3300013308 Bacteria 889
87 Ga0163163_10005936 3300014325 Bacteria 10630
88 Ga0163163_10195203 3300014325 Bacteria 2072
89 Ga0157380_10041967 3300014326 Bacteria 3573
90 Ga0157380_10361470 3300014326 Bacteria 1362
91 Ga0157380_10565662 3300014326 Bacteria 1118
92 Ga0157380_12321110 3300014326 Bacteria 601
93 Ga0157377_10243532 3300014745 Bacteria 1162
94 Ga0157377_10659361 3300014745 Unclassified 754
95 Ga0157379_10000421 3300014968 Bacteria 34236
96 Ga0157376_10196711 3300014969 Bacteria 1852
97 Ga0163161_10092328 3300017792 Bacteria 2241
98 Ga0207680_10311398 3300025903 Bacteria 1099
99 Ga0207645_11226854 3300025907 Archaea 503
100 Ga0207643_10133530 3300025908 Bacteria 1478
101 Ga0207660_10371942 3300025917 Bacteria 1148
102 Ga0207646_10543681 3300025922 Bacteria 1045
103 Ga0207650_10026368 3300025925 Bacteria 4145
104 Ga0207650_10262429 3300025925 Bacteria 1401
105 Ga0207650_10576323 3300025925 Bacteria 945
106 Ga0207659_10005526 3300025926 Bacteria 7668
107 Ga0207659_10009871 3300025926 Bacteria 5975
108 Ga0207659_10054233 3300025926 Bacteria 2862
109 Ga0207659_10097928 3300025926 Bacteria 2204
110 Ga0207659_10640216 3300025926 Bacteria 908
111 Ga0207659_10830535 3300025926 Bacteria 794
112 Ga0207687_11503790 3300025927 Unclassified 578
113 Ga0207644_10006542 3300025931 Bacteria 7594
114 Ga0207644_10842208 3300025931 Bacteria 768
115 Ga0207670_10639418 3300025936 Bacteria 876
116 Ga0207691_10002704 3300025940 Bacteria 17330
117 Ga0207711_10000638 3300025941 Bacteria 35113
118 Ga0207679_10006397 3300025945 Bacteria 7440
119 Ga0207679_10124615 3300025945 Bacteria 2057
120 Ga0207679_10232557 3300025945 Bacteria 1557
121 Ga0207651_10169032 3300025960 Bacteria 1722
122 Ga0207651_11358906 3300025960 Bacteria 639
123 Ga0207712_11129210 3300025961 Bacteria 698
124 Ga0207658_10006886 3300025986 Bacteria 7739
125 Ga0207677_10160750 3300026023 Bacteria 1745
126 Ga0207703_10003184 3300026035 Bacteria 13810
127 Ga0207641_10000514 3300026088 Bacteria 43419
128 Ga0207641_10492124 3300026088 Bacteria 1190
129 Ga0207641_10558493 3300026088 Bacteria 1117
130 Ga0207648_10623806 3300026089 Bacteria 995
131 Ga0207676_10433128 3300026095 Bacteria 1236
132 Ga0207674_10368981 3300026116 Bacteria 1388
133 Ga0207674_11925190 3300026116 Bacteria 557
134 Ga0207675_100496600 3300026118 Bacteria 1214
135 Ga0207675_101012869 3300026118 Bacteria 849
136 Ga0207683_10021594 3300026121 Bacteria 5516
137 Ga0207683_10967894 3300026121 Bacteria 790
138 Ga0209982_1028995 3300027552 Bacteria 867
139 Ga0209974_10021733 3300027876 Bacteria 2126
140 Ga0207428_10036788 3300027907 Bacteria 3988
141 Ga0207428_10145509 3300027907 Bacteria 1806
142 Ga0268266_11032146 3300028379 Bacteria 796
143 Ga0268264_10013759 3300028381 Bacteria 6656
144 Ga0268264_10203449 3300028381 Bacteria 1813
145 Ga0268264_10283501 3300028381 Bacteria 1553
146 Ga0268264_11562310 3300028381 Bacteria 670
147 Ga0265318_10009112 3300028577 Bacteria 4386
148 Ga0265322_10059677 3300028654 Bacteria 1082
