F357540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 245 | 175 | 243 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0041644|Ga0395905_0041644_2287_2967 |
| Length | 226 |
| Sequence | MPLPESKMRRLISGVFQSLDGVMQAPGGPTEDWTQGFTLGGWSATLWDDAMGQAIGGLFSQPFDLLLGRKTYEIFAAHWPYVGPDDPIGQAFDHCRKYVLTRGEEQLDWINSQRLAGIADVAALKQTDGPDLLIQGSSTLYPQLLAADLIDRLFVMTFPVVLGRGKRLFGEGTPSSAWRLVDHQVSTTGVMIATYEPAGAVPIGSFQMQEPSEAEQRRQERMKREG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 121 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 122 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 123 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 124 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 125 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 126 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 130 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 131 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 132 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 133 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 134 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 135 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 136 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 137 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 138 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 139 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 140 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 141 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 142 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 159 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 160 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 161 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 162 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 163 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 164 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 168 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 169 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 170 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 171 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 172 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 173 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 174 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 175 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.18 |
| Metatranscriptomes | 0 |
| Isolates | 0.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.96 |
| Nodule | 0 |
| Rhizoplane | 1.63 |
| Rhizosphere | 76.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001313 | 3300001989 | Bacteria | 9327 |
| 2 | JGI24737J22298_10000087 | 3300001990 | Bacteria | 27343 |
| 3 | JGI24737J22298_10006419 | 3300001990 | Bacteria | 4018 |
| 4 | JGI24735J21928_10004769 | 3300002067 | Bacteria | 4525 |
| 5 | JGI24735J21928_10005036 | 3300002067 | Bacteria | 4397 |
| 6 | JGI24735J21928_10032148 | 3300002067 | Bacteria | 1553 |
| 7 | JGI24735J21928_10036968 | 3300002067 | Bacteria | 1432 |
| 8 | JGI24735J21928_10042443 | 3300002067 | Bacteria | 1324 |
| 9 | JGI24738J21930_10001022 | 3300002075 | Bacteria | 7987 |
| 10 | JGI24738J21930_10001128 | 3300002075 | Bacteria | 7551 |
| 11 | JGI24744J21845_10000104 | 3300002077 | Bacteria | 11338 |
| 12 | rootH1_10116888 | 3300003323 | Bacteria | 4036 |
| 13 | JGI25160J50197_1012367 | 3300003354 | Bacteria | 2965 |
| 14 | Ga0055526_1013510 | 3300003771 | Bacteria | 3445 |
| 15 | Ga0055537_1001707 | 3300003773 | Bacteria | 8124 |
| 16 | Ga0055524_1000226 | 3300003775 | Bacteria | 59950 |
| 17 | Ga0055528_1002138 | 3300003790 | Bacteria | 10887 |
| 18 | Ga0055530_10009220 | 3300003791 | Bacteria | 3827 |
| 19 | Ga0055531_10007478 | 3300003794 | Bacteria | 5953 |
| 20 | Ga0055543_1012831 | 3300004625 | Bacteria | 1672 |
| 21 | Ga0065165_1000525 | 3300005262 | Bacteria | 58607 |
| 22 | Ga0065165_1020728 | 3300005262 | Bacteria | 2304 |
| 23 | Ga0065165_1060343 | 3300005262 | Bacteria | 1041 |
| 24 | Ga0070658_10000815 | 3300005327 | Bacteria | 26642 |
| 25 | Ga0070658_10003481 | 3300005327 | Bacteria | 12932 |
| 26 | Ga0070658_10116428 | 3300005327 | Bacteria | 2218 |
| 27 | Ga0070676_10004001 | 3300005328 | Bacteria | 7734 |
| 28 | Ga0068869_100005963 | 3300005334 | Bacteria | 7705 |
| 29 | Ga0068868_100000201 | 3300005338 | Bacteria | 40113 |
| 30 | Ga0070660_100106990 | 3300005339 | Bacteria | 2222 |
| 31 | Ga0070675_100047742 | 3300005354 | Bacteria | 3509 |
| 32 | Ga0070671_100021835 | 3300005355 | Bacteria | 5228 |
