F357540

General Info

Members Datasets Scaffolds Average Seq Length
245 175 243 217

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0041644|Ga0395905_0041644_2287_2967
Length 226
Sequence MPLPESKMRRLISGVFQSLDGVMQAPGGPTEDWTQGFTLGGWSATLWDDAMGQAIGGLFSQPFDLLLGRKTYEIFAAHWPYVGPDDPIGQAFDHCRKYVLTRGEEQLDWINSQRLAGIADVAALKQTDGPDLLIQGSSTLYPQLLAADLIDRLFVMTFPVVLGRGKRLFGEGTPSSAWRLVDHQVSTTGVMIATYEPAGAVPIGSFQMQEPSEAEQRRQERMKREG

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
135 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
175 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.96
Nodule 0
Rhizoplane 1.63
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001313 3300001989 Bacteria 9327
2 JGI24737J22298_10000087 3300001990 Bacteria 27343
3 JGI24737J22298_10006419 3300001990 Bacteria 4018
4 JGI24735J21928_10004769 3300002067 Bacteria 4525
5 JGI24735J21928_10005036 3300002067 Bacteria 4397
6 JGI24735J21928_10032148 3300002067 Bacteria 1553
7 JGI24735J21928_10036968 3300002067 Bacteria 1432
8 JGI24735J21928_10042443 3300002067 Bacteria 1324
9 JGI24738J21930_10001022 3300002075 Bacteria 7987
10 JGI24738J21930_10001128 3300002075 Bacteria 7551
11 JGI24744J21845_10000104 3300002077 Bacteria 11338
12 rootH1_10116888 3300003323 Bacteria 4036
13 JGI25160J50197_1012367 3300003354 Bacteria 2965
14 Ga0055526_1013510 3300003771 Bacteria 3445
15 Ga0055537_1001707 3300003773 Bacteria 8124
16 Ga0055524_1000226 3300003775 Bacteria 59950
17 Ga0055528_1002138 3300003790 Bacteria 10887
18 Ga0055530_10009220 3300003791 Bacteria 3827
19 Ga0055531_10007478 3300003794 Bacteria 5953
20 Ga0055543_1012831 3300004625 Bacteria 1672
21 Ga0065165_1000525 3300005262 Bacteria 58607
22 Ga0065165_1020728 3300005262 Bacteria 2304
23 Ga0065165_1060343 3300005262 Bacteria 1041
24 Ga0070658_10000815 3300005327 Bacteria 26642
25 Ga0070658_10003481 3300005327 Bacteria 12932
26 Ga0070658_10116428 3300005327 Bacteria 2218
27 Ga0070676_10004001 3300005328 Bacteria 7734
28 Ga0068869_100005963 3300005334 Bacteria 7705
29 Ga0068868_100000201 3300005338 Bacteria 40113
30 Ga0070660_100106990 3300005339 Bacteria 2222
31 Ga0070675_100047742 3300005354 Bacteria 3509
32 Ga0070671_100021835 3300005355 Bacteria 5228
33 Ga0070673_100000015 3300005364 Bacteria 118064
34 Ga0070659_100109825 3300005366 Bacteria 2226
35 Ga0070659_100240852 3300005366 Bacteria 1497
36 Ga0070659_100241336 3300005366 Bacteria 1495
37 Ga0070663_100000668 3300005455 Bacteria 18445
38 Ga0070663_100021058 3300005455 Bacteria 4329
39 Ga0070662_100008425 3300005457 Bacteria 6721
40 Ga0070662_100171541 3300005457 Bacteria 1704
41 Ga0068867_100000236 3300005459 Bacteria 36247
42 Ga0070706_100804322 3300005467 Bacteria 870
43 Ga0070707_100966255 3300005468 Bacteria 817
44 Ga0070679_100202823 3300005530 Bacteria 1948
45 Ga0068853_100024318 3300005539 Bacteria 5078
46 Ga0068853_100035402 3300005539 Bacteria 4241
47 Ga0068853_100214383 3300005539 Bacteria 1756
48 Ga0070672_100031388 3300005543 Bacteria 3998
49 Ga0070672_100177226 3300005543 Bacteria 1775
50 Ga0068855_100005189 3300005563 Bacteria 15889
51 Ga0068855_100218212 3300005563 Bacteria 2140
52 Ga0068857_100117703 3300005577 Bacteria 2391
53 Ga0068854_100000118 3300005578 Bacteria 54862
54 Ga0068856_100002333 3300005614 Bacteria 19522
55 Ga0068856_100041261 3300005614 Bacteria 4534
56 Ga0068852_100000052 3300005616 Bacteria 80329
57 Ga0068852_100252598 3300005616 Bacteria 1690
58 Ga0068859_100205555 3300005617 Bacteria 2054
59 Ga0068851_10107380 3300005834 Bacteria 1487
60 Ga0068858_100000318 3300005842 Bacteria 51170