149 Ga0265327_10013049 3300031251 Bacteria 5549
150 Ga0265327_10280407 3300031251 Bacteria 737
151 Ga0265316_10005406 3300031344 Bacteria 12416
152 Ga0316575_10126128 3300031665 Bacteria 1048
153 Ga0316579_10017868 3300031691 Bacteria 3116
154 Ga0316579_10055272 3300031691 Bacteria 1862
155 Ga0316576_10005504 3300031727 Bacteria 7749
156 Ga0316576_10258812 3300031727 Bacteria 1306
157 Ga0316576_10446794 3300031727 Bacteria 955
158 Ga0316578_10055845 3300031728 Bacteria 2318
159 Ga0316577_10000725 3300031733 Bacteria 14032
160 Ga0316577_10065773 3300031733 Bacteria 2024
161 Ga0316577_10834318 3300031733 Archaea 523
162 Ga0307409_101398731 3300031995 Bacteria 726
163 Ga0307416_100655033 3300032002 Bacteria 1135
164 Ga0307415_100862553 3300032126 Bacteria 832
165 Ga0316583_10002044 3300032133 Unclassified 6912
166 Ga0316583_10069277 3300032133 Bacteria 1234
167 Ga0373928_0006529 3300035084 Bacteria 2242
168 Ga0373956_0138478 3300035119 Bacteria 1142
169 Ga0373946_0032974 3300035171 Bacteria 2082
170 Ga0316574_0066656 3300035398 Bacteria 2269
171 Ga0373931_1006239 3300035691 Bacteria 564
172 Ga0373933_0497858 3300035724 Bacteria 798
173 Ga0316582_0077883 3300036647 Bacteria 2159
174 Ga0316582_0101057 3300036647 Bacteria 1910
175 Ga0316582_0129132 3300036647 Unclassified 1696
176 Ga0316582_0256960 3300036647 Unclassified 1197
177 Ga0316582_0978986 3300036647 Unclassified 578
178 Ga0316584_0007999 3300036712 Bacteria 7259
179 Ga0316584_0084734 3300036712 Bacteria 2373
180 Ga0316581_0025401 3300037588 Unclassified 1762
181 Ga0436362_0398418 3300039453 Bacteria 536
182 Ga0451791_1274883 3300041451 Bacteria 598
183 Ga0450896_025168 3300042133 Bacteria 884
184 Ga0439446_0140169 3300042156 Bacteria 789
185 Ga0451577_0000636 3300042876 Bacteria 56018
186 Ga0451577_0023400 3300042876 Bacteria 5634
187 Ga0451577_0028120 3300042876 Bacteria 5088
188 Ga0451577_0109958 3300042876 Bacteria 2465
189 Ga0451577_0133712 3300042876 Bacteria 2226
190 Ga0451577_0625124 3300042876 Bacteria 977
191 Ga0451577_0963145 3300042876 Bacteria 767
192 Ga0453683_0000107 3300044673 Bacteria 124376
193 Ga0453683_0000475 3300044673 Bacteria 46138
194 Ga0453683_0000773 3300044673 Bacteria 31774
195 Ga0453683_0047708 3300044673 Bacteria 2686
196 Ga0453683_0056419 3300044673 Bacteria 2458
197 Ga0453683_0090814 3300044673 Bacteria 1915
198 Ga0453683_0174224 3300044673 Bacteria 1363
199 Ga0453683_0468656 3300044673 Bacteria 816
200 Ga0453683_0558364 3300044673 Bacteria 745
201 Ga0453683_0600347 3300044673 Bacteria 718
202 Ga0453683_0801654 3300044673 Bacteria 620
203 Ga0453684_0000406 3300044712 Bacteria 177405
204 Ga0453684_0000690 3300044712 Bacteria 120137
205 Ga0453684_0001524 3300044712 Bacteria 64854
206 Ga0453684_0003817 3300044712 Bacteria 33232
207 Ga0453684_0036054 3300044712 Bacteria 6823
208 Ga0453684_0054719 3300044712 Bacteria 5195
209 Ga0453684_0113714 3300044712 Bacteria 3283
210 Ga0453684_0414089 3300044712 Bacteria 1507
211 Ga0453684_1061984 3300044712 Bacteria 858
212 Ga0453684_1371379 3300044712 Bacteria 734