| 33 | Ga0070673_100000015 | 3300005364 | Bacteria | 118064 |
| 34 | Ga0070659_100109825 | 3300005366 | Bacteria | 2226 |
| 35 | Ga0070659_100240852 | 3300005366 | Bacteria | 1497 |
| 36 | Ga0070659_100241336 | 3300005366 | Bacteria | 1495 |
| 37 | Ga0070663_100000668 | 3300005455 | Bacteria | 18445 |
| 38 | Ga0070663_100021058 | 3300005455 | Bacteria | 4329 |
| 39 | Ga0070662_100008425 | 3300005457 | Bacteria | 6721 |
| 40 | Ga0070662_100171541 | 3300005457 | Bacteria | 1704 |
| 41 | Ga0068867_100000236 | 3300005459 | Bacteria | 36247 |
| 42 | Ga0070706_100804322 | 3300005467 | Bacteria | 870 |
| 43 | Ga0070707_100966255 | 3300005468 | Bacteria | 817 |
| 44 | Ga0070679_100202823 | 3300005530 | Bacteria | 1948 |
| 45 | Ga0068853_100024318 | 3300005539 | Bacteria | 5078 |
| 46 | Ga0068853_100035402 | 3300005539 | Bacteria | 4241 |
| 47 | Ga0068853_100214383 | 3300005539 | Bacteria | 1756 |
| 48 | Ga0070672_100031388 | 3300005543 | Bacteria | 3998 |
| 49 | Ga0070672_100177226 | 3300005543 | Bacteria | 1775 |
| 50 | Ga0068855_100005189 | 3300005563 | Bacteria | 15889 |
| 51 | Ga0068855_100218212 | 3300005563 | Bacteria | 2140 |
| 52 | Ga0068857_100117703 | 3300005577 | Bacteria | 2391 |
| 53 | Ga0068854_100000118 | 3300005578 | Bacteria | 54862 |
| 54 | Ga0068856_100002333 | 3300005614 | Bacteria | 19522 |
| 55 | Ga0068856_100041261 | 3300005614 | Bacteria | 4534 |
| 56 | Ga0068852_100000052 | 3300005616 | Bacteria | 80329 |
| 57 | Ga0068852_100252598 | 3300005616 | Bacteria | 1690 |
| 58 | Ga0068859_100205555 | 3300005617 | Bacteria | 2054 |
| 59 | Ga0068851_10107380 | 3300005834 | Bacteria | 1487 |
| 60 | Ga0068858_100000318 | 3300005842 | Bacteria | 51170 |
| 61 | Ga0068860_100384684 | 3300005843 | Bacteria | 1385 |
| 62 | Ga0075362_10306248 | 3300006177 | Bacteria | 789 |
| 63 | Ga0075366_10263460 | 3300006195 | Bacteria | 1052 |
| 64 | Ga0097621_100015294 | 3300006237 | Bacteria | 5771 |
| 65 | Ga0075370_10121444 | 3300006353 | Bacteria | 1521 |
| 66 | Ga0075370_10192507 | 3300006353 | Bacteria | 1202 |
| 67 | Ga0068871_100006602 | 3300006358 | Bacteria | 8226 |
| 68 | Ga0068865_100001212 | 3300006881 | Bacteria | 15028 |
| 69 | Ga0068865_100147099 | 3300006881 | Bacteria | 1783 |
| 70 | Ga0097620_100205572 | 3300006931 | Bacteria | 2054 |
| 71 | Ga0105240_10016005 | 3300009093 | Bacteria | 10166 |
| 72 | Ga0105245_10011115 | 3300009098 | Bacteria | 7836 |
| 73 | Ga0105243_10000445 | 3300009148 | Bacteria | 43080 |
| 74 | Ga0105241_10089416 | 3300009174 | Bacteria | 2426 |
| 75 | Ga0105241_11076171 | 3300009174 | Bacteria | 756 |
| 76 | Ga0105242_10008694 | 3300009176 | Bacteria | 7790 |
| 77 | Ga0105248_10025328 | 3300009177 | Bacteria | 6596 |
| 78 | Ga0105249_10009401 | 3300009553 | Bacteria | 8554 |
| 79 | Ga0099796_10028850 | 3300010159 | Bacteria | 1785 |
| 80 | Ga0105239_10073724 | 3300010375 | Bacteria | 3753 |
| 81 | Ga0105239_10146013 | 3300010375 | Bacteria | 2638 |
| 82 | Ga0105246_10004240 | 3300011119 | Bacteria | 8718 |
| 83 | Ga0157373_10003714 | 3300013100 | Bacteria | 11553 |
| 84 | Ga0157371_10094959 | 3300013102 | Bacteria | 2113 |
| 85 | Ga0157369_10444860 | 3300013105 | Bacteria | 1342 |
| 86 | Ga0157374_10005712 | 3300013296 | Bacteria | 10496 |
| 87 | Ga0157374_10006198 | 3300013296 | Bacteria | 10136 |
| 88 | Ga0157378_10000394 | 3300013297 | Bacteria | 43079 |
| 89 | Ga0163162_10035494 | 3300013306 | Bacteria | 4967 |
| 90 | Ga0163162_10265099 | 3300013306 | Bacteria | 1849 |
| 91 | Ga0157372_10013070 | 3300013307 | Bacteria | 8856 |
| 92 | Ga0157372_10097695 | 3300013307 | Bacteria | 3350 |
| 93 | Ga0157372_10167549 | 3300013307 | Bacteria | 2541 |
| 94 | Ga0157372_10278079 | 3300013307 | Bacteria | 1946 |
| 95 | Ga0157372_10532082 | 3300013307 | Bacteria | 1370 |
| 96 | Ga0157375_10004676 | 3300013308 | Bacteria | 11907 |
| 97 | Ga0157376_10000078 | 3300014969 | Bacteria | 72879 |
| 98 | Ga0207425_1009889 | 3300025245 | Bacteria | 2348 |
| 99 | Ga0209148_1000146 | 3300025254 | Bacteria | 160734 |
| 100 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 101 | Ga0209455_1026098 | 3300025272 | Bacteria | 1052 |
| 102 | Ga0209673_1000014 | 3300025273 | Bacteria | 537082 |
| 103 | Ga0209673_1000018 | 3300025273 | Bacteria | 458281 |
| 104 | Ga0209673_1001068 | 3300025273 | Bacteria | 31210 |
| 105 | Ga0209564_1013537 | 3300025295 | Bacteria | 3454 |
| 106 | Ga0209564_1016455 | 3300025295 | Bacteria | 2942 |
| 107 | Ga0209758_1004820 | 3300025297 | Bacteria | 10891 |
| 108 | Ga0209758_1010407 | 3300025297 | Bacteria | 5570 |