61 Ga0068860_100384684 3300005843 Bacteria 1385
62 Ga0075362_10306248 3300006177 Bacteria 789
63 Ga0075366_10263460 3300006195 Bacteria 1052
64 Ga0097621_100015294 3300006237 Bacteria 5771
65 Ga0075370_10121444 3300006353 Bacteria 1521
66 Ga0075370_10192507 3300006353 Bacteria 1202
67 Ga0068871_100006602 3300006358 Bacteria 8226
68 Ga0068865_100001212 3300006881 Bacteria 15028
69 Ga0068865_100147099 3300006881 Bacteria 1783
70 Ga0097620_100205572 3300006931 Bacteria 2054
71 Ga0105240_10016005 3300009093 Bacteria 10166
72 Ga0105245_10011115 3300009098 Bacteria 7836
73 Ga0105243_10000445 3300009148 Bacteria 43080
74 Ga0105241_10089416 3300009174 Bacteria 2426
75 Ga0105241_11076171 3300009174 Bacteria 756
76 Ga0105242_10008694 3300009176 Bacteria 7790
77 Ga0105248_10025328 3300009177 Bacteria 6596
78 Ga0105249_10009401 3300009553 Bacteria 8554
79 Ga0099796_10028850 3300010159 Bacteria 1785
80 Ga0105239_10073724 3300010375 Bacteria 3753
81 Ga0105239_10146013 3300010375 Bacteria 2638
82 Ga0105246_10004240 3300011119 Bacteria 8718
83 Ga0157373_10003714 3300013100 Bacteria 11553
84 Ga0157371_10094959 3300013102 Bacteria 2113
85 Ga0157369_10444860 3300013105 Bacteria 1342
86 Ga0157374_10005712 3300013296 Bacteria 10496
87 Ga0157374_10006198 3300013296 Bacteria 10136
88 Ga0157378_10000394 3300013297 Bacteria 43079
89 Ga0163162_10035494 3300013306 Bacteria 4967
90 Ga0163162_10265099 3300013306 Bacteria 1849
91 Ga0157372_10013070 3300013307 Bacteria 8856
92 Ga0157372_10097695 3300013307 Bacteria 3350
93 Ga0157372_10167549 3300013307 Bacteria 2541
94 Ga0157372_10278079 3300013307 Bacteria 1946
95 Ga0157372_10532082 3300013307 Bacteria 1370
96 Ga0157375_10004676 3300013308 Bacteria 11907
97 Ga0157376_10000078 3300014969 Bacteria 72879
98 Ga0207425_1009889 3300025245 Bacteria 2348
99 Ga0209148_1000146 3300025254 Bacteria 160734
100 Ga0209565_1000007 3300025263 Bacteria 784361
101 Ga0209455_1026098 3300025272 Bacteria 1052
102 Ga0209673_1000014 3300025273 Bacteria 537082
103 Ga0209673_1000018 3300025273 Bacteria 458281
104 Ga0209673_1001068 3300025273 Bacteria 31210
105 Ga0209564_1013537 3300025295 Bacteria 3454
106 Ga0209564_1016455 3300025295 Bacteria 2942
107 Ga0209758_1004820 3300025297 Bacteria 10891
108 Ga0209758_1010407 3300025297 Bacteria 5570
109 Ga0209050_1000481 3300025298 Bacteria 70155
110 Ga0209050_1006920 3300025298 Bacteria 6552
111 Ga0209256_1000008 3300025299 Bacteria 975723
112 Ga0207426_1002884 3300025302 Bacteria 10177
113 Ga0209257_1002047 3300025304 Bacteria 21436
114 Ga0207642_10332459 3300025899 Bacteria 891
115 Ga0207647_10000604 3300025904 Bacteria 27991
116 Ga0207647_10003389 3300025904 Bacteria 11949
117 Ga0207647_10019991 3300025904 Bacteria 4495
118 Ga0207645_10006551 3300025907 Bacteria 8336
119 Ga0207705_10000025 3300025909 Bacteria 259826
120 Ga0207705_10000756 3300025909 Bacteria 26658
121 Ga0207684_10719935 3300025910 Bacteria 847
122 Ga0207695_10005706 3300025913 Bacteria 16411
123 Ga0207657_10003967 3300025919 Bacteria 15717
124 Ga0207657_10142299 3300025919 Bacteria 1959
125 Ga0207657_10214510 3300025919 Bacteria 1543
126 Ga0207652_10057198 3300025921 Bacteria 3358
127 Ga0207646_10132513 3300025922 Bacteria 2244
128 Ga0207659_10011485 3300025926 Bacteria 5596
129 Ga0207644_10393638 3300025931 Bacteria 1131
130 Ga0207690_10048978 3300025932 Bacteria 2814
131 Ga0207690_10054178 3300025932 Bacteria 2695
132 Ga0207690_10139641 3300025932 Bacteria 1784
133 Ga0207706_10001626 3300025933 Bacteria 22272
134 Ga0207706_10109312 3300025933 Bacteria 2433