213 Ga0453684_1505467 3300044712 Bacteria 694
214 Ga0451576_0000686 3300045051 Bacteria 68943
215 Ga0451576_0029836 3300045051 Bacteria 5834
216 Ga0451576_0035194 3300045051 Bacteria 5314
217 Ga0451576_0069195 3300045051 Bacteria 3673
218 Ga0451576_0202366 3300045051 Bacteria 2074
219 Ga0451576_0301885 3300045051 Bacteria 1675
220 Ga0451576_0821629 3300045051 Bacteria 976
221 Ga0451576_2388802 3300045051 Unclassified 541
222 Ga0495582_0347424 3300046473 Bacteria 854
223 Ga0495586_0424806 3300046535 Bacteria 766
224 Ga0495621_0316193 3300046539 Bacteria 650
225 Ga0496104_0368133 3300048907 Bacteria 1350
226 Ga0496125_0279955 3300048928 Bacteria 1034
227 Ga0501291_031615 3300049514 Bacteria 895
228 Ga0501034_0820929 3300049571 Bacteria 821
229 Ga0501071_0114044 3300049587 Bacteria 1999
230 Ga0501075_0258579 3300049591 Bacteria 1327
231 Ga0501075_0623988 3300049591 Bacteria 822
232 Ga0501076_1523988 3300049592 Bacteria 549
233 Ga0501235_108140 3300049669 Bacteria 685
234 Ga0501079_0510765 3300049741 Bacteria 945
235 Ga0501080_0441296 3300049742 Bacteria 1168
236 Ga0501081_0395485 3300049743 Bacteria 1023
237 Ga0501083_0960903 3300049744 Unclassified 556
238 nmdc:mga05p37_218655_c1 3300050507 Bacteria 2300
239 nmdc:mga08y16_32634_c1 3300050511 Bacteria 5473
240 nmdc:mga08y16_9301_c1 3300050511 Bacteria 10308
241 nmdc:mga0n895_886444_c1 3300050512 Bacteria 878
242 nmdc:mga0n895_89198_c1 3300050512 Bacteria 3084
243 nmdc:mga0a205_56528_c1 3300050515 Bacteria 3788
244 Ga0500643_003198 3300053087 Bacteria 7995
245 Ga0530510_0380254 3300061734 Bacteria 1063

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0625124 Ga0451577_0625124_10_411 109
2 3300025925 Ga0207650_10576323 Ga0207650_105763232 123
3 3300031691 Ga0316579_10017868 Ga0316579_100178684 125
4 3300031733 Ga0316577_10065773 Ga0316577_100657731 125
5 3300037588 Ga0316581_0025401 Ga0316581_0025401_1120_1503 125
6 3300042876 Ga0451577_0133712 Ga0451577_0133712_1203_1583 125
7 3300044712 Ga0453684_1061984 Ga0453684_1061984_156_536 125
8 3300045051 Ga0451576_0301885 Ga0451576_0301885_1034_1438 125
9 3300032126 Ga0307415_100862553 Ga0307415_1008625532 126
10 3300044673 Ga0453683_0558364 Ga0453683_0558364_143_535 129
11 3300005843 Ga0068860_100172047 Ga0068860_1001720472 130
12 3300028381 Ga0268264_10283501 Ga0268264_102835012 130
13 3300005354 Ga0070675_101027986 Ga0070675_1010279861 131
14 3300005355 Ga0070671_100265131 Ga0070671_1002651312 131
15 3300007076 Ga0075435_100437310 Ga0075435_1004373102 131
16 3300025926 Ga0207659_10830535 Ga0207659_108305352 131
17 3300026118 Ga0207675_100496600 Ga0207675_1004966003 131
18 3300026121 Ga0207683_10021594 Ga0207683_100215944 131
19 3300035171 Ga0373946_0032974 Ga0373946_0032974_1492_1902 131
20 3300044673 Ga0453683_0600347 Ga0453683_0600347_70_477 131
21 3300046535 Ga0495586_0424806 Ga0495586_0424806_225_635 131
22 3300005289 Ga0065704_10406290 Ga0065704_104062902 132
23 3300005293 Ga0065715_10151285 Ga0065715_101512852 132