| 109 | Ga0209050_1000481 | 3300025298 | Bacteria | 70155 |
| 110 | Ga0209050_1006920 | 3300025298 | Bacteria | 6552 |
| 111 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 112 | Ga0207426_1002884 | 3300025302 | Bacteria | 10177 |
| 113 | Ga0209257_1002047 | 3300025304 | Bacteria | 21436 |
| 114 | Ga0207642_10332459 | 3300025899 | Bacteria | 891 |
| 115 | Ga0207647_10000604 | 3300025904 | Bacteria | 27991 |
| 116 | Ga0207647_10003389 | 3300025904 | Bacteria | 11949 |
| 117 | Ga0207647_10019991 | 3300025904 | Bacteria | 4495 |
| 118 | Ga0207645_10006551 | 3300025907 | Bacteria | 8336 |
| 119 | Ga0207705_10000025 | 3300025909 | Bacteria | 259826 |
| 120 | Ga0207705_10000756 | 3300025909 | Bacteria | 26658 |
| 121 | Ga0207684_10719935 | 3300025910 | Bacteria | 847 |
| 122 | Ga0207695_10005706 | 3300025913 | Bacteria | 16411 |
| 123 | Ga0207657_10003967 | 3300025919 | Bacteria | 15717 |
| 124 | Ga0207657_10142299 | 3300025919 | Bacteria | 1959 |
| 125 | Ga0207657_10214510 | 3300025919 | Bacteria | 1543 |
| 126 | Ga0207652_10057198 | 3300025921 | Bacteria | 3358 |
| 127 | Ga0207646_10132513 | 3300025922 | Bacteria | 2244 |
| 128 | Ga0207659_10011485 | 3300025926 | Bacteria | 5596 |
| 129 | Ga0207644_10393638 | 3300025931 | Bacteria | 1131 |
| 130 | Ga0207690_10048978 | 3300025932 | Bacteria | 2814 |
| 131 | Ga0207690_10054178 | 3300025932 | Bacteria | 2695 |
| 132 | Ga0207690_10139641 | 3300025932 | Bacteria | 1784 |
| 133 | Ga0207706_10001626 | 3300025933 | Bacteria | 22272 |
| 134 | Ga0207706_10109312 | 3300025933 | Bacteria | 2433 |
| 135 | Ga0207706_10244280 | 3300025933 | Bacteria | 1569 |
| 136 | Ga0207686_10004020 | 3300025934 | Bacteria | 7890 |
| 137 | Ga0207709_10000118 | 3300025935 | Bacteria | 122125 |
| 138 | Ga0207704_10000027 | 3300025938 | Bacteria | 122372 |
| 139 | Ga0207691_10033022 | 3300025940 | Bacteria | 4821 |
| 140 | Ga0207691_10183853 | 3300025940 | Bacteria | 1825 |
| 141 | Ga0207711_10012992 | 3300025941 | Bacteria | 6918 |
| 142 | Ga0207689_10011327 | 3300025942 | Bacteria | 7650 |
| 143 | Ga0207689_10607484 | 3300025942 | Bacteria | 920 |
| 144 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 145 | Ga0207651_10000016 | 3300025960 | Bacteria | 122094 |
| 146 | Ga0207712_10005023 | 3300025961 | Bacteria | 8369 |
| 147 | Ga0207640_10000085 | 3300025981 | Bacteria | 73838 |
| 148 | Ga0207677_10000573 | 3300026023 | Bacteria | 22918 |
| 149 | Ga0207703_10004368 | 3300026035 | Bacteria | 11617 |
| 150 | Ga0207639_10035163 | 3300026041 | Bacteria | 3707 |
| 151 | Ga0207639_10041164 | 3300026041 | Bacteria | 3455 |
| 152 | Ga0207639_10076428 | 3300026041 | Bacteria | 2637 |
| 153 | Ga0207678_10001976 | 3300026067 | Bacteria | 18682 |
| 154 | Ga0207678_10135572 | 3300026067 | Bacteria | 2100 |
| 155 | Ga0207678_10354253 | 3300026067 | Bacteria | 1266 |
| 156 | Ga0207702_10003111 | 3300026078 | Bacteria | 15373 |
| 157 | Ga0207702_10046485 | 3300026078 | Bacteria | 3654 |
| 158 | Ga0207702_10725874 | 3300026078 | Bacteria | 980 |
| 159 | Ga0207648_10000482 | 3300026089 | Bacteria | 44351 |
| 160 | Ga0207676_10772431 | 3300026095 | Bacteria | 936 |
| 161 | Ga0207674_10033823 | 3300026116 | Bacteria | 5348 |
| 162 | Ga0207683_10002831 | 3300026121 | Bacteria | 15159 |
| 163 | Ga0207698_10000198 | 3300026142 | Bacteria | 37741 |
| 164 | Ga0207698_10377822 | 3300026142 | Bacteria | 1347 |
| 165 | Ga0268264_10302001 | 3300028381 | Bacteria | 1507 |
| 166 | Ga0265338_10485594 | 3300028800 | Bacteria | 871 |
| 167 | Ga0307508_10000550 | 3300031616 | Bacteria | 44447 |
| 168 | Ga0373937_0064678 | 3300036401 | Bacteria | 3365 |
| 169 | Ga0395900_0155924 | 3300037418 | Bacteria | 2332 |
| 170 | Ga0395900_0454853 | 3300037418 | Bacteria | 1236 |
| 171 | Ga0395905_0041644 | 3300037471 | Bacteria | 4310 |
| 172 | Ga0395905_0108495 | 3300037471 | Bacteria | 2606 |
| 173 | Ga0395905_0603537 | 3300037471 | Bacteria | 999 |
| 174 | Ga0395901_0020753 | 3300038443 | Bacteria | 6726 |
| 175 | Ga0436363_0307925 | 3300039450 | Bacteria | 1537 |
| 176 | Ga0439436_0015108 | 3300041404 | Bacteria | 2323 |
| 177 | Ga0439436_0018976 | 3300041404 | Bacteria | 2055 |
| 178 | Ga0439439_0054186 | 3300041406 | Bacteria | 1056 |
| 179 | Ga0439439_0068946 | 3300041406 | Bacteria | 945 |
| 180 | Ga0439461_0000038 | 3300041410 | Bacteria | 16271 |
| 181 | Ga0439466_0105330 | 3300041411 | Bacteria | 877 |
| 182 | Ga0439465_0001731 | 3300041413 | Bacteria | 7139 |
| 183 | Ga0439465_0056611 | 3300041413 | Bacteria | 1292 |
| 184 | Ga0451793_0822967 | 3300041452 | Bacteria | 1771 |