135 Ga0207706_10244280 3300025933 Bacteria 1569
136 Ga0207686_10004020 3300025934 Bacteria 7890
137 Ga0207709_10000118 3300025935 Bacteria 122125
138 Ga0207704_10000027 3300025938 Bacteria 122372
139 Ga0207691_10033022 3300025940 Bacteria 4821
140 Ga0207691_10183853 3300025940 Bacteria 1825
141 Ga0207711_10012992 3300025941 Bacteria 6918
142 Ga0207689_10011327 3300025942 Bacteria 7650
143 Ga0207689_10607484 3300025942 Bacteria 920
144 Ga0207667_10000035 3300025949 Bacteria 301056
145 Ga0207651_10000016 3300025960 Bacteria 122094
146 Ga0207712_10005023 3300025961 Bacteria 8369
147 Ga0207640_10000085 3300025981 Bacteria 73838
148 Ga0207677_10000573 3300026023 Bacteria 22918
149 Ga0207703_10004368 3300026035 Bacteria 11617
150 Ga0207639_10035163 3300026041 Bacteria 3707
151 Ga0207639_10041164 3300026041 Bacteria 3455
152 Ga0207639_10076428 3300026041 Bacteria 2637
153 Ga0207678_10001976 3300026067 Bacteria 18682
154 Ga0207678_10135572 3300026067 Bacteria 2100
155 Ga0207678_10354253 3300026067 Bacteria 1266
156 Ga0207702_10003111 3300026078 Bacteria 15373
157 Ga0207702_10046485 3300026078 Bacteria 3654
158 Ga0207702_10725874 3300026078 Bacteria 980
159 Ga0207648_10000482 3300026089 Bacteria 44351
160 Ga0207676_10772431 3300026095 Bacteria 936
161 Ga0207674_10033823 3300026116 Bacteria 5348
162 Ga0207683_10002831 3300026121 Bacteria 15159
163 Ga0207698_10000198 3300026142 Bacteria 37741
164 Ga0207698_10377822 3300026142 Bacteria 1347
165 Ga0268264_10302001 3300028381 Bacteria 1507
166 Ga0265338_10485594 3300028800 Bacteria 871
167 Ga0307508_10000550 3300031616 Bacteria 44447
168 Ga0373937_0064678 3300036401 Bacteria 3365
169 Ga0395900_0155924 3300037418 Bacteria 2332
170 Ga0395900_0454853 3300037418 Bacteria 1236
171 Ga0395905_0041644 3300037471 Bacteria 4310
172 Ga0395905_0108495 3300037471 Bacteria 2606
173 Ga0395905_0603537 3300037471 Bacteria 999
174 Ga0395901_0020753 3300038443 Bacteria 6726
175 Ga0436363_0307925 3300039450 Bacteria 1537
176 Ga0439436_0015108 3300041404 Bacteria 2323
177 Ga0439436_0018976 3300041404 Bacteria 2055
178 Ga0439439_0054186 3300041406 Bacteria 1056
179 Ga0439439_0068946 3300041406 Bacteria 945
180 Ga0439461_0000038 3300041410 Bacteria 16271
181 Ga0439466_0105330 3300041411 Bacteria 877
182 Ga0439465_0001731 3300041413 Bacteria 7139
183 Ga0439465_0056611 3300041413 Bacteria 1292
184 Ga0451793_0822967 3300041452 Bacteria 1771
185 Ga0451802_0050544 3300041460 Bacteria 2552
186 Ga0451807_0413610 3300041486 Bacteria 2848
187 Ga0439431_0000211 3300041997 Bacteria 11608
188 Ga0439442_000819 3300042002 Bacteria 6438
189 Ga0439445_0024896 3300042004 Bacteria 1524
190 Ga0439445_0049497 3300042004 Bacteria 1132
191 Ga0439448_0002944 3300042005 Bacteria 4673
192 Ga0439448_0005395 3300042005 Bacteria 3644
193 Ga0439432_000877 3300042006 Bacteria 11269
194 Ga0439450_037327 3300042008 Bacteria 1116
195 Ga0439452_036650 3300042010 Bacteria 1174
196 Ga0439455_0000361 3300042012 Bacteria 5911
197 Ga0439455_0001231 3300042012 Bacteria 4190
198 Ga0439455_0003075 3300042012 Bacteria 3136
199 Ga0439462_0003378 3300042015 Bacteria 3827
200 Ga0439462_0011114 3300042015 Bacteria 2288
201 Ga0439446_0015138 3300042156 Bacteria 2137
202 Ga0439458_0000415 3300042157 Bacteria 10732
203 Ga0439458_0000568 3300042157 Bacteria 9503
204 Ga0439434_0002786 3300042435 Bacteria 5098
205 Ga0466972_0001273 3300044658 Bacteria 12167
206 Ga0466965_0106033 3300044683 Bacteria 1441
207 Ga0466966_0009843 3300044684 Bacteria 6337
208 Ga0466961_0027839 3300044693 Bacteria 3634
209 Ga0466964_0002598 3300044706 Bacteria 6449