24 3300005330 Ga0070690_100034230 Ga0070690_1000342302 132
25 3300005331 Ga0070670_100024763 Ga0070670_1000247633 132
26 3300005335 Ga0070666_10017929 Ga0070666_100179292 132
27 3300005335 Ga0070666_10090624 Ga0070666_100906242 132
28 3300005338 Ga0068868_100261254 Ga0068868_1002612542 132
29 3300005353 Ga0070669_100119825 Ga0070669_1001198252 132
30 3300005354 Ga0070675_100000064 Ga0070675_10000006422 132
31 3300005354 Ga0070675_100004222 Ga0070675_1000042228 132
32 3300005354 Ga0070675_100008110 Ga0070675_1000081107 132
33 3300005354 Ga0070675_100088231 Ga0070675_1000882313 132
34 3300005354 Ga0070675_100125026 Ga0070675_1001250262 132
35 3300005354 Ga0070675_100291906 Ga0070675_1002919061 132
36 3300005355 Ga0070671_100006683 Ga0070671_1000066835 132
37 3300005364 Ga0070673_100008187 Ga0070673_1000081876 132
38 3300005364 Ga0070673_100899984 Ga0070673_1008999842 132
39 3300005364 Ga0070673_101138820 Ga0070673_1011388201 132
40 3300005365 Ga0070688_100007483 Ga0070688_1000074836 132
41 3300005365 Ga0070688_100313508 Ga0070688_1003135082 132
42 3300005365 Ga0070688_100326657 Ga0070688_1003266572 132
43 3300005367 Ga0070667_100015428 Ga0070667_1000154285 132
44 3300005438 Ga0070701_10030561 Ga0070701_100305612 132
45 3300005440 Ga0070705_100129150 Ga0070705_1001291502 132
46 3300005444 Ga0070694_101512574 Ga0070694_1015125741 132
47 3300005456 Ga0070678_100863219 Ga0070678_1008632192 132
48 3300005457 Ga0070662_100211843 Ga0070662_1002118432 132
49 3300005457 Ga0070662_100393193 Ga0070662_1003931932 132
50 3300005458 Ga0070681_10398497 Ga0070681_103984972 132
51 3300005466 Ga0070685_10037814 Ga0070685_100378142 132
52 3300005466 Ga0070685_10729547 Ga0070685_107295471 132
53 3300005468 Ga0070707_100024196 Ga0070707_1000241962 132
54 3300005543 Ga0070672_100007422 Ga0070672_1000074222 132
55 3300005543 Ga0070672_101371254 Ga0070672_1013712542 132
56 3300005544 Ga0070686_100030571 Ga0070686_1000305714 132
57 3300005544 Ga0070686_100370417 Ga0070686_1003704172 132
58 3300005548 Ga0070665_100528873 Ga0070665_1005288732 132
59 3300005549 Ga0070704_100032320 Ga0070704_1000323202 132
60 3300005549 Ga0070704_100266129 Ga0070704_1002661292 132
61 3300005564 Ga0070664_100010752 Ga0070664_1000107525 132
62 3300005564 Ga0070664_100069589 Ga0070664_1000695893 132
63 3300005564 Ga0070664_100209825 Ga0070664_1002098252 132
64 3300005564 Ga0070664_100581375 Ga0070664_1005813752 132
65 3300005615 Ga0070702_100316084 Ga0070702_1003160842 132
66 3300005617 Ga0068859_100031690 Ga0068859_1000316904 132
67 3300005617 Ga0068859_100032497 Ga0068859_1000324976 132
68 3300005618 Ga0068864_100056547 Ga0068864_1000565473 132
69 3300005719 Ga0068861_100219266 Ga0068861_1002192662 132
70 3300005840 Ga0068870_10166220 Ga0068870_101662202 132
71 3300005841 Ga0068863_100001761 Ga0068863_1000017617 132
72 3300005841 Ga0068863_100141699 Ga0068863_1001416993 132
73 3300005841 Ga0068863_102052880 Ga0068863_1020528802 132
74 3300005842 Ga0068858_100002868 Ga0068858_10000286813 132