| 185 | Ga0451802_0050544 | 3300041460 | Bacteria | 2552 |
| 186 | Ga0451807_0413610 | 3300041486 | Bacteria | 2848 |
| 187 | Ga0439431_0000211 | 3300041997 | Bacteria | 11608 |
| 188 | Ga0439442_000819 | 3300042002 | Bacteria | 6438 |
| 189 | Ga0439445_0024896 | 3300042004 | Bacteria | 1524 |
| 190 | Ga0439445_0049497 | 3300042004 | Bacteria | 1132 |
| 191 | Ga0439448_0002944 | 3300042005 | Bacteria | 4673 |
| 192 | Ga0439448_0005395 | 3300042005 | Bacteria | 3644 |
| 193 | Ga0439432_000877 | 3300042006 | Bacteria | 11269 |
| 194 | Ga0439450_037327 | 3300042008 | Bacteria | 1116 |
| 195 | Ga0439452_036650 | 3300042010 | Bacteria | 1174 |
| 196 | Ga0439455_0000361 | 3300042012 | Bacteria | 5911 |
| 197 | Ga0439455_0001231 | 3300042012 | Bacteria | 4190 |
| 198 | Ga0439455_0003075 | 3300042012 | Bacteria | 3136 |
| 199 | Ga0439462_0003378 | 3300042015 | Bacteria | 3827 |
| 200 | Ga0439462_0011114 | 3300042015 | Bacteria | 2288 |
| 201 | Ga0439446_0015138 | 3300042156 | Bacteria | 2137 |
| 202 | Ga0439458_0000415 | 3300042157 | Bacteria | 10732 |
| 203 | Ga0439458_0000568 | 3300042157 | Bacteria | 9503 |
| 204 | Ga0439434_0002786 | 3300042435 | Bacteria | 5098 |
| 205 | Ga0466972_0001273 | 3300044658 | Bacteria | 12167 |
| 206 | Ga0466965_0106033 | 3300044683 | Bacteria | 1441 |
| 207 | Ga0466966_0009843 | 3300044684 | Bacteria | 6337 |
| 208 | Ga0466961_0027839 | 3300044693 | Bacteria | 3634 |
| 209 | Ga0466964_0002598 | 3300044706 | Bacteria | 6449 |
| 210 | Ga0466968_0021573 | 3300044735 | Bacteria | 2609 |
| 211 | Ga0466970_0004885 | 3300044765 | Bacteria | 6620 |
| 212 | Ga0466960_0001185 | 3300044901 | Bacteria | 9393 |
| 213 | Ga0466959_0017484 | 3300045049 | Bacteria | 5256 |
| 214 | Ga0466958_0084236 | 3300045836 | Bacteria | 1960 |
| 215 | Ga0466958_0210151 | 3300045836 | Bacteria | 1240 |
| 216 | Ga0495638_0002975 | 3300046460 | Bacteria | 13525 |
| 217 | Ga0495641_0236508 | 3300046461 | Bacteria | 820 |
| 218 | Ga0495625_0001098 | 3300046660 | Bacteria | 35115 |
| 219 | Ga0495649_0026356 | 3300046694 | Bacteria | 3233 |
| 220 | Ga0495687_042422 | 3300047443 | Bacteria | 1988 |
| 221 | Ga0495686_0013725 | 3300047472 | Bacteria | 5613 |
| 222 | Ga0496100_0410185 | 3300048903 | Bacteria | 1033 |
| 223 | Ga0496117_0140505 | 3300048920 | Bacteria | 1447 |
| 224 | Ga0496118_0036599 | 3300048921 | Bacteria | 3964 |
| 225 | Ga0496120_0040389 | 3300048923 | Bacteria | 2742 |
| 226 | Ga0496121_0009365 | 3300048924 | Bacteria | 11280 |
| 227 | Ga0496122_0029814 | 3300048925 | Bacteria | 4589 |
| 228 | Ga0496123_0101299 | 3300048926 | Bacteria | 1674 |
| 229 | Ga0501035_0355702 | 3300049822 | Bacteria | 1225 |
| 230 | Ga0501044_0080147 | 3300049823 | Bacteria | 3307 |
| 231 | nmdc:mga07m45_178091_c1 | 3300050496 | Bacteria | 1236 |
| 232 | nmdc:mga07m45_20988_c1 | 3300050496 | Bacteria | 3552 |
| 233 | nmdc:mga0sz30_354471_c1 | 3300050516 | Bacteria | 656 |
| 234 | Ga0500643_010345 | 3300053087 | Bacteria | 3480 |
| 235 | Ga0500643_081307 | 3300053087 | Bacteria | 889 |
| 236 | Ga0500651_0331507 | 3300053093 | Bacteria | 867 |
| 237 | Ga0500556_0104594 | 3300053104 | Bacteria | 1093 |
| 238 | Ga0500595_000700 | 3300053119 | Bacteria | 20020 |
| 239 | Ga0500658_0006669 | 3300053134 | Bacteria | 4278 |
| 240 | Ga0500658_0008330 | 3300053134 | Bacteria | 3832 |
| 241 | Ga0500658_0051426 | 3300053134 | Bacteria | 1684 |
| 242 | Ga0500559_0073774 | 3300053136 | Bacteria | 1540 |
| 243 | Ga0500645_002595 | 3300053730 | Bacteria | 7942 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046461 | Ga0495641_0236508 | Ga0495641_0236508_35_595 | 184 |
| 2 | 3300005355 | Ga0070671_100021835 | Ga0070671_1000218356 | 191 |
| 3 | 3300005455 | Ga0070663_100021058 | Ga0070663_1000210586 | 191 |
| 4 | 3300025931 | Ga0207644_10393638 | Ga0207644_103936381 | 191 |
| 5 | 3300026067 | Ga0207678_10135572 | Ga0207678_101355722 | 191 |
| 6 | 3300042005 | Ga0439448_0002944 | Ga0439448_0002944_353_1012 | 191 |
| 7 | 3300042012 | Ga0439455_0001231 | Ga0439455_0001231_3444_4103 | 191 |
| 8 | 3300048920 | Ga0496117_0140505 | Ga0496117_0140505_486_1145 | 195 |
| 9 | 3300048921 | Ga0496118_0036599 | Ga0496118_0036599_2933_3592 | 195 |
| 10 | 3300048923 | Ga0496120_0040389 | Ga0496120_0040389_1442_2101 | 195 |
| 11 | 3300048924 | Ga0496121_0009365 | Ga0496121_0009365_3227_3886 | 195 |
| 12 | 3300048925 | Ga0496122_0029814 | Ga0496122_0029814_2324_2983 | 195 |
| 13 | 3300048926 | Ga0496123_0101299 | Ga0496123_0101299_946_1605 | 195 |
| 14 | 3300013306 | Ga0163162_10035494 | Ga0163162_100354948 | 200 |
