F357601

General Info

Members Datasets Scaffolds Average Seq Length
245 107 490 63

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0261750|Ga0451576_0261750_663_878
Length 71
Sequence MHRIWLMFDPRRVMVALTGFLAVLALLIHFILLSSNRYGWIENGTLPAASAPVGATAPVAAAEMAPLPAGR

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
24 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
25 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
40 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
41 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
45 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
51 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
52 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
53 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
102 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
106 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
107 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.04
Metatranscriptomes 17.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 0.41
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0261750 3300045051 Bacteria 1808
2 rootH1_10095054 3300003316 Bacteria 3284
3 Ga0070667_102125195 3300005367 Bacteria 529
4 Ga0070710_10518182 3300005437 Bacteria 819
5 Ga0070711_100318499 3300005439 Bacteria 1242
6 Ga0068854_100832162 3300005578 Bacteria 807
7 Ga0068856_100400247 3300005614 Bacteria 1393
8 Ga0068852_102419028 3300005616 Bacteria 546
9 Ga0068860_100870720 3300005843 Bacteria 916
10 Ga0075364_10149782 3300006051 Bacteria 1572
11 Ga0070716_101235719 3300006173 Bacteria 601
12 Ga0105240_10946761 3300009093 Bacteria 924
13 Ga0105242_10318525 3300009176 Bacteria 1426
14 Ga0105248_10042613 3300009177 Bacteria 5091
15 Ga0105238_10799898 3300009551 Bacteria 958
16 Ga0105249_11557625 3300009553 Bacteria 733
17 Ga0105239_10151151 3300010375 Bacteria 2591
18 Ga0105239_12994927 3300010375 Bacteria 551
19 Ga0105246_11468982 3300011119 Bacteria 639
20 Ga0157370_11993974 3300013104 Bacteria 520
21 Ga0157374_11051534 3300013296 Bacteria 834
22 Ga0157372_11745329 3300013307 Bacteria 716
23 Ga0157372_11998769 3300013307 Bacteria 666
24 Ga0163163_10395546 3300014325 Bacteria 1440
25 Ga0157377_11682819 3300014745 Bacteria 511
26 Ga0157376_10576176 3300014969 Bacteria 1117
27 Ga0213874_10006325 3300021377 Bacteria 2802
28 Ga0213874_10053749 3300021377 Bacteria 1243
29 Ga0213874_10176045 3300021377 Bacteria 759
30 Ga0213874_10341263 3300021377 Bacteria 572
31 Ga0213876_10092084 3300021384 Bacteria 1605
32 Ga0213876_10121256 3300021384 Bacteria 1388
33 Ga0213876_10194019 3300021384 Bacteria 1080
34 Ga0213875_10019028 3300021388 Bacteria 3305
35 Ga0213875_10022971 3300021388 Bacteria 2982
36 Ga0213875_10024652 3300021388 Bacteria 2867
37 Ga0213875_10072367 3300021388 Bacteria 1609
38 Ga0213875_10079375 3300021388 Bacteria 1531
39 Ga0213875_10185421 3300021388 Bacteria 978
40 Ga0213875_10213924 3300021388 Bacteria 908
41 Ga0213871_10010017 3300021441 Bacteria 2139
42 Ga0207705_11219015 3300025909 Bacteria 577