210 Ga0466968_0021573 3300044735 Bacteria 2609
211 Ga0466970_0004885 3300044765 Bacteria 6620
212 Ga0466960_0001185 3300044901 Bacteria 9393
213 Ga0466959_0017484 3300045049 Bacteria 5256
214 Ga0466958_0084236 3300045836 Bacteria 1960
215 Ga0466958_0210151 3300045836 Bacteria 1240
216 Ga0495638_0002975 3300046460 Bacteria 13525
217 Ga0495641_0236508 3300046461 Bacteria 820
218 Ga0495625_0001098 3300046660 Bacteria 35115
219 Ga0495649_0026356 3300046694 Bacteria 3233
220 Ga0495687_042422 3300047443 Bacteria 1988
221 Ga0495686_0013725 3300047472 Bacteria 5613
222 Ga0496100_0410185 3300048903 Bacteria 1033
223 Ga0496117_0140505 3300048920 Bacteria 1447
224 Ga0496118_0036599 3300048921 Bacteria 3964
225 Ga0496120_0040389 3300048923 Bacteria 2742
226 Ga0496121_0009365 3300048924 Bacteria 11280
227 Ga0496122_0029814 3300048925 Bacteria 4589
228 Ga0496123_0101299 3300048926 Bacteria 1674
229 Ga0501035_0355702 3300049822 Bacteria 1225
230 Ga0501044_0080147 3300049823 Bacteria 3307
231 nmdc:mga07m45_178091_c1 3300050496 Bacteria 1236
232 nmdc:mga07m45_20988_c1 3300050496 Bacteria 3552
233 nmdc:mga0sz30_354471_c1 3300050516 Bacteria 656
234 Ga0500643_010345 3300053087 Bacteria 3480
235 Ga0500643_081307 3300053087 Bacteria 889
236 Ga0500651_0331507 3300053093 Bacteria 867
237 Ga0500556_0104594 3300053104 Bacteria 1093
238 Ga0500595_000700 3300053119 Bacteria 20020
239 Ga0500658_0006669 3300053134 Bacteria 4278
240 Ga0500658_0008330 3300053134 Bacteria 3832
241 Ga0500658_0051426 3300053134 Bacteria 1684
242 Ga0500559_0073774 3300053136 Bacteria 1540
243 Ga0500645_002595 3300053730 Bacteria 7942

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0236508 Ga0495641_0236508_35_595 184
2 3300005355 Ga0070671_100021835 Ga0070671_1000218356 191
3 3300005455 Ga0070663_100021058 Ga0070663_1000210586 191
4 3300025931 Ga0207644_10393638 Ga0207644_103936381 191
5 3300026067 Ga0207678_10135572 Ga0207678_101355722 191
6 3300042005 Ga0439448_0002944 Ga0439448_0002944_353_1012 191
7 3300042012 Ga0439455_0001231 Ga0439455_0001231_3444_4103 191
8 3300048920 Ga0496117_0140505 Ga0496117_0140505_486_1145 195
9 3300048921 Ga0496118_0036599 Ga0496118_0036599_2933_3592 195
10 3300048923 Ga0496120_0040389 Ga0496120_0040389_1442_2101 195
11 3300048924 Ga0496121_0009365 Ga0496121_0009365_3227_3886 195
12 3300048925 Ga0496122_0029814 Ga0496122_0029814_2324_2983 195
13 3300048926 Ga0496123_0101299 Ga0496123_0101299_946_1605 195
14 3300013306 Ga0163162_10035494 Ga0163162_100354948 200
15 3300026095 Ga0207676_10772431 Ga0207676_107724311 200
16 3300044683 Ga0466965_0106033 Ga0466965_0106033_359_1033 200
17 3300044684 Ga0466966_0009843 Ga0466966_0009843_2271_2945 200
18 3300044693 Ga0466961_0027839 Ga0466961_0027839_451_1125 200
19 3300044765 Ga0466970_0004885 Ga0466970_0004885_2475_3149 200
20 3300045049 Ga0466959_0017484 Ga0466959_0017484_100_774 200
21 3300045836 Ga0466958_0084236 Ga0466958_0084236_478_1152 200
22 3300005467 Ga0070706_100804322 Ga0070706_1008043221 201
23 3300005468 Ga0070707_100966255 Ga0070707_1009662551 201
24 3300025910 Ga0207684_10719935 Ga0207684_107199352 201
25 3300025922 Ga0207646_10132513 Ga0207646_101325132 201
26 3300042010 Ga0439452_036650 Ga0439452_036650_517_1155 202
27 3300010375 Ga0105239_10073724 Ga0105239_100737246 203
28 3300042156 Ga0439446_0015138 Ga0439446_0015138_10_624 204
29 3300050516 nmdc:mga0sz30_354471_c1 nmdc:mga0sz30_354471_c1_32_646 204
30 3300046460 Ga0495638_0002975 Ga0495638_0002975_4925_5587 205
31 3300028800 Ga0265338_10485594 Ga0265338_104855941 206