| 15 | 3300026095 | Ga0207676_10772431 | Ga0207676_107724311 | 200 |
| 16 | 3300044683 | Ga0466965_0106033 | Ga0466965_0106033_359_1033 | 200 |
| 17 | 3300044684 | Ga0466966_0009843 | Ga0466966_0009843_2271_2945 | 200 |
| 18 | 3300044693 | Ga0466961_0027839 | Ga0466961_0027839_451_1125 | 200 |
| 19 | 3300044765 | Ga0466970_0004885 | Ga0466970_0004885_2475_3149 | 200 |
| 20 | 3300045049 | Ga0466959_0017484 | Ga0466959_0017484_100_774 | 200 |
| 21 | 3300045836 | Ga0466958_0084236 | Ga0466958_0084236_478_1152 | 200 |
| 22 | 3300005467 | Ga0070706_100804322 | Ga0070706_1008043221 | 201 |
| 23 | 3300005468 | Ga0070707_100966255 | Ga0070707_1009662551 | 201 |
| 24 | 3300025910 | Ga0207684_10719935 | Ga0207684_107199352 | 201 |
| 25 | 3300025922 | Ga0207646_10132513 | Ga0207646_101325132 | 201 |
| 26 | 3300042010 | Ga0439452_036650 | Ga0439452_036650_517_1155 | 202 |
| 27 | 3300010375 | Ga0105239_10073724 | Ga0105239_100737246 | 203 |
| 28 | 3300042156 | Ga0439446_0015138 | Ga0439446_0015138_10_624 | 204 |
| 29 | 3300050516 | nmdc:mga0sz30_354471_c1 | nmdc:mga0sz30_354471_c1_32_646 | 204 |
| 30 | 3300046460 | Ga0495638_0002975 | Ga0495638_0002975_4925_5587 | 205 |
| 31 | 3300028800 | Ga0265338_10485594 | Ga0265338_104855941 | 206 |
| 32 | 3300005563 | Ga0068855_100005189 | Ga0068855_10000518910 | 209 |
| 33 | 3300013307 | Ga0157372_10167549 | Ga0157372_101675495 | 209 |
| 34 | 3300025949 | Ga0207667_10000035 | Ga0207667_100000359 | 209 |
| 35 | 3300041406 | Ga0439439_0068946 | Ga0439439_0068946_215_874 | 209 |
| 36 | 3300041413 | Ga0439465_0001731 | Ga0439465_0001731_4677_5336 | 209 |
| 37 | 3300042004 | Ga0439445_0049497 | Ga0439445_0049497_440_1099 | 209 |
| 38 | 3300053134 | Ga0500658_0006669 | Ga0500658_0006669_3067_3729 | 212 |
| 39 | iso_pu_bacteria | 2643221622 | 2644125695 | 215 |
| 40 | iso_pu_bacteria | 8057101203 | 8057105550 | 215 |
| 41 | 3300003354 | JGI25160J50197_1012367 | JGI25160J50197_10123673 | 218 |
| 42 | 3300003771 | Ga0055526_1013510 | Ga0055526_10135101 | 218 |
| 43 | 3300003790 | Ga0055528_1002138 | Ga0055528_10021387 | 218 |
| 44 | 3300003791 | Ga0055530_10009220 | Ga0055530_100092202 | 218 |
| 45 | 3300004625 | Ga0055543_1012831 | Ga0055543_10128312 | 218 |
| 46 | 3300005262 | Ga0065165_1000525 | Ga0065165_100052555 | 218 |
| 47 | 3300005530 | Ga0070679_100202823 | Ga0070679_1002028232 | 218 |
| 48 | 3300005563 | Ga0068855_100218212 | Ga0068855_1002182121 | 218 |
| 49 | 3300005842 | Ga0068858_100000318 | Ga0068858_10000031831 | 218 |
| 50 | 3300013306 | Ga0163162_10265099 | Ga0163162_102650993 | 218 |
| 51 | 3300013307 | Ga0157372_10097695 | Ga0157372_100976954 | 218 |
| 52 | 3300025272 | Ga0209455_1026098 | Ga0209455_10260982 | 218 |
| 53 | 3300025273 | Ga0209673_1000014 | Ga0209673_1000014264 | 218 |
| 54 | 3300025273 | Ga0209673_1000018 | Ga0209673_1000018212 | 218 |
| 55 | 3300025295 | Ga0209564_1013537 | Ga0209564_10135372 | 218 |
| 56 | 3300025297 | Ga0209758_1004820 | Ga0209758_10048208 | 218 |
| 57 | 3300025298 | Ga0209050_1000481 | Ga0209050_10004819 | 218 |
| 58 | 3300025302 | Ga0207426_1002884 | Ga0207426_100288412 | 218 |
| 59 | 3300025921 | Ga0207652_10057198 | Ga0207652_100571983 | 218 |
| 60 | 3300025942 | Ga0207689_10607484 | Ga0207689_106074841 | 218 |
| 61 | 3300026035 | Ga0207703_10004368 | Ga0207703_1000436811 | 218 |
| 62 | 3300031616 | Ga0307508_10000550 | Ga0307508_1000055033 | 218 |
| 63 | 3300046660 | Ga0495625_0001098 | Ga0495625_0001098_29690_30352 | 218 |
| 64 | 3300047472 | Ga0495686_0013725 | Ga0495686_0013725_2308_2970 | 218 |
| 65 | 3300053093 | Ga0500651_0331507 | Ga0500651_0331507_194_856 | 218 |
| 66 | 3300053136 | Ga0500559_0073774 | Ga0500559_0073774_162_824 | 218 |
| 67 | 3300001990 | JGI24737J22298_10006419 | JGI24737J22298_100064192 | 219 |
| 68 | 3300002067 | JGI24735J21928_10004769 | JGI24735J21928_100047698 | 219 |
| 69 | 3300002067 | JGI24735J21928_10032148 | JGI24735J21928_100321482 | 219 |
| 70 | 3300002067 | JGI24735J21928_10036968 | JGI24735J21928_100369682 | 219 |
| 71 | 3300002067 | JGI24735J21928_10042443 | JGI24735J21928_100424432 | 219 |
| 72 | 3300002075 | JGI24738J21930_10001022 | JGI24738J21930_100010225 | 219 |
| 73 | 3300002077 | JGI24744J21845_10000104 | JGI24744J21845_100001044 | 219 |
| 74 | 3300003323 | rootH1_10116888 | rootH1_101168881 | 219 |
| 75 | 3300003773 | Ga0055537_1001707 | Ga0055537_10017074 | 219 |
| 76 | 3300003775 | Ga0055524_1000226 | Ga0055524_100022630 | 219 |
| 77 | 3300003794 | Ga0055531_10007478 | Ga0055531_100074783 | 219 |
| 78 | 3300005262 | Ga0065165_1020728 | Ga0065165_10207284 | 219 |