75 3300005843 Ga0068860_100870863 Ga0068860_1008708632 132
76 3300005844 Ga0068862_100256964 Ga0068862_1002569642 132
77 3300006237 Ga0097621_100080761 Ga0097621_1000807612 132
78 3300006844 Ga0075428_100012524 Ga0075428_1000125243 132
79 3300006852 Ga0075433_10339504 Ga0075433_103395042 132
80 3300006931 Ga0097620_100031690 Ga0097620_1000316904 132
81 3300006931 Ga0097620_100032497 Ga0097620_1000324976 132
82 3300009094 Ga0111539_10009746 Ga0111539_100097469 132
83 3300009094 Ga0111539_10022706 Ga0111539_100227062 132
84 3300009094 Ga0111539_10091449 Ga0111539_100914492 132
85 3300009094 Ga0111539_10601319 Ga0111539_106013192 132
86 3300009098 Ga0105245_11234379 Ga0105245_112343792 132
87 3300009098 Ga0105245_12327460 Ga0105245_123274602 132
88 3300009147 Ga0114129_10057350 Ga0114129_100573501 132
89 3300009147 Ga0114129_10305485 Ga0114129_103054852 132
90 3300009176 Ga0105242_10831236 Ga0105242_108312362 132
91 3300009177 Ga0105248_10000363 Ga0105248_1000036319 132
92 3300009177 Ga0105248_11833781 Ga0105248_118337812 132
93 3300009553 Ga0105249_11122765 Ga0105249_111227652 132
94 3300011119 Ga0105246_10367159 Ga0105246_103671592 132
95 3300013296 Ga0157374_10877496 Ga0157374_108774962 132
96 3300013297 Ga0157378_12563067 Ga0157378_125630672 132
97 3300013306 Ga0163162_10003664 Ga0163162_100036643 132
98 3300013306 Ga0163162_11235651 Ga0163162_112356512 132
99 3300013306 Ga0163162_13227617 Ga0163162_132276171 132
100 3300013308 Ga0157375_10002253 Ga0157375_100022537 132
101 3300013308 Ga0157375_10102371 Ga0157375_101023712 132
102 3300013308 Ga0157375_10900406 Ga0157375_109004062 132
103 3300013308 Ga0157375_11203437 Ga0157375_112034372 132
104 3300014325 Ga0163163_10005936 Ga0163163_100059368 132
105 3300014325 Ga0163163_10195203 Ga0163163_101952032 132
106 3300014326 Ga0157380_10041967 Ga0157380_100419672 132
107 3300014326 Ga0157380_10361470 Ga0157380_103614702 132
108 3300014326 Ga0157380_10565662 Ga0157380_105656622 132
109 3300014326 Ga0157380_12321110 Ga0157380_123211101 132
110 3300014745 Ga0157377_10243532 Ga0157377_102435322 132
111 3300014745 Ga0157377_10659361 Ga0157377_106593612 132
112 3300014968 Ga0157379_10000421 Ga0157379_100004219 132
113 3300014969 Ga0157376_10196711 Ga0157376_101967112 132
114 3300017792 Ga0163161_10092328 Ga0163161_100923282 132
115 3300025903 Ga0207680_10311398 Ga0207680_103113982 132
116 3300025907 Ga0207645_11226854 Ga0207645_112268541 132
117 3300025908 Ga0207643_10133530 Ga0207643_101335302 132
118 3300025917 Ga0207660_10371942 Ga0207660_103719421 132
119 3300025922 Ga0207646_10543681 Ga0207646_105436811 132
120 3300025925 Ga0207650_10026368 Ga0207650_100263683 132
121 3300025925 Ga0207650_10262429 Ga0207650_102624292 132
122 3300025926 Ga0207659_10005526 Ga0207659_100055266 132
123 3300025926 Ga0207659_10009871 Ga0207659_100098716 132
124 3300025926 Ga0207659_10054233 Ga0207659_100542332 132
125 3300025926 Ga0207659_10097928 Ga0207659_100979282 132
126 3300025926 Ga0207659_10640216 Ga0207659_106402162 132