43 Ga0207695_10037138 3300025913 Bacteria 5257
44 Ga0207663_10240568 3300025916 Bacteria 1327
45 Ga0207694_10613287 3300025924 Bacteria 915
46 Ga0207686_10206819 3300025934 Bacteria 1409
47 Ga0207658_11799100 3300025986 Bacteria 559
48 Ga0207641_12470401 3300026088 Bacteria 518
49 Ga0268266_10356423 3300028379 Bacteria 1376
50 Ga0268264_12531596 3300028381 Bacteria 518
51 Ga0265338_10975177 3300028800 Bacteria 575
52 Ga0265324_10132452 3300029957 Bacteria 846
53 Ga0265328_10011333 3300031239 Bacteria 3567
54 Ga0265329_10126888 3300031242 Bacteria 820
55 Ga0265340_10343998 3300031247 Bacteria 659
56 Ga0265316_10719388 3300031344 Bacteria 703
57 Ga0265316_11076741 3300031344 Unclassified 558
58 Ga0316575_10018206 3300031665 Bacteria 2675
59 Ga0316575_10075764 3300031665 Bacteria 1354
60 Ga0316579_10025358 3300031691 Bacteria 2675
61 Ga0316579_10153760 3300031691 Bacteria 1110
62 Ga0316576_10001249 3300031727 Bacteria 13470
63 Ga0316576_10010166 3300031727 Bacteria 6103
64 Ga0316576_10020637 3300031727 Bacteria 4542
65 Ga0316576_10033040 3300031727 Bacteria 3680
66 Ga0316576_10042225 3300031727 Bacteria 3286
67 Ga0316576_10113359 3300031727 Bacteria 2033
68 Ga0316576_10246529 3300031727 Bacteria 1341
69 Ga0316576_10495379 3300031727 Bacteria 899
70 Ga0316578_10000010 3300031728 Bacteria 44911
71 Ga0316578_10000103 3300031728 Bacteria 20042
72 Ga0316578_10033019 3300031728 Bacteria 2961
73 Ga0316578_10101318 3300031728 Bacteria 1726
74 Ga0316578_10105694 3300031728 Bacteria 1689
75 Ga0316578_10147286 3300031728 Bacteria 1418
76 Ga0316578_10209762 3300031728 Bacteria 1172
77 Ga0316578_10308601 3300031728 Bacteria 945
78 Ga0316578_10380712 3300031728 Bacteria 838
79 Ga0316578_10691602 3300031728 Bacteria 594
80 Ga0316577_10000190 3300031733 Bacteria 20350
81 Ga0316577_10000493 3300031733 Bacteria 15617
82 Ga0316577_10018804 3300031733 Bacteria 3822
83 Ga0316577_10336495 3300031733 Bacteria 856
84 Ga0316577_10351593 3300031733 Bacteria 836
85 Ga0307406_10034675 3300031901 Bacteria 3098
86 Ga0316583_10004375 3300032133 Bacteria 5039
87 Ga0316583_10012547 3300032133 Bacteria 3056
88 Ga0316583_10078505 3300032133 Bacteria 1154
89 Ga0316585_10002208 3300032137 Bacteria 5224
90 Ga0316585_10131421 3300032137 Bacteria 825
91 Ga0316585_10308936 3300032137 Bacteria 525
92 Ga0316580_10000006 3300032139 Bacteria 32316
93 Ga0316580_10057005 3300032139 Bacteria 1201
94 Ga0316580_10089186 3300032139 Bacteria 943
95 Ga0316580_10145352 3300032139 Bacteria 727
96 Ga0316593_10045514 3300032168 Bacteria 1471
97 Ga0316593_10180045 3300032168 Bacteria 777
98 Ga0316592_1000763 3300033524 Bacteria 4777
99 Ga0316592_1002932 3300033524 Bacteria 3008
100 Ga0316592_1006496 3300033524 Bacteria 2253
101 Ga0316592_1075077 3300033524 Bacteria 766
102 Ga0316592_1109452 3300033524 Bacteria 638
103 Ga0316592_1143396 3300033524 Bacteria 561
104 Ga0316586_1000210 3300033527 Bacteria 5006
105 Ga0316586_1000420 3300033527 Bacteria 4076
106 Ga0316586_1011509 3300033527 Bacteria 1356
107 Ga0316586_1035663 3300033527 Bacteria 863