| 79 | 3300005262 | Ga0065165_1060343 | Ga0065165_10603432 | 219 |
| 80 | 3300005327 | Ga0070658_10000815 | Ga0070658_1000081512 | 219 |
| 81 | 3300005327 | Ga0070658_10003481 | Ga0070658_100034817 | 219 |
| 82 | 3300005327 | Ga0070658_10116428 | Ga0070658_101164284 | 219 |
| 83 | 3300005328 | Ga0070676_10004001 | Ga0070676_1000400110 | 219 |
| 84 | 3300005334 | Ga0068869_100005963 | Ga0068869_1000059632 | 219 |
| 85 | 3300005338 | Ga0068868_100000201 | Ga0068868_10000020142 | 219 |
| 86 | 3300005339 | Ga0070660_100106990 | Ga0070660_1001069904 | 219 |
| 87 | 3300005354 | Ga0070675_100047742 | Ga0070675_1000477422 | 219 |
| 88 | 3300005364 | Ga0070673_100000015 | Ga0070673_100000015117 | 219 |
| 89 | 3300005366 | Ga0070659_100109825 | Ga0070659_1001098252 | 219 |
| 90 | 3300005366 | Ga0070659_100240852 | Ga0070659_1002408522 | 219 |
| 91 | 3300005455 | Ga0070663_100000668 | Ga0070663_10000066817 | 219 |
| 92 | 3300005457 | Ga0070662_100171541 | Ga0070662_1001715412 | 219 |
| 93 | 3300005459 | Ga0068867_100000236 | Ga0068867_10000023637 | 219 |
| 94 | 3300005539 | Ga0068853_100024318 | Ga0068853_1000243183 | 219 |
| 95 | 3300005539 | Ga0068853_100214383 | Ga0068853_1002143832 | 219 |
| 96 | 3300005543 | Ga0070672_100031388 | Ga0070672_1000313884 | 219 |
| 97 | 3300005543 | Ga0070672_100177226 | Ga0070672_1001772262 | 219 |
| 98 | 3300005577 | Ga0068857_100117703 | Ga0068857_1001177032 | 219 |
| 99 | 3300005578 | Ga0068854_100000118 | Ga0068854_10000011837 | 219 |
| 100 | 3300005614 | Ga0068856_100002333 | Ga0068856_10000233313 | 219 |
| 101 | 3300005614 | Ga0068856_100041261 | Ga0068856_1000412614 | 219 |
| 102 | 3300005616 | Ga0068852_100000052 | Ga0068852_10000005237 | 219 |
| 103 | 3300005616 | Ga0068852_100252598 | Ga0068852_1002525982 | 219 |
| 104 | 3300005617 | Ga0068859_100205555 | Ga0068859_1002055553 | 219 |
| 105 | 3300005834 | Ga0068851_10107380 | Ga0068851_101073802 | 219 |
| 106 | 3300005843 | Ga0068860_100384684 | Ga0068860_1003846842 | 219 |
| 107 | 3300006177 | Ga0075362_10306248 | Ga0075362_103062481 | 219 |
| 108 | 3300006195 | Ga0075366_10263460 | Ga0075366_102634602 | 219 |
| 109 | 3300006237 | Ga0097621_100015294 | Ga0097621_1000152945 | 219 |
| 110 | 3300006353 | Ga0075370_10121444 | Ga0075370_101214442 | 219 |
| 111 | 3300006353 | Ga0075370_10192507 | Ga0075370_101925071 | 219 |
| 112 | 3300006358 | Ga0068871_100006602 | Ga0068871_1000066025 | 219 |
| 113 | 3300006881 | Ga0068865_100001212 | Ga0068865_10000121211 | 219 |
| 114 | 3300006881 | Ga0068865_100147099 | Ga0068865_1001470993 | 219 |
| 115 | 3300006931 | Ga0097620_100205572 | Ga0097620_1002055723 | 219 |
| 116 | 3300009093 | Ga0105240_10016005 | Ga0105240_100160055 | 219 |
| 117 | 3300009098 | Ga0105245_10011115 | Ga0105245_100111152 | 219 |
| 118 | 3300009148 | Ga0105243_10000445 | Ga0105243_1000044545 | 219 |
| 119 | 3300009174 | Ga0105241_10089416 | Ga0105241_100894161 | 219 |
| 120 | 3300009174 | Ga0105241_11076171 | Ga0105241_110761711 | 219 |
| 121 | 3300009176 | Ga0105242_10008694 | Ga0105242_1000869410 | 219 |
| 122 | 3300009177 | Ga0105248_10025328 | Ga0105248_100253289 | 219 |
| 123 | 3300009553 | Ga0105249_10009401 | Ga0105249_1000940110 | 219 |
| 124 | 3300010159 | Ga0099796_10028850 | Ga0099796_100288503 | 219 |
| 125 | 3300010375 | Ga0105239_10146013 | Ga0105239_101460133 | 219 |
| 126 | 3300011119 | Ga0105246_10004240 | Ga0105246_1000424011 | 219 |
| 127 | 3300013100 | Ga0157373_10003714 | Ga0157373_1000371410 | 219 |
| 128 | 3300013105 | Ga0157369_10444860 | Ga0157369_104448602 | 219 |
| 129 | 3300013296 | Ga0157374_10005712 | Ga0157374_100057127 | 219 |
| 130 | 3300013296 | Ga0157374_10006198 | Ga0157374_100061987 | 219 |
| 131 | 3300013297 | Ga0157378_10000394 | Ga0157378_1000039445 | 219 |
| 132 | 3300013307 | Ga0157372_10013070 | Ga0157372_1001307010 | 219 |
| 133 | 3300013307 | Ga0157372_10278079 | Ga0157372_102780792 | 219 |
| 134 | 3300013308 | Ga0157375_10004676 | Ga0157375_100046769 | 219 |
| 135 | 3300014969 | Ga0157376_10000078 | Ga0157376_1000007878 | 219 |
| 136 | 3300025245 | Ga0207425_1009889 | Ga0207425_10098892 | 219 |
| 137 | 3300025254 | Ga0209148_1000146 | Ga0209148_100014622 | 219 |
| 138 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007237 | 219 |
| 139 | 3300025273 | Ga0209673_1001068 | Ga0209673_100106831 | 219 |
| 140 | 3300025295 | Ga0209564_1016455 | Ga0209564_10164551 | 219 |
| 141 | 3300025297 | Ga0209758_1010407 | Ga0209758_10104079 | 219 |
| 142 | 3300025298 | Ga0209050_1006920 | Ga0209050_10069208 | 219 |