32 3300005563 Ga0068855_100005189 Ga0068855_10000518910 209
33 3300013307 Ga0157372_10167549 Ga0157372_101675495 209
34 3300025949 Ga0207667_10000035 Ga0207667_100000359 209
35 3300041406 Ga0439439_0068946 Ga0439439_0068946_215_874 209
36 3300041413 Ga0439465_0001731 Ga0439465_0001731_4677_5336 209
37 3300042004 Ga0439445_0049497 Ga0439445_0049497_440_1099 209
38 3300053134 Ga0500658_0006669 Ga0500658_0006669_3067_3729 212
39 iso_pu_bacteria 2643221622 2644125695 215
40 iso_pu_bacteria 8057101203 8057105550 215
41 3300003354 JGI25160J50197_1012367 JGI25160J50197_10123673 218
42 3300003771 Ga0055526_1013510 Ga0055526_10135101 218
43 3300003790 Ga0055528_1002138 Ga0055528_10021387 218
44 3300003791 Ga0055530_10009220 Ga0055530_100092202 218
45 3300004625 Ga0055543_1012831 Ga0055543_10128312 218
46 3300005262 Ga0065165_1000525 Ga0065165_100052555 218
47 3300005530 Ga0070679_100202823 Ga0070679_1002028232 218
48 3300005563 Ga0068855_100218212 Ga0068855_1002182121 218
49 3300005842 Ga0068858_100000318 Ga0068858_10000031831 218
50 3300013306 Ga0163162_10265099 Ga0163162_102650993 218
51 3300013307 Ga0157372_10097695 Ga0157372_100976954 218
52 3300025272 Ga0209455_1026098 Ga0209455_10260982 218
53 3300025273 Ga0209673_1000014 Ga0209673_1000014264 218
54 3300025273 Ga0209673_1000018 Ga0209673_1000018212 218
55 3300025295 Ga0209564_1013537 Ga0209564_10135372 218
56 3300025297 Ga0209758_1004820 Ga0209758_10048208 218
57 3300025298 Ga0209050_1000481 Ga0209050_10004819 218
58 3300025302 Ga0207426_1002884 Ga0207426_100288412 218
59 3300025921 Ga0207652_10057198 Ga0207652_100571983 218
60 3300025942 Ga0207689_10607484 Ga0207689_106074841 218
61 3300026035 Ga0207703_10004368 Ga0207703_1000436811 218
62 3300031616 Ga0307508_10000550 Ga0307508_1000055033 218
63 3300046660 Ga0495625_0001098 Ga0495625_0001098_29690_30352 218
64 3300047472 Ga0495686_0013725 Ga0495686_0013725_2308_2970 218
65 3300053093 Ga0500651_0331507 Ga0500651_0331507_194_856 218
66 3300053136 Ga0500559_0073774 Ga0500559_0073774_162_824 218
67 3300001990 JGI24737J22298_10006419 JGI24737J22298_100064192 219
68 3300002067 JGI24735J21928_10004769 JGI24735J21928_100047698 219
69 3300002067 JGI24735J21928_10032148 JGI24735J21928_100321482 219
70 3300002067 JGI24735J21928_10036968 JGI24735J21928_100369682 219
71 3300002067 JGI24735J21928_10042443 JGI24735J21928_100424432 219
72 3300002075 JGI24738J21930_10001022 JGI24738J21930_100010225 219
73 3300002077 JGI24744J21845_10000104 JGI24744J21845_100001044 219
74 3300003323 rootH1_10116888 rootH1_101168881 219
75 3300003773 Ga0055537_1001707 Ga0055537_10017074 219
76 3300003775 Ga0055524_1000226 Ga0055524_100022630 219
77 3300003794 Ga0055531_10007478 Ga0055531_100074783 219
78 3300005262 Ga0065165_1020728 Ga0065165_10207284 219
79 3300005262 Ga0065165_1060343 Ga0065165_10603432 219
80 3300005327 Ga0070658_10000815 Ga0070658_1000081512 219
81 3300005327 Ga0070658_10003481 Ga0070658_100034817 219
82 3300005327 Ga0070658_10116428 Ga0070658_101164284 219
83 3300005328 Ga0070676_10004001 Ga0070676_1000400110 219
84 3300005334 Ga0068869_100005963 Ga0068869_1000059632 219
85 3300005338 Ga0068868_100000201 Ga0068868_10000020142 219
86 3300005339 Ga0070660_100106990 Ga0070660_1001069904 219
87 3300005354 Ga0070675_100047742 Ga0070675_1000477422 219
88 3300005364 Ga0070673_100000015 Ga0070673_100000015117 219
89 3300005366 Ga0070659_100109825 Ga0070659_1001098252 219
90 3300005366 Ga0070659_100240852 Ga0070659_1002408522 219
91 3300005455 Ga0070663_100000668 Ga0070663_10000066817 219