108 Ga0316586_1061934 3300033527 Bacteria 681
109 Ga0316586_1074573 3300033527 Bacteria 628
110 Ga0316586_1095137 3300033527 Bacteria 565
111 Ga0316586_1119270 3300033527 Unclassified 514
112 Ga0316588_1000008 3300033528 Bacteria 13213
113 Ga0316588_1000125 3300033528 Bacteria 7838
114 Ga0316588_1002310 3300033528 Bacteria 3311
115 Ga0316588_1004640 3300033528 Bacteria 2617
116 Ga0316588_1046920 3300033528 Bacteria 1042
117 Ga0316588_1075831 3300033528 Bacteria 829
118 Ga0316588_1076231 3300033528 Unclassified 827
119 Ga0316588_1078819 3300033528 Bacteria 814
120 Ga0316588_1090423 3300033528 Bacteria 762
121 Ga0316588_1104110 3300033528 Bacteria 712
122 Ga0316588_1104919 3300033528 Bacteria 709
123 Ga0316588_1115780 3300033528 Bacteria 676
124 Ga0316588_1125233 3300033528 Bacteria 651
125 Ga0316588_1126895 3300033528 Bacteria 647
126 Ga0316588_1141788 3300033528 Bacteria 614
127 Ga0316588_1185976 3300033528 Bacteria 540
128 Ga0316588_1205351 3300033528 Bacteria 516
129 Ga0316588_1212831 3300033528 Bacteria 507
130 Ga0316587_1006771 3300033529 Bacteria 1762
131 Ga0316587_1029902 3300033529 Bacteria 960
132 Ga0316587_1038301 3300033529 Bacteria 862
133 Ga0316596_1002646 3300033541 Bacteria 3844
134 Ga0316596_1012129 3300033541 Bacteria 2115
135 Ga0316596_1027268 3300033541 Bacteria 1474
136 Ga0316596_1116368 3300033541 Bacteria 726
137 Ga0316596_1122066 3300033541 Bacteria 709
138 Ga0316596_1195236 3300033541 Bacteria 562
139 Ga0316574_0000087 3300035398 Bacteria 26351
140 Ga0316574_0026624 3300035398 Bacteria 3479
141 Ga0316574_0029396 3300035398 Bacteria 3320
142 Ga0316574_0034100 3300035398 Bacteria 3101
143 Ga0316574_0074427 3300035398 Bacteria 2149
144 Ga0316574_0109250 3300035398 Bacteria 1772
145 Ga0316574_0122803 3300035398 Bacteria 1668
146 Ga0316574_0214353 3300035398 Bacteria 1235
147 Ga0316574_0219920 3300035398 Bacteria 1217
148 Ga0316574_0527707 3300035398 Unclassified 734
149 Ga0316574_0890989 3300035398 Bacteria 539
150 Ga0373933_0848377 3300035724 Bacteria 601
151 Ga0316582_0000068 3300036647 Bacteria 26166
152 Ga0316582_0010989 3300036647 Bacteria 4989
153 Ga0316582_0233007 3300036647 Bacteria 1260
154 Ga0316582_0310030 3300036647 Bacteria 1085
155 Ga0316582_0877129 3300036647 Bacteria 614
156 Ga0316582_0959224 3300036647 Bacteria 584
157 Ga0316584_0008974 3300036712 Bacteria 6915
158 Ga0316584_0010912 3300036712 Bacteria 6364
159 Ga0316584_0013371 3300036712 Bacteria 5807
160 Ga0316584_0026029 3300036712 Bacteria 4296
161 Ga0316584_0032132 3300036712 Bacteria 3883
162 Ga0316584_0061819 3300036712 Bacteria 2804
163 Ga0316584_0084232 3300036712 Bacteria 2381
164 Ga0316584_0129766 3300036712 Bacteria 1883
165 Ga0316584_0329720 3300036712 Bacteria 1099
166 Ga0316584_0339539 3300036712 Bacteria 1080
167 Ga0316584_0418974 3300036712 Bacteria 951
168 Ga0316584_0440162 3300036712 Bacteria 923
169 Ga0316584_0670793 3300036712 Bacteria 713
170 Ga0316584_0895474 3300036712 Bacteria 598
171 Ga0395900_0160923 3300037418 Bacteria 2290