| 143 | 3300025299 | Ga0209256_1000008 | Ga0209256_100000879 | 219 |
| 144 | 3300025304 | Ga0209257_1002047 | Ga0209257_10020479 | 219 |
| 145 | 3300025899 | Ga0207642_10332459 | Ga0207642_103324591 | 219 |
| 146 | 3300025904 | Ga0207647_10003389 | Ga0207647_1000338912 | 219 |
| 147 | 3300025904 | Ga0207647_10019991 | Ga0207647_100199918 | 219 |
| 148 | 3300025907 | Ga0207645_10006551 | Ga0207645_1000655110 | 219 |
| 149 | 3300025909 | Ga0207705_10000025 | Ga0207705_10000025118 | 219 |
| 150 | 3300025909 | Ga0207705_10000756 | Ga0207705_1000075612 | 219 |
| 151 | 3300025913 | Ga0207695_10005706 | Ga0207695_1000570612 | 219 |
| 152 | 3300025919 | Ga0207657_10003967 | Ga0207657_1000396713 | 219 |
| 153 | 3300025919 | Ga0207657_10142299 | Ga0207657_101422992 | 219 |
| 154 | 3300025919 | Ga0207657_10214510 | Ga0207657_102145102 | 219 |
| 155 | 3300025926 | Ga0207659_10011485 | Ga0207659_100114859 | 219 |
| 156 | 3300025932 | Ga0207690_10054178 | Ga0207690_100541783 | 219 |
| 157 | 3300025932 | Ga0207690_10139641 | Ga0207690_101396413 | 219 |
| 158 | 3300025933 | Ga0207706_10109312 | Ga0207706_101093123 | 219 |
| 159 | 3300025933 | Ga0207706_10244280 | Ga0207706_102442802 | 219 |
| 160 | 3300025934 | Ga0207686_10004020 | Ga0207686_1000402010 | 219 |
| 161 | 3300025935 | Ga0207709_10000118 | Ga0207709_10000118122 | 219 |
| 162 | 3300025938 | Ga0207704_10000027 | Ga0207704_10000027122 | 219 |
| 163 | 3300025940 | Ga0207691_10033022 | Ga0207691_100330225 | 219 |
| 164 | 3300025940 | Ga0207691_10183853 | Ga0207691_101838532 | 219 |
| 165 | 3300025941 | Ga0207711_10012992 | Ga0207711_100129924 | 219 |
| 166 | 3300025942 | Ga0207689_10011327 | Ga0207689_1001132710 | 219 |
| 167 | 3300025960 | Ga0207651_10000016 | Ga0207651_10000016122 | 219 |
| 168 | 3300025961 | Ga0207712_10005023 | Ga0207712_100050239 | 219 |
| 169 | 3300025981 | Ga0207640_10000085 | Ga0207640_1000008546 | 219 |
| 170 | 3300026023 | Ga0207677_10000573 | Ga0207677_1000057320 | 219 |
| 171 | 3300026041 | Ga0207639_10035163 | Ga0207639_100351636 | 219 |
| 172 | 3300026041 | Ga0207639_10076428 | Ga0207639_100764284 | 219 |
| 173 | 3300026067 | Ga0207678_10001976 | Ga0207678_1000197616 | 219 |
| 174 | 3300026067 | Ga0207678_10354253 | Ga0207678_103542532 | 219 |
| 175 | 3300026078 | Ga0207702_10003111 | Ga0207702_1000311111 | 219 |
| 176 | 3300026078 | Ga0207702_10046485 | Ga0207702_100464853 | 219 |
| 177 | 3300026078 | Ga0207702_10725874 | Ga0207702_107258742 | 219 |
| 178 | 3300026089 | Ga0207648_10000482 | Ga0207648_1000048210 | 219 |
| 179 | 3300026116 | Ga0207674_10033823 | Ga0207674_100338236 | 219 |
| 180 | 3300026121 | Ga0207683_10002831 | Ga0207683_1000283110 | 219 |
| 181 | 3300026142 | Ga0207698_10000198 | Ga0207698_1000019813 | 219 |
| 182 | 3300026142 | Ga0207698_10377822 | Ga0207698_103778222 | 219 |
| 183 | 3300028381 | Ga0268264_10302001 | Ga0268264_103020012 | 219 |
| 184 | 3300036401 | Ga0373937_0064678 | Ga0373937_0064678_779_1441 | 219 |
| 185 | 3300037418 | Ga0395900_0155924 | Ga0395900_0155924_874_1533 | 219 |
| 186 | 3300037418 | Ga0395900_0454853 | Ga0395900_0454853_359_1018 | 219 |
| 187 | 3300037471 | Ga0395905_0108495 | Ga0395905_0108495_281_940 | 219 |
| 188 | 3300037471 | Ga0395905_0603537 | Ga0395905_0603537_323_982 | 219 |
| 189 | 3300038443 | Ga0395901_0020753 | Ga0395901_0020753_1319_1978 | 219 |
| 190 | 3300039450 | Ga0436363_0307925 | Ga0436363_0307925_654_1313 | 219 |
| 191 | 3300041404 | Ga0439436_0015108 | Ga0439436_0015108_1491_2150 | 219 |
| 192 | 3300041404 | Ga0439436_0018976 | Ga0439436_0018976_910_1569 | 219 |
| 193 | 3300041406 | Ga0439439_0054186 | Ga0439439_0054186_328_987 | 219 |
| 194 | 3300041410 | Ga0439461_0000038 | Ga0439461_0000038_5223_5882 | 219 |
| 195 | 3300041411 | Ga0439466_0105330 | Ga0439466_0105330_77_736 | 219 |
| 196 | 3300041413 | Ga0439465_0056611 | Ga0439465_0056611_408_1067 | 219 |
| 197 | 3300041452 | Ga0451793_0822967 | Ga0451793_0822967_933_1592 | 219 |
| 198 | 3300041460 | Ga0451802_0050544 | Ga0451802_0050544_1206_1865 | 219 |
| 199 | 3300041486 | Ga0451807_0413610 | Ga0451807_0413610_659_1318 | 219 |
| 200 | 3300041997 | Ga0439431_0000211 | Ga0439431_0000211_5236_5895 | 219 |
| 201 | 3300042002 | Ga0439442_000819 | Ga0439442_000819_5428_6087 | 219 |
| 202 | 3300042004 | Ga0439445_0024896 | Ga0439445_0024896_44_703 | 219 |
| 203 | 3300042005 | Ga0439448_0005395 | Ga0439448_0005395_2696_3355 | 219 |
| 204 | 3300042006 | Ga0439432_000877 | Ga0439432_000877_329_988 | 219 |
| 205 | 3300042008 | Ga0439450_037327 | Ga0439450_037327_244_903 | 219 |