92 3300005457 Ga0070662_100171541 Ga0070662_1001715412 219
93 3300005459 Ga0068867_100000236 Ga0068867_10000023637 219
94 3300005539 Ga0068853_100024318 Ga0068853_1000243183 219
95 3300005539 Ga0068853_100214383 Ga0068853_1002143832 219
96 3300005543 Ga0070672_100031388 Ga0070672_1000313884 219
97 3300005543 Ga0070672_100177226 Ga0070672_1001772262 219
98 3300005577 Ga0068857_100117703 Ga0068857_1001177032 219
99 3300005578 Ga0068854_100000118 Ga0068854_10000011837 219
100 3300005614 Ga0068856_100002333 Ga0068856_10000233313 219
101 3300005614 Ga0068856_100041261 Ga0068856_1000412614 219
102 3300005616 Ga0068852_100000052 Ga0068852_10000005237 219
103 3300005616 Ga0068852_100252598 Ga0068852_1002525982 219
104 3300005617 Ga0068859_100205555 Ga0068859_1002055553 219
105 3300005834 Ga0068851_10107380 Ga0068851_101073802 219
106 3300005843 Ga0068860_100384684 Ga0068860_1003846842 219
107 3300006177 Ga0075362_10306248 Ga0075362_103062481 219
108 3300006195 Ga0075366_10263460 Ga0075366_102634602 219
109 3300006237 Ga0097621_100015294 Ga0097621_1000152945 219
110 3300006353 Ga0075370_10121444 Ga0075370_101214442 219
111 3300006353 Ga0075370_10192507 Ga0075370_101925071 219
112 3300006358 Ga0068871_100006602 Ga0068871_1000066025 219
113 3300006881 Ga0068865_100001212 Ga0068865_10000121211 219
114 3300006881 Ga0068865_100147099 Ga0068865_1001470993 219
115 3300006931 Ga0097620_100205572 Ga0097620_1002055723 219
116 3300009093 Ga0105240_10016005 Ga0105240_100160055 219
117 3300009098 Ga0105245_10011115 Ga0105245_100111152 219
118 3300009148 Ga0105243_10000445 Ga0105243_1000044545 219
119 3300009174 Ga0105241_10089416 Ga0105241_100894161 219
120 3300009174 Ga0105241_11076171 Ga0105241_110761711 219
121 3300009176 Ga0105242_10008694 Ga0105242_1000869410 219
122 3300009177 Ga0105248_10025328 Ga0105248_100253289 219
123 3300009553 Ga0105249_10009401 Ga0105249_1000940110 219
124 3300010159 Ga0099796_10028850 Ga0099796_100288503 219
125 3300010375 Ga0105239_10146013 Ga0105239_101460133 219
126 3300011119 Ga0105246_10004240 Ga0105246_1000424011 219
127 3300013100 Ga0157373_10003714 Ga0157373_1000371410 219
128 3300013105 Ga0157369_10444860 Ga0157369_104448602 219
129 3300013296 Ga0157374_10005712 Ga0157374_100057127 219
130 3300013296 Ga0157374_10006198 Ga0157374_100061987 219
131 3300013297 Ga0157378_10000394 Ga0157378_1000039445 219
132 3300013307 Ga0157372_10013070 Ga0157372_1001307010 219
133 3300013307 Ga0157372_10278079 Ga0157372_102780792 219
134 3300013308 Ga0157375_10004676 Ga0157375_100046769 219
135 3300014969 Ga0157376_10000078 Ga0157376_1000007878 219
136 3300025245 Ga0207425_1009889 Ga0207425_10098892 219
137 3300025254 Ga0209148_1000146 Ga0209148_100014622 219
138 3300025263 Ga0209565_1000007 Ga0209565_1000007237 219
139 3300025273 Ga0209673_1001068 Ga0209673_100106831 219
140 3300025295 Ga0209564_1016455 Ga0209564_10164551 219
141 3300025297 Ga0209758_1010407 Ga0209758_10104079 219
142 3300025298 Ga0209050_1006920 Ga0209050_10069208 219
143 3300025299 Ga0209256_1000008 Ga0209256_100000879 219
144 3300025304 Ga0209257_1002047 Ga0209257_10020479 219
145 3300025899 Ga0207642_10332459 Ga0207642_103324591 219
146 3300025904 Ga0207647_10003389 Ga0207647_1000338912 219
147 3300025904 Ga0207647_10019991 Ga0207647_100199918 219
148 3300025907 Ga0207645_10006551 Ga0207645_1000655110 219
149 3300025909 Ga0207705_10000025 Ga0207705_10000025118 219
150 3300025909 Ga0207705_10000756 Ga0207705_1000075612 219
151 3300025913 Ga0207695_10005706 Ga0207695_1000570612 219
152 3300025919 Ga0207657_10003967 Ga0207657_1000396713 219
153 3300025919 Ga0207657_10142299 Ga0207657_101422992 219
154 3300025919 Ga0207657_10214510 Ga0207657_102145102 219
155 3300025926 Ga0207659_10011485 Ga0207659_100114859 219
156 3300025932 Ga0207690_10054178 Ga0207690_100541783 219
157 3300025932 Ga0207690_10139641 Ga0207690_101396413 219
158 3300025933 Ga0207706_10109312 Ga0207706_101093123 219
159 3300025933 Ga0207706_10244280 Ga0207706_102442802 219
160 3300025934 Ga0207686_10004020 Ga0207686_1000402010 219
161 3300025935 Ga0207709_10000118 Ga0207709_10000118122 219
162 3300025938 Ga0207704_10000027 Ga0207704_10000027122 219
163 3300025940 Ga0207691_10033022 Ga0207691_100330225 219
164 3300025940 Ga0207691_10183853 Ga0207691_101838532 219
165 3300025941 Ga0207711_10012992 Ga0207711_100129924 219
166 3300025942 Ga0207689_10011327 Ga0207689_1001132710 219
167 3300025960 Ga0207651_10000016 Ga0207651_10000016122 219
168 3300025961 Ga0207712_10005023 Ga0207712_100050239 219
169 3300025981 Ga0207640_10000085 Ga0207640_1000008546 219
170 3300026023 Ga0207677_10000573 Ga0207677_1000057320 219
171 3300026041 Ga0207639_10035163 Ga0207639_100351636 219
172 3300026041 Ga0207639_10076428 Ga0207639_100764284 219
173 3300026067 Ga0207678_10001976 Ga0207678_1000197616 219
174 3300026067 Ga0207678_10354253 Ga0207678_103542532 219
175 3300026078 Ga0207702_10003111 Ga0207702_1000311111 219
176 3300026078 Ga0207702_10046485 Ga0207702_100464853 219
177 3300026078 Ga0207702_10725874 Ga0207702_107258742 219
178 3300026089 Ga0207648_10000482 Ga0207648_1000048210 219
179 3300026116 Ga0207674_10033823 Ga0207674_100338236 219
180 3300026121 Ga0207683_10002831 Ga0207683_1000283110 219
181 3300026142 Ga0207698_10000198 Ga0207698_1000019813 219
182 3300026142 Ga0207698_10377822 Ga0207698_103778222 219
183 3300028381 Ga0268264_10302001 Ga0268264_103020012 219
184 3300036401 Ga0373937_0064678 Ga0373937_0064678_779_1441 219
185 3300037418 Ga0395900_0155924 Ga0395900_0155924_874_1533 219
186 3300037418 Ga0395900_0454853 Ga0395900_0454853_359_1018 219
187 3300037471 Ga0395905_0108495 Ga0395905_0108495_281_940 219
188 3300037471 Ga0395905_0603537 Ga0395905_0603537_323_982 219
189 3300038443 Ga0395901_0020753 Ga0395901_0020753_1319_1978 219
190 3300039450 Ga0436363_0307925 Ga0436363_0307925_654_1313 219
191 3300041404 Ga0439436_0015108 Ga0439436_0015108_1491_2150 219
192 3300041404 Ga0439436_0018976 Ga0439436_0018976_910_1569 219
193 3300041406 Ga0439439_0054186 Ga0439439_0054186_328_987 219
194 3300041410 Ga0439461_0000038 Ga0439461_0000038_5223_5882 219
195 3300041411 Ga0439466_0105330 Ga0439466_0105330_77_736 219
196 3300041413 Ga0439465_0056611 Ga0439465_0056611_408_1067 219
197 3300041452 Ga0451793_0822967 Ga0451793_0822967_933_1592 219
198 3300041460 Ga0451802_0050544 Ga0451802_0050544_1206_1865 219
199 3300041486 Ga0451807_0413610 Ga0451807_0413610_659_1318 219
200 3300041997 Ga0439431_0000211 Ga0439431_0000211_5236_5895 219
201 3300042002 Ga0439442_000819 Ga0439442_000819_5428_6087 219
202 3300042004 Ga0439445_0024896 Ga0439445_0024896_44_703 219
203 3300042005 Ga0439448_0005395 Ga0439448_0005395_2696_3355 219
204 3300042006 Ga0439432_000877 Ga0439432_000877_329_988 219
205 3300042008 Ga0439450_037327 Ga0439450_037327_244_903 219
206 3300042012 Ga0439455_0000361 Ga0439455_0000361_3372_4031 219
207 3300042012 Ga0439455_0003075 Ga0439455_0003075_206_865 219
208 3300042015 Ga0439462_0003378 Ga0439462_0003378_1159_1818 219
209 3300042015 Ga0439462_0011114 Ga0439462_0011114_368_1027 219
210 3300042157 Ga0439458_0000415 Ga0439458_0000415_4045_4704 219
211 3300042157 Ga0439458_0000568 Ga0439458_0000568_8638_9297 219
212 3300042435 Ga0439434_0002786 Ga0439434_0002786_2703_3362 219
213 3300044658 Ga0466972_0001273 Ga0466972_0001273_6995_7654 219
214 3300044706 Ga0466964_0002598 Ga0466964_0002598_612_1271 219
215 3300044735 Ga0466968_0021573 Ga0466968_0021573_911_1570 219
216 3300044901 Ga0466960_0001185 Ga0466960_0001185_3795_4454 219
217 3300045836 Ga0466958_0210151 Ga0466958_0210151_220_879 219
218 3300046694 Ga0495649_0026356 Ga0495649_0026356_395_1054 219
219 3300047443 Ga0495687_042422 Ga0495687_042422_482_1141 219
220 3300048903 Ga0496100_0410185 Ga0496100_0410185_306_965 219
221 3300049822 Ga0501035_0355702 Ga0501035_0355702_289_948 219
222 3300049823 Ga0501044_0080147 Ga0501044_0080147_2143_2805 219
223 3300050496 nmdc:mga07m45_178091_c1 nmdc:mga07m45_178091_c1_71_730 219
224 3300050496 nmdc:mga07m45_20988_c1 nmdc:mga07m45_20988_c1_2509_3168 219
225 3300053087 Ga0500643_081307 Ga0500643_081307_86_757 219
226 3300053104 Ga0500556_0104594 Ga0500556_0104594_187_846 219
227 3300053730 Ga0500645_002595 Ga0500645_002595_4095_4754 219
228 3300005539 Ga0068853_100035402 Ga0068853_1000354025 220
229 3300026041 Ga0207639_10041164 Ga0207639_100411644 220
230 3300053119 Ga0500595_000700 Ga0500595_000700_10684_11346 220
231 3300053087 Ga0500643_010345 Ga0500643_010345_1039_1704 221
232 3300053134 Ga0500658_0008330 Ga0500658_0008330_2634_3299 221
233 3300053134 Ga0500658_0051426 Ga0500658_0051426_634_1299 221
234 3300001989 JGI24739J22299_10001313 JGI24739J22299_100013132 224
235 3300001990 JGI24737J22298_10000087 JGI24737J22298_100000875 224
236 3300002067 JGI24735J21928_10005036 JGI24735J21928_100050364 224
237 3300002075 JGI24738J21930_10001128 JGI24738J21930_100011282 224
238 3300005366 Ga0070659_100241336 Ga0070659_1002413363 224
239 3300005457 Ga0070662_100008425 Ga0070662_1000084259 224
240 3300013102 Ga0157371_10094959 Ga0157371_100949591 224
241 3300013307 Ga0157372_10532082 Ga0157372_105320822 224
242 3300025904 Ga0207647_10000604 Ga0207647_1000060423 224
243 3300025932 Ga0207690_10048978 Ga0207690_100489785 224
244 3300025933 Ga0207706_10001626 Ga0207706_1000162621 224
245 3300037471 Ga0395905_0041644 Ga0395905_0041644_2287_2967 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

9

192

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8129 7 195
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8042 7 195
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7942 8 195
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7861 7 193
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7855 8 195
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8066 7 195 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.798 7 195 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7784 8 195 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7784 8 195 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7765 7 192 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3E1KB80-F1-model_v4 Dihydrofolate reductase 0.9649 6 220 GO:0008703
GO:0009231
AF-A0A4Q3ASH4-F1-model_v4 Dihydrofolate reductase 0.9588 7 223 GO:0008703
GO:0009231
AF-A0A520HNH4-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9556 44 219 GO:0008703
GO:0009231
AF-A0A1H4P4V0-F1-model_v4 Dihydrofolate reductase 0.9513 2 223 GO:0008703
GO:0009231
AF-A0A1W2CR52-F1-model_v4 Dihydrofolate reductase 0.9469 7 203 GO:0008703
GO:0009231
GO:0019684
GO:0030077
GO:0045156

Feature Viewer

pLDDT pTM Quality
90.57 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map