172 Ga0395898_0081381 3300037466 Bacteria 3123
173 Ga0316581_0245181 3300037588 Bacteria 550
174 Ga0436364_0283370 3300037853 Bacteria 8826
175 Ga0436364_0358239 3300037853 Bacteria 1096
176 Ga0436364_0507641 3300037853 Bacteria 2212
177 Ga0436364_0731834 3300037853 Bacteria 14258
178 Ga0436364_0755350 3300037853 Bacteria 1008
179 Ga0436364_1329069 3300037853 Bacteria 3023
180 Ga0436365_0201900 3300039437 Bacteria 6641
181 Ga0436365_0287586 3300039437 Bacteria 4234
182 Ga0436365_0322153 3300039437 Bacteria 608
183 Ga0436365_1074871 3300039437 Bacteria 2632
184 Ga0436365_1159328 3300039437 Bacteria 27033
185 Ga0436365_1556681 3300039437 Bacteria 1099
186 Ga0436360_0103241 3300039438 Bacteria 623
187 Ga0436360_0287017 3300039438 Bacteria 3577
188 Ga0436360_0584967 3300039438 Bacteria 5498
189 Ga0436360_0968550 3300039438 Bacteria 8130
190 Ga0436360_1011476 3300039438 Bacteria 2133
191 Ga0436360_1246210 3300039438 Bacteria 1003
192 Ga0436363_0010804 3300039450 Bacteria 858
193 Ga0436363_0059956 3300039450 Bacteria 5395
194 Ga0436363_0209843 3300039450 Bacteria 1343
195 Ga0436363_0636212 3300039450 Bacteria 589
196 Ga0436363_0758073 3300039450 Bacteria 523
197 Ga0436363_1105668 3300039450 Bacteria 1714
198 Ga0436363_1374025 3300039450 Bacteria 725
199 Ga0436362_0710022 3300039453 Bacteria 5671
200 Ga0451797_0987719 3300041453 Bacteria 825
201 Ga0451577_0007153 3300042876 Bacteria 11006
202 Ga0451577_0027182 3300042876 Bacteria 5179
203 Ga0451577_1814400 3300042876 Bacteria 535
204 Ga0453683_0621575 3300044673 Bacteria 705
205 Ga0466963_0761838 3300044694 Unclassified 683
206 Ga0466963_1231697 3300044694 Bacteria 526
207 Ga0453684_0037005 3300044712 Bacteria 6708
208 Ga0466968_0005506 3300044735 Bacteria 4741
209 Ga0466970_0165341 3300044765 Bacteria 1225
210 Ga0466960_0855011 3300044901 Bacteria 553
211 Ga0451576_0001939 3300045051 Bacteria 33033
212 Ga0451576_0064715 3300045051 Bacteria 3808
213 Ga0451576_0467240 3300045051 Bacteria 1325
214 Ga0466958_0631454 3300045836 Bacteria 697
215 Ga0495629_0320868 3300046459 Bacteria 1059
216 Ga0495662_0420706 3300046476 Bacteria 656
217 Ga0495664_0190764 3300046477 Bacteria 1242
218 Ga0495608_0663003 3300046511 Unclassified 623
219 Ga0495618_0227256 3300046514 Bacteria 1176
220 Ga0495618_0483910 3300046514 Unclassified 748
221 Ga0495628_0997566 3300046516 Unclassified 576
222 Ga0495630_0964173 3300046517 Bacteria 649
223 Ga0495640_0191587 3300046533 Bacteria 1299
224 Ga0495586_0100740 3300046535 Bacteria 1603
225 Ga0495667_0546492 3300046559 Unclassified 724
226 Ga0495667_0629492 3300046559 Bacteria 667
227 Ga0495635_0758093 3300046663 Bacteria 627
228 Ga0495657_0381322 3300046675 Bacteria 832
229 Ga0495599_0437428 3300046678 Bacteria 776
230 Ga0495646_0479228 3300046680 Bacteria 640
231 Ga0495600_0123653 3300046809 Bacteria 1683
232 Ga0495581_0247376 3300047315 Unclassified 1043
233 Ga0495674_0636196 3300047319 Bacteria 842
234 Ga0495675_0309938 3300047444 Bacteria 936
235 Ga0495686_0591539 3300047472 Bacteria 575
236 Ga0495593_0434490 3300047673 Bacteria 657
237 Ga0501323_046729 3300049539 Bacteria 648
238 Ga0501280_000887 3300049776 Bacteria 6403
239 Ga0501282_015130 3300049778 Bacteria 838
240 nmdc:mga0yw44_1011664_c1 3300050492 Bacteria 562
241 Ga0495601_0549656 3300053077 Bacteria 743
242 Ga0500635_0000034 3300053080 Bacteria 96919
243 Ga0500635_0032500 3300053080 Bacteria 1697
244 Ga0495595_0055330 3300053084 Bacteria 1847
245 Ga0495619_0247972 3300053085 Unclassified 1234
246 Ga0451576_0261750
247 rootH1_10095054
248 Ga0070667_102125195
249 Ga0070710_10518182
250 Ga0070711_100318499
251 Ga0068854_100832162
252 Ga0068856_100400247
253 Ga0068852_102419028
254 Ga0068860_100870720
255 Ga0075364_10149782
256 Ga0070716_101235719
257 Ga0105240_10946761
258 Ga0105242_10318525
259 Ga0105248_10042613
260 Ga0105238_10799898
261 Ga0105249_11557625
262 Ga0105239_10151151
263 Ga0105239_12994927
264 Ga0105246_11468982
265 Ga0157370_11993974
266 Ga0157374_11051534
267 Ga0157372_11745329
268 Ga0157372_11998769
269 Ga0163163_10395546
270 Ga0157377_11682819
271 Ga0157376_10576176
272 Ga0213874_10006325
273 Ga0213874_10053749
274 Ga0213874_10176045
275 Ga0213874_10341263
276 Ga0213876_10092084
277 Ga0213876_10121256
278 Ga0213876_10194019
279 Ga0213875_10019028
280 Ga0213875_10022971
281 Ga0213875_10024652
282 Ga0213875_10072367
283 Ga0213875_10079375
284 Ga0213875_10185421
285 Ga0213875_10213924
286 Ga0213871_10010017
287 Ga0207705_11219015
288 Ga0207695_10037138
289 Ga0207663_10240568
290 Ga0207694_10613287
291 Ga0207686_10206819
292 Ga0207658_11799100
293 Ga0207641_12470401
294 Ga0268266_10356423
295 Ga0268264_12531596
296 Ga0265338_10975177
297 Ga0265324_10132452
298 Ga0265328_10011333
299 Ga0265329_10126888
300 Ga0265340_10343998
301 Ga0265316_10719388
302 Ga0265316_11076741
303 Ga0316575_10018206
304 Ga0316575_10075764
305 Ga0316579_10025358
306 Ga0316579_10153760
307 Ga0316576_10001249
308 Ga0316576_10010166
309 Ga0316576_10020637
310 Ga0316576_10033040
311 Ga0316576_10042225
312 Ga0316576_10113359
313 Ga0316576_10246529
314 Ga0316576_10495379
315 Ga0316578_10000010
316 Ga0316578_10000103
317 Ga0316578_10033019
318 Ga0316578_10101318
319 Ga0316578_10105694
320 Ga0316578_10147286
321 Ga0316578_10209762
322 Ga0316578_10308601
323 Ga0316578_10380712
324 Ga0316578_10691602
325 Ga0316577_10000190
326 Ga0316577_10000493
327 Ga0316577_10018804
328 Ga0316577_10336495
329 Ga0316577_10351593
330 Ga0307406_10034675
331 Ga0316583_10004375
332 Ga0316583_10012547
333 Ga0316583_10078505
334 Ga0316585_10002208
335 Ga0316585_10131421
336 Ga0316585_10308936
337 Ga0316580_10000006
338 Ga0316580_10057005
339 Ga0316580_10089186
340 Ga0316580_10145352
341 Ga0316593_10045514
342 Ga0316593_10180045
343 Ga0316592_1000763
344 Ga0316592_1002932
345 Ga0316592_1006496
346 Ga0316592_1075077
347 Ga0316592_1109452
348 Ga0316592_1143396
349 Ga0316586_1000210
350 Ga0316586_1000420
351 Ga0316586_1011509
352 Ga0316586_1035663
353 Ga0316586_1061934
354 Ga0316586_1074573
355 Ga0316586_1095137
356 Ga0316586_1119270
357 Ga0316588_1000008
358 Ga0316588_1000125
359 Ga0316588_1002310
360 Ga0316588_1004640
361 Ga0316588_1046920
362 Ga0316588_1075831
363 Ga0316588_1076231
364 Ga0316588_1078819
365 Ga0316588_1090423
366 Ga0316588_1104110
367 Ga0316588_1104919
368 Ga0316588_1115780
369 Ga0316588_1125233
370 Ga0316588_1126895
371 Ga0316588_1141788
372 Ga0316588_1185976
373 Ga0316588_1205351
374 Ga0316588_1212831
375 Ga0316587_1006771
376 Ga0316587_1029902
377 Ga0316587_1038301
378 Ga0316596_1002646
379 Ga0316596_1012129
380 Ga0316596_1027268
381 Ga0316596_1116368
382 Ga0316596_1122066
383 Ga0316596_1195236
384 Ga0316574_0000087
385 Ga0316574_0026624
386 Ga0316574_0029396
387 Ga0316574_0034100
388 Ga0316574_0074427
389 Ga0316574_0109250
390 Ga0316574_0122803
391 Ga0316574_0214353
392 Ga0316574_0219920
393 Ga0316574_0527707
394 Ga0316574_0890989
395 Ga0373933_0848377
396 Ga0316582_0000068
397 Ga0316582_0010989
398 Ga0316582_0233007
399 Ga0316582_0310030
400 Ga0316582_0877129
401 Ga0316582_0959224
402 Ga0316584_0008974
403 Ga0316584_0010912
404 Ga0316584_0013371
405 Ga0316584_0026029
406 Ga0316584_0032132
407 Ga0316584_0061819
408 Ga0316584_0084232
409 Ga0316584_0129766
410 Ga0316584_0329720
411 Ga0316584_0339539
412 Ga0316584_0418974
413 Ga0316584_0440162
414 Ga0316584_0670793
415 Ga0316584_0895474
416 Ga0395900_0160923
417 Ga0395898_0081381
418 Ga0316581_0245181
419 Ga0436364_0283370
420 Ga0436364_0358239
421 Ga0436364_0507641
422 Ga0436364_0731834
423 Ga0436364_0755350
424 Ga0436364_1329069
425 Ga0436365_0201900
426 Ga0436365_0287586
427 Ga0436365_0322153
428 Ga0436365_1074871
429 Ga0436365_1159328
430 Ga0436365_1556681
431 Ga0436360_0103241
432 Ga0436360_0287017
433 Ga0436360_0584967
434 Ga0436360_0968550
435 Ga0436360_1011476
436 Ga0436360_1246210
437 Ga0436363_0010804
438 Ga0436363_0059956
439 Ga0436363_0209843
440 Ga0436363_0636212
441 Ga0436363_0758073
442 Ga0436363_1105668
443 Ga0436363_1374025
444 Ga0436362_0710022
445 Ga0451797_0987719
446 Ga0451577_0007153
447 Ga0451577_0027182
448 Ga0451577_1814400
449 Ga0453683_0621575
450 Ga0466963_0761838
451 Ga0466963_1231697
452 Ga0453684_0037005
453 Ga0466968_0005506
454 Ga0466970_0165341
455 Ga0466960_0855011
456 Ga0451576_0001939
457 Ga0451576_0064715
458 Ga0451576_0467240
459 Ga0466958_0631454
460 Ga0495629_0320868
461 Ga0495662_0420706
462 Ga0495664_0190764
463 Ga0495608_0663003
464 Ga0495618_0227256
465 Ga0495618_0483910
466 Ga0495628_0997566
467 Ga0495630_0964173
468 Ga0495640_0191587
469 Ga0495586_0100740
470 Ga0495667_0546492
471 Ga0495667_0629492
472 Ga0495635_0758093
473 Ga0495657_0381322
474 Ga0495599_0437428
475 Ga0495646_0479228
476 Ga0495600_0123653
477 Ga0495581_0247376
478 Ga0495674_0636196
479 Ga0495675_0309938
480 Ga0495686_0591539
481 Ga0495593_0434490
482 Ga0501323_046729
483 Ga0501280_000887
484 Ga0501282_015130
485 nmdc:mga0yw44_1011664_c1
486 Ga0495601_0549656
487 Ga0500635_0000034
488 Ga0500635_0032500
489 Ga0495595_0055330
490 Ga0495619_0247972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00556

LHC

Antenna complex alpha/beta subunit

1

41

0.92

Map