127 3300025927 Ga0207687_11503790 Ga0207687_115037902 132
128 3300025931 Ga0207644_10006542 Ga0207644_100065427 132
129 3300025931 Ga0207644_10842208 Ga0207644_108422082 132
130 3300025936 Ga0207670_10639418 Ga0207670_106394182 132
131 3300025940 Ga0207691_10002704 Ga0207691_1000270413 132
132 3300025941 Ga0207711_10000638 Ga0207711_100006387 132
133 3300025945 Ga0207679_10006397 Ga0207679_100063975 132
134 3300025945 Ga0207679_10124615 Ga0207679_101246151 132
135 3300025945 Ga0207679_10232557 Ga0207679_102325572 132
136 3300025960 Ga0207651_10169032 Ga0207651_101690322 132
137 3300025960 Ga0207651_11358906 Ga0207651_113589062 132
138 3300025961 Ga0207712_11129210 Ga0207712_111292102 132
139 3300025986 Ga0207658_10006886 Ga0207658_100068866 132
140 3300026023 Ga0207677_10160750 Ga0207677_101607502 132
141 3300026035 Ga0207703_10003184 Ga0207703_100031844 132
142 3300026088 Ga0207641_10000514 Ga0207641_1000051419 132
143 3300026088 Ga0207641_10492124 Ga0207641_104921242 132
144 3300026088 Ga0207641_10558493 Ga0207641_105584932 132
145 3300026089 Ga0207648_10623806 Ga0207648_106238062 132
146 3300026095 Ga0207676_10433128 Ga0207676_104331281 132
147 3300026116 Ga0207674_10368981 Ga0207674_103689812 132
148 3300026116 Ga0207674_11925190 Ga0207674_119251901 132
149 3300026118 Ga0207675_101012869 Ga0207675_1010128692 132
150 3300026121 Ga0207683_10967894 Ga0207683_109678941 132
151 3300027552 Ga0209982_1028995 Ga0209982_10289952 132
152 3300027876 Ga0209974_10021733 Ga0209974_100217332 132
153 3300027907 Ga0207428_10036788 Ga0207428_100367885 132
154 3300027907 Ga0207428_10145509 Ga0207428_101455092 132
155 3300028379 Ga0268266_11032146 Ga0268266_110321462 132
156 3300028381 Ga0268264_10013759 Ga0268264_100137594 132
157 3300028381 Ga0268264_10203449 Ga0268264_102034493 132
158 3300028381 Ga0268264_11562310 Ga0268264_115623102 132
159 3300028577 Ga0265318_10009112 Ga0265318_100091122 132
160 3300028654 Ga0265322_10059677 Ga0265322_100596772 132
161 3300031251 Ga0265327_10013049 Ga0265327_100130496 132
162 3300031251 Ga0265327_10280407 Ga0265327_102804071 132
163 3300031344 Ga0265316_10005406 Ga0265316_1000540613 132
164 3300031665 Ga0316575_10126128 Ga0316575_101261282 132
165 3300031691 Ga0316579_10055272 Ga0316579_100552722 132
166 3300031727 Ga0316576_10005504 Ga0316576_100055043 132
167 3300031727 Ga0316576_10258812 Ga0316576_102588121 132
168 3300031727 Ga0316576_10446794 Ga0316576_104467942 132
169 3300031728 Ga0316578_10055845 Ga0316578_100558452 132
170 3300031733 Ga0316577_10000725 Ga0316577_100007257 132
171 3300031733 Ga0316577_10834318 Ga0316577_108343181 132
172 3300031995 Ga0307409_101398731 Ga0307409_1013987311 132
173 3300032002 Ga0307416_100655033 Ga0307416_1006550332 132
174 3300032133 Ga0316583_10002044 Ga0316583_100020442 132
175 3300032133 Ga0316583_10069277 Ga0316583_100692772 132
176 3300035084 Ga0373928_0006529 Ga0373928_0006529_154_558 132
177 3300035119 Ga0373956_0138478 Ga0373956_0138478_244_648 132
178 3300035398 Ga0316574_0066656 Ga0316574_0066656_1303_1719 132
179 3300035691 Ga0373931_1006239 Ga0373931_1006239_103_507 132
180 3300035724 Ga0373933_0497858 Ga0373933_0497858_196_615 132
181 3300036647 Ga0316582_0077883 Ga0316582_0077883_424_837 132
182 3300036647 Ga0316582_0101057 Ga0316582_0101057_346_762 132
183 3300036647 Ga0316582_0129132 Ga0316582_0129132_724_1131 132
184 3300036647 Ga0316582_0256960 Ga0316582_0256960_556_966 132
185 3300036647 Ga0316582_0978986 Ga0316582_0978986_71_478 132
186 3300036712 Ga0316584_0007999 Ga0316584_0007999_6245_6661 132
187 3300036712 Ga0316584_0084734 Ga0316584_0084734_981_1397 132
188 3300039453 Ga0436362_0398418 Ga0436362_0398418_85_486 132
189 3300041451 Ga0451791_1274883 Ga0451791_1274883_28_474 132
190 3300042133 Ga0450896_025168 Ga0450896_025168_50_478 132
191 3300042156 Ga0439446_0140169 Ga0439446_0140169_117_545 132
192 3300042876 Ga0451577_0000636 Ga0451577_0000636_10049_10483 132
193 3300042876 Ga0451577_0023400 Ga0451577_0023400_4301_4705 132
194 3300042876 Ga0451577_0028120 Ga0451577_0028120_1832_2236 132
195 3300042876 Ga0451577_0109958 Ga0451577_0109958_1067_1522 132
196 3300042876 Ga0451577_0963145 Ga0451577_0963145_142_546 132
197 3300044673 Ga0453683_0000107 Ga0453683_0000107_11395_11799 132
198 3300044673 Ga0453683_0000475 Ga0453683_0000475_5428_5829 132
199 3300044673 Ga0453683_0000773 Ga0453683_0000773_29446_29850 132
200 3300044673 Ga0453683_0047708 Ga0453683_0047708_406_810 132
201 3300044673 Ga0453683_0056419 Ga0453683_0056419_1995_2399 132
202 3300044673 Ga0453683_0090814 Ga0453683_0090814_976_1380 132
203 3300044673 Ga0453683_0174224 Ga0453683_0174224_167_571 132
204 3300044673 Ga0453683_0468656 Ga0453683_0468656_379_783 132
205 3300044673 Ga0453683_0801654 Ga0453683_0801654_33_437 132
206 3300044712 Ga0453684_0000406 Ga0453684_0000406_52044_52448 132
207 3300044712 Ga0453684_0000690 Ga0453684_0000690_96782_97186 132
208 3300044712 Ga0453684_0001524 Ga0453684_0001524_53056_53460 132
209 3300044712 Ga0453684_0003817 Ga0453684_0003817_14964_15398 132
210 3300044712 Ga0453684_0036054 Ga0453684_0036054_3957_4361 132
211 3300044712 Ga0453684_0054719 Ga0453684_0054719_3724_4128 132
212 3300044712 Ga0453684_0113714 Ga0453684_0113714_64_468 132
213 3300044712 Ga0453684_0414089 Ga0453684_0414089_809_1213 132
214 3300044712 Ga0453684_1371379 Ga0453684_1371379_114_518 132
215 3300044712 Ga0453684_1505467 Ga0453684_1505467_199_609 132
216 3300045051 Ga0451576_0000686 Ga0451576_0000686_52241_52645 132
217 3300045051 Ga0451576_0029836 Ga0451576_0029836_282_686 132
218 3300045051 Ga0451576_0035194 Ga0451576_0035194_4663_5067 132
219 3300045051 Ga0451576_0069195 Ga0451576_0069195_2016_2471 132
220 3300045051 Ga0451576_0202366 Ga0451576_0202366_300_734 132
221 3300045051 Ga0451576_0821629 Ga0451576_0821629_464_868 132
222 3300045051 Ga0451576_2388802 Ga0451576_2388802_22_426 132
223 3300046473 Ga0495582_0347424 Ga0495582_0347424_433_843 132
224 3300046539 Ga0495621_0316193 Ga0495621_0316193_39_461 132
225 3300048907 Ga0496104_0368133 Ga0496104_0368133_650_1048 132
226 3300048928 Ga0496125_0279955 Ga0496125_0279955_184_582 132
227 3300049514 Ga0501291_031615 Ga0501291_031615_251_664 132
228 3300049571 Ga0501034_0820929 Ga0501034_0820929_250_687 132
229 3300049587 Ga0501071_0114044 Ga0501071_0114044_613_1035 132
230 3300049591 Ga0501075_0258579 Ga0501075_0258579_685_1104 132
231 3300049591 Ga0501075_0623988 Ga0501075_0623988_81_503 132
232 3300049592 Ga0501076_1523988 Ga0501076_1523988_53_475 132
233 3300049669 Ga0501235_108140 Ga0501235_108140_110_523 132
234 3300049741 Ga0501079_0510765 Ga0501079_0510765_210_632 132
235 3300049742 Ga0501080_0441296 Ga0501080_0441296_318_737 132
236 3300049743 Ga0501081_0395485 Ga0501081_0395485_384_815 132
237 3300049744 Ga0501083_0960903 Ga0501083_0960903_72_494 132
238 3300050507 nmdc:mga05p37_218655_c1 nmdc:mga05p37_218655_c1_1390_1791 132
239 3300050511 nmdc:mga08y16_32634_c1 nmdc:mga08y16_32634_c1_918_1334 132
240 3300050511 nmdc:mga08y16_9301_c1 nmdc:mga08y16_9301_c1_796_1194 132
241 3300050512 nmdc:mga0n895_886444_c1 nmdc:mga0n895_886444_c1_27_428 132
242 3300050512 nmdc:mga0n895_89198_c1 nmdc:mga0n895_89198_c1_1942_2361 132
243 3300050515 nmdc:mga0a205_56528_c1 nmdc:mga0a205_56528_c1_1212_1631 132
244 3300053087 Ga0500643_003198 Ga0500643_003198_970_1368 132
245 3300061734 Ga0530510_0380254 Ga0530510_0380254_219_641 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02310

B12-binding

B12 binding domain

6

89

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.9642 3 132
5cjw-assembly1.cif.gz_A isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate pivalyl-coenzyme a 0.9532 2 114
5cjt-assembly1.cif.gz_A isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isobutyryl-coenzyme a 0.9531 2 114
6oxd-assembly1.cif.gz_A structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin 0.9516 4 127
2yxb-assembly1.cif.gz_A crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix 0.9508 4 131
ID Description Score Start End Superfamily
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9692 3 129 3.40.50.280
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9474 3 129 3.40.50.280
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9337 4 127 3.40.50.280
3bicB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9051 3 131 3.40.50.280
3bicB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.88 3 131 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A2V8C997-F1-model_v4 Methylmalonyl-CoA mutase 0.9957 29 129 GO:0016853
GO:0031419
GO:0046872
AF-A0A7W0U635-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9929 26 129 GO:0016853
GO:0031419
GO:0046872
AF-A0A842YD92-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9916 33 129 GO:0016853
GO:0031419
GO:0046872
AF-A0A7V9I1Z1-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9888 2 129 GO:0016853
GO:0031419
GO:0046872
AF-A0A5N9AL57-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9888 4 127 GO:0016853
GO:0031419
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map