| 206 | 3300042012 | Ga0439455_0000361 | Ga0439455_0000361_3372_4031 | 219 |
| 207 | 3300042012 | Ga0439455_0003075 | Ga0439455_0003075_206_865 | 219 |
| 208 | 3300042015 | Ga0439462_0003378 | Ga0439462_0003378_1159_1818 | 219 |
| 209 | 3300042015 | Ga0439462_0011114 | Ga0439462_0011114_368_1027 | 219 |
| 210 | 3300042157 | Ga0439458_0000415 | Ga0439458_0000415_4045_4704 | 219 |
| 211 | 3300042157 | Ga0439458_0000568 | Ga0439458_0000568_8638_9297 | 219 |
| 212 | 3300042435 | Ga0439434_0002786 | Ga0439434_0002786_2703_3362 | 219 |
| 213 | 3300044658 | Ga0466972_0001273 | Ga0466972_0001273_6995_7654 | 219 |
| 214 | 3300044706 | Ga0466964_0002598 | Ga0466964_0002598_612_1271 | 219 |
| 215 | 3300044735 | Ga0466968_0021573 | Ga0466968_0021573_911_1570 | 219 |
| 216 | 3300044901 | Ga0466960_0001185 | Ga0466960_0001185_3795_4454 | 219 |
| 217 | 3300045836 | Ga0466958_0210151 | Ga0466958_0210151_220_879 | 219 |
| 218 | 3300046694 | Ga0495649_0026356 | Ga0495649_0026356_395_1054 | 219 |
| 219 | 3300047443 | Ga0495687_042422 | Ga0495687_042422_482_1141 | 219 |
| 220 | 3300048903 | Ga0496100_0410185 | Ga0496100_0410185_306_965 | 219 |
| 221 | 3300049822 | Ga0501035_0355702 | Ga0501035_0355702_289_948 | 219 |
| 222 | 3300049823 | Ga0501044_0080147 | Ga0501044_0080147_2143_2805 | 219 |
| 223 | 3300050496 | nmdc:mga07m45_178091_c1 | nmdc:mga07m45_178091_c1_71_730 | 219 |
| 224 | 3300050496 | nmdc:mga07m45_20988_c1 | nmdc:mga07m45_20988_c1_2509_3168 | 219 |
| 225 | 3300053087 | Ga0500643_081307 | Ga0500643_081307_86_757 | 219 |
| 226 | 3300053104 | Ga0500556_0104594 | Ga0500556_0104594_187_846 | 219 |
| 227 | 3300053730 | Ga0500645_002595 | Ga0500645_002595_4095_4754 | 219 |
| 228 | 3300005539 | Ga0068853_100035402 | Ga0068853_1000354025 | 220 |
| 229 | 3300026041 | Ga0207639_10041164 | Ga0207639_100411644 | 220 |
| 230 | 3300053119 | Ga0500595_000700 | Ga0500595_000700_10684_11346 | 220 |
| 231 | 3300053087 | Ga0500643_010345 | Ga0500643_010345_1039_1704 | 221 |
| 232 | 3300053134 | Ga0500658_0008330 | Ga0500658_0008330_2634_3299 | 221 |
| 233 | 3300053134 | Ga0500658_0051426 | Ga0500658_0051426_634_1299 | 221 |
| 234 | 3300001989 | JGI24739J22299_10001313 | JGI24739J22299_100013132 | 224 |
| 235 | 3300001990 | JGI24737J22298_10000087 | JGI24737J22298_100000875 | 224 |
| 236 | 3300002067 | JGI24735J21928_10005036 | JGI24735J21928_100050364 | 224 |
| 237 | 3300002075 | JGI24738J21930_10001128 | JGI24738J21930_100011282 | 224 |
| 238 | 3300005366 | Ga0070659_100241336 | Ga0070659_1002413363 | 224 |
| 239 | 3300005457 | Ga0070662_100008425 | Ga0070662_1000084259 | 224 |
| 240 | 3300013102 | Ga0157371_10094959 | Ga0157371_100949591 | 224 |
| 241 | 3300013307 | Ga0157372_10532082 | Ga0157372_105320822 | 224 |
| 242 | 3300025904 | Ga0207647_10000604 | Ga0207647_1000060423 | 224 |
| 243 | 3300025932 | Ga0207690_10048978 | Ga0207690_100489785 | 224 |
| 244 | 3300025933 | Ga0207706_10001626 | Ga0207706_1000162621 | 224 |
| 245 | 3300037471 | Ga0395905_0041644 | Ga0395905_0041644_2287_2967 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jtw-assembly2.cif.gz_B-3 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8129 | 7 | 195 |
| 3jtw-assembly2.cif.gz_B-3 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8042 | 7 | 195 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.7942 | 8 | 195 |
| 7xh2-assembly1.cif.gz_A | dihydrofolate reductase-like protein sach in safracin biosynthesis | 0.7861 | 7 | 193 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.7855 | 8 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8066 | 7 | 195 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.798 | 7 | 195 | 3.40.430.10 |
| 5ecxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7784 | 8 | 195 | 3.40.430.10 |
| 1vdrA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7784 | 8 | 195 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7765 | 7 | 192 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E1KB80-F1-model_v4 | Dihydrofolate reductase | 0.9649 | 6 | 220 |
GO:0008703
GO:0009231 |
| AF-A0A4Q3ASH4-F1-model_v4 | Dihydrofolate reductase | 0.9588 | 7 | 223 |
GO:0008703
GO:0009231 |
| AF-A0A520HNH4-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9556 | 44 | 219 |
GO:0008703
GO:0009231 |
| AF-A0A1H4P4V0-F1-model_v4 | Dihydrofolate reductase | 0.9513 | 2 | 223 |
GO:0008703
GO:0009231 |
| AF-A0A1W2CR52-F1-model_v4 | Dihydrofolate reductase | 0.9469 | 7 | 203 |
GO:0008703
GO:0009231 GO:0019684 GO:0030077 GO:0045156 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar