F357505

General Info

Members Datasets Scaffolds Average Seq Length
245 126 490 393

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100002260|Ga0307415_1000022607
Length 421
Sequence VDDRQVTTKRGVPSGSPRFTRRSIIGGMTAGAIAPAVLRAARPSSASRIAVIGAGVFGAWTAEYLRRAGHQVTLVDMAGPANNRASSGGESRMTRAGYGKDEIYSRMARDSLAEWKTLSTVSGLPIFIPHGVLFFTGTPDDYFTQSLAVNRRLGLPIEELSRPQLQRRFRMIDFSGIELGMFEPGFGALMARRAVQTLVQRFVAGGGQYRHEAAHTLQHQGGRLVSVGLSHGSPLSADLFVFALGPWLPKLFPELLEGRIVATRQEIFGDRRFLPASMPGWADFNGGDVYYGFPDLEGRGVKFAHDAHGVEVDPDAQSRQPTRAALDEIIAFRDRRFPMLKNAPLTEARVCQYENSSNGDFLIDRHPDMPNVILVGGGSGHGFKHGPEVGRLAADLVRGGTQSERRFTLATKGKAQKREVI

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
126 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 4.49
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100002260 3300032126 Bacteria 9545
2 Ga0070658_10005310 3300005327 Bacteria 10457
3 Ga0070658_10026280 3300005327 Bacteria 4669
4 Ga0070658_10031816 3300005327 Bacteria 4239
5 Ga0070658_10174249 3300005327 Bacteria 1808
6 Ga0070690_100001273 3300005330 Bacteria 13096
7 Ga0070670_100052940 3300005331 Bacteria 3486
8 Ga0070680_100002233 3300005336 Bacteria 14285
9 Ga0070682_100027163 3300005337 Bacteria 3433
10 Ga0068868_100017409 3300005338 Bacteria 5354
11 Ga0070660_100009860 3300005339 Bacteria 6737
12 Ga0070660_100075957 3300005339 Bacteria 2631
13 Ga0070660_100143930 3300005339 Bacteria 1914
14 Ga0070660_100152069 3300005339 Bacteria 1861
15 Ga0070687_100024955 3300005343 Bacteria 2862
16 Ga0070661_100009459 3300005344 Bacteria 6747
17 Ga0070661_100067537 3300005344 Bacteria 2627
18 Ga0070671_100001635 3300005355 Bacteria 16920
19 Ga0070674_100010504 3300005356 Bacteria 5601
20 Ga0070659_100006278 3300005366 Bacteria 8590
21 Ga0070659_100066137 3300005366 Bacteria 2864
22 Ga0070659_100105388 3300005366 Bacteria 2272
23 Ga0070667_100167991 3300005367 Bacteria 1935
24 Ga0070667_100221646 3300005367 Bacteria 1684
25 Ga0070678_100002008 3300005456 Bacteria 10994
26 Ga0070662_100019061 3300005457 Bacteria 4652
27 Ga0070662_100025106 3300005457 Bacteria 4112
28 Ga0070662_100133603 3300005457 Bacteria 1916
29 Ga0070681_10042136 3300005458 Bacteria 4576
30 Ga0070681_10126995 3300005458 Bacteria 2483
31 Ga0070681_10140739 3300005458 Bacteria 2342
32 Ga0068867_100008251 3300005459 Bacteria 7356
33 Ga0070679_100081275 3300005530 Bacteria 3229
34 Ga0068853_100069290 3300005539 Bacteria 3068
35 Ga0068853_100072677 3300005539 Bacteria 2998
36 Ga0070672_100001947 3300005543 Bacteria 12943
37 Ga0070686_100055674 3300005544 Bacteria 2534
38 Ga0070665_100112360 3300005548 Bacteria 2727
39 Ga0070665_100157765 3300005548 Bacteria 2271
40 Ga0070664_100010325 3300005564 Bacteria 7578
41 Ga0070664_100023667 3300005564 Bacteria 5074
42 Ga0070664_100097455 3300005564 Bacteria 2553
43 Ga0068856_100289710 3300005614 Bacteria 1654
44 Ga0068856_100441858 3300005614 Bacteria 1321
45 Ga0068852_100002322 3300005616 Bacteria 13070
46 Ga0068852_100066667 3300005616 Bacteria 3144
47 Ga0068852_100150184 3300005616 Bacteria 2166
48 Ga0068859_100235970 3300005617 Bacteria 1917
49 Ga0068859_100278924 3300005617 Bacteria 1764
50 Ga0068859_100346698 3300005617 Bacteria 1580
51 Ga0068864_100009628 3300005618 Bacteria 7971
52 Ga0068851_10004570 3300005834 Bacteria 6243
53 Ga0068863_100023273 3300005841 Bacteria 5919
54 Ga0068863_100139137 3300005841 Bacteria 2320
55 Ga0068858_100021978 3300005842 Bacteria 5958
56 Ga0068862_100022826 3300005844 Bacteria 5237
57 Ga0068862_100063461 3300005844 Bacteria 3178
58 Ga0097621_100007632 3300006237 Bacteria 7754
59 Ga0068871_100051345 3300006358 Bacteria 3338
60 Ga0097620_100007546 3300006931 Bacteria 11045
61 Ga0097620_100235978 3300006931 Bacteria 1917
62 Ga0097620_100278904 3300006931 Bacteria 1764
63 Ga0097620_100346672 3300006931 Bacteria 1580
64 Ga0105240_10033964 3300009093 Bacteria 6586
65 Ga0105240_10037873 3300009093 Bacteria 6193
66 Ga0105245_10004618 3300009098 Bacteria 12158
67 Ga0105247_10069889 3300009101 Bacteria 2193
68 Ga0105243_10086089 3300009148 Bacteria 2577
69 Ga0105248_10014596 3300009177 Bacteria 8645
70 Ga0105238_10012907 3300009551 Bacteria 8430
71 Ga0105238_10114345 3300009551 Bacteria 2678
72 Ga0105249_10449157 3300009553 Bacteria 1327
73 Ga0105239_10243949 3300010375 Bacteria 2017
74 Ga0157373_10003341 3300013100 Bacteria 12125
75 Ga0157373_10004400 3300013100 Bacteria 10616
76 Ga0157373_10084956 3300013100 Bacteria 2231
77 Ga0157373_10091414 3300013100 Bacteria 2144
78 Ga0157371_10097137 3300013102 Bacteria 2088
79 Ga0157370_10108565 3300013104 Bacteria 2595
80 Ga0157369_10306302 3300013105 Bacteria 1652
81 Ga0157374_10039861 3300013296 Bacteria 4324
82 Ga0157374_10260261 3300013296 Bacteria 1709
83 Ga0157372_10152136 3300013307 Bacteria 2671
84 Ga0157375_10002761 3300013308 Bacteria 15188
85 Ga0157375_10347092 3300013308 Bacteria 1650
86 Ga0163163_10123175 3300014325 Bacteria 2628
87 Ga0157376_10105995 3300014969 Bacteria 2466
88 Ga0207656_10009308 3300025321 Bacteria 3645
89 Ga0207710_10038325 3300025900 Bacteria 2119
90 Ga0207680_10043485 3300025903 Bacteria 2635
91 Ga0207647_10000847 3300025904 Bacteria 23725
92 Ga0207705_10002166 3300025909 Bacteria 15203
93 Ga0207705_10006319 3300025909 Bacteria 8795
94 Ga0207705_10006745 3300025909 Bacteria 8484
95 Ga0207705_10020677 3300025909 Bacteria 4700
96 Ga0207705_10032761 3300025909 Bacteria 3713
97 Ga0207705_10041886 3300025909 Bacteria 3286
98 Ga0207705_10064721 3300025909 Bacteria 2642
99 Ga0207707_10055886 3300025912 Bacteria 3434
100 Ga0207707_10163056 3300025912 Bacteria 1949
101 Ga0207695_10197165 3300025913 Bacteria 1929
102 Ga0207660_10003204 3300025917 Bacteria 10704
103 Ga0207657_10000763 3300025919 Bacteria 34137
104 Ga0207657_10001850 3300025919 Bacteria 22857
105 Ga0207657_10003997 3300025919 Bacteria 15678
106 Ga0207657_10004553 3300025919 Bacteria 14654
107 Ga0207657_10028180 3300025919 Bacteria 5129
108 Ga0207657_10085258 3300025919 Bacteria 2646
109 Ga0207649_10008235 3300025920 Bacteria 5679
110 Ga0207649_10033807 3300025920 Bacteria 3058
111 Ga0207652_10088748 3300025921 Bacteria 2713
112 Ga0207652_10132004 3300025921 Bacteria 2228
113 Ga0207652_10166568 3300025921 Bacteria 1976
114 Ga0207681_10054905 3300025923 Bacteria 2711
115 Ga0207644_10000938 3300025931 Bacteria 18557
116 Ga0207644_10090091 3300025931 Bacteria 2284
117 Ga0207690_10010079 3300025932 Bacteria 5614
118 Ga0207690_10042325 3300025932 Bacteria 2990
119 Ga0207690_10100587 3300025932 Bacteria 2064
120 Ga0207706_10005540 3300025933 Bacteria 11774
121 Ga0207706_10005579 3300025933 Bacteria 11723
122 Ga0207706_10080130 3300025933 Bacteria 2871
123 Ga0207706_10122728 3300025933 Bacteria 2285
124 Ga0207709_10161027 3300025935 Bacteria 1565
125 Ga0207669_10027124 3300025937 Bacteria 3129
126 Ga0207669_10075830 3300025937 Bacteria 2132
127 Ga0207691_10161392 3300025940 Bacteria 1966
128 Ga0207711_10001440 3300025941 Bacteria 22257
129 Ga0207711_10002565 3300025941 Bacteria 16166
130 Ga0207711_10013027 3300025941 Bacteria 6906
131 Ga0207661_10087972 3300025944 Bacteria 2581
132 Ga0207679_10019459 3300025945 Bacteria 4561
133 Ga0207679_10059715 3300025945 Bacteria 2830
134 Ga0207679_10256162 3300025945 Bacteria 1490
135 Ga0207667_10010120 3300025949 Bacteria 11048
136 Ga0207667_10106716 3300025949 Bacteria 2889
137 Ga0207658_10019318 3300025986 Bacteria 4712
138 Ga0207658_10147857 3300025986 Bacteria 1910
139 Ga0207658_10154662 3300025986 Bacteria 1873
140 Ga0207677_10007214 3300026023 Bacteria 6128
141 Ga0207703_10002376 3300026035 Bacteria 16368
142 Ga0207703_10004143 3300026035 Bacteria 11960
143 Ga0207639_10111468 3300026041 Bacteria 2230
144 Ga0207678_10004587 3300026067 Bacteria 12421
145 Ga0207678_10005331 3300026067 Bacteria 11514
146 Ga0207678_10007195 3300026067 Bacteria 9867
147 Ga0207702_10121110 3300026078 Bacteria 2342
148 Ga0207641_10016435 3300026088 Bacteria 6059
149 Ga0207641_10074813 3300026088 Bacteria 2923
150 Ga0207641_10145830 3300026088 Bacteria 2140
151 Ga0207648_10015127 3300026089 Bacteria 7101
152 Ga0207675_100044231 3300026118 Bacteria 4160
153 Ga0207683_10001310 3300026121 Bacteria 22492
154 Ga0207698_10002083 3300026142 Bacteria 11797
155 Ga0207698_10008877 3300026142 Bacteria 6374
156 Ga0207698_10123450 3300026142 Bacteria 2197
157 Ga0268266_10305038 3300028379 Bacteria 1486
158 Ga0268265_10013938 3300028380 Bacteria 5473
159 Ga0307408_100014112 3300031548 Bacteria 5307
160 Ga0307405_10000836 3300031731 Bacteria 12118
161 Ga0307405_10006113 3300031731 Bacteria 5892
162 Ga0307405_10045900 3300031731 Bacteria 2680
163 Ga0307413_10005558 3300031824 Bacteria 5643
164 Ga0307413_10020721 3300031824 Bacteria 3504
165 Ga0307413_10039022 3300031824 Bacteria 2757
166 Ga0307413_10064772 3300031824 Bacteria 2272
167 Ga0307410_10001973 3300031852 Bacteria 9649
168 Ga0307410_10003822 3300031852 Bacteria 7651
169 Ga0307410_10014781 3300031852 Bacteria 4607
170 Ga0307410_10051752 3300031852 Bacteria 2770
171 Ga0307406_10002502 3300031901 Bacteria 10015
172 Ga0307406_10077556 3300031901 Bacteria 2198
173 Ga0307406_10094016 3300031901 Bacteria 2025
174 Ga0307407_10009455 3300031903 Bacteria 4541
175 Ga0307412_10008726 3300031911 Bacteria 5799
176 Ga0307412_10041469 3300031911 Bacteria 2983
177 Ga0307409_100010125 3300031995 Bacteria 5838
178 Ga0307409_100023054 3300031995 Bacteria 4305
179 Ga0307416_100020644 3300032002 Bacteria 4706
180 Ga0307416_100175441 3300032002 Bacteria 2001
181 Ga0307416_100358879 3300032002 Bacteria 1478
182 Ga0307414_10018471 3300032004 Bacteria 4294
183 Ga0307414_10029475 3300032004 Bacteria 3572
184 Ga0307414_10053761 3300032004 Bacteria 2810
185 Ga0307414_10156230 3300032004 Bacteria 1806
186 Ga0307411_10008797 3300032005 Bacteria 5255
187 Ga0307411_10135026 3300032005 Bacteria 1809
188 Ga0307411_10172109 3300032005 Bacteria 1634
189 Ga0307411_10184083 3300032005 Bacteria 1588
190 Ga0307415_100006054 3300032126 Bacteria 6483
191 Ga0307415_100010408 3300032126 Bacteria 5268
192 Ga0307415_100134356 3300032126 Bacteria 1878
193 Ga0373954_0016138 3300035118 Bacteria 3342
194 Ga0373931_0104747 3300035691 Bacteria 1596
195 Ga0395899_0002935 3300037312 Bacteria 13677
196 Ga0395899_0036682 3300037312 Bacteria 3677
197 Ga0395899_0045055 3300037312 Bacteria 3286
198 Ga0395899_0158274 3300037312 Bacteria 1602
199 Ga0395899_0222582 3300037312 Bacteria 1306
200 Ga0395900_0035231 3300037418 Bacteria 5155
201 Ga0395900_0041781 3300037418 Bacteria 4725
202 Ga0395900_0092971 3300037418 Bacteria 3098
203 Ga0395900_0107024 3300037418 Bacteria 2873
204 Ga0395900_0179471 3300037418 Bacteria 2152
205 Ga0395900_0197463 3300037418 Bacteria 2037
206 Ga0395900_0223139 3300037418 Bacteria 1898
207 Ga0395900_0305097 3300037418 Bacteria 1577
208 Ga0395898_0023912 3300037466 Bacteria 6167
209 Ga0395898_0027324 3300037466 Bacteria 5730
210 Ga0395898_0160040 3300037466 Bacteria 2153
211 Ga0395898_0262174 3300037466 Bacteria 1648
212 Ga0395898_0378782 3300037466 Bacteria 1349
213 Ga0395905_0021899 3300037471 Bacteria 6044
214 Ga0395905_0032192 3300037471 Bacteria 4932
215 Ga0395905_0033176 3300037471 Bacteria 4850
216 Ga0395905_0051334 3300037471 Bacteria 3862
217 Ga0395905_0137630 3300037471 Bacteria 2297
218 Ga0395905_0204759 3300037471 Bacteria 1849
219 Ga0395901_0073350 3300038443 Bacteria 3569
220 Ga0395901_0073641 3300038443 Bacteria 3562
221 Ga0395901_0105568 3300038443 Bacteria 2956
222 Ga0395901_0108819 3300038443 Bacteria 2909
223 Ga0395901_0126074 3300038443 Bacteria 2691
224 Ga0439445_0000524 3300042004 Bacteria 7760
225 Ga0439448_0010469 3300042005 Bacteria 2753
226 Ga0466961_0152201 3300044693 Bacteria 1444
227 Ga0466971_0087237 3300044719 Bacteria 1427
228 Ga0466970_0051952 3300044765 Bacteria 2188
229 Ga0466957_0004838 3300044842 Bacteria 7534
230 Ga0466958_0000625 3300045836 Bacteria 15150
231 Ga0466967_0238133 3300045976 Bacteria 1735
232 Ga0495668_0029392 3300046616 Bacteria 3105
233 Ga0496100_0026069 3300048903 Bacteria 3580
234 Ga0496101_0008901 3300048904 Bacteria 6576
235 Ga0496105_0177981 3300048908 Bacteria 1742
236 Ga0496107_0035149 3300048910 Bacteria 3592
237 Ga0496109_0069058 3300048912 Bacteria 3239
238 Ga0496111_0008001 3300048914 Bacteria 6972
239 Ga0496112_0004651 3300048915 Bacteria 11668
240 Ga0496112_0077719 3300048915 Bacteria 3282
241 Ga0496113_0002096 3300048916 Bacteria 11488
242 Ga0496114_0260810 3300048917 Bacteria 1526
243 Ga0496115_0002466 3300048918 Bacteria 13295
244 Ga0501225_0034117 3300049705 Bacteria 1401
245 Ga0500658_0000115 3300053134 Bacteria 38090
246 Ga0307415_100002260
247 Ga0070658_10005310
248 Ga0070658_10026280
249 Ga0070658_10031816
250 Ga0070658_10174249
251 Ga0070690_100001273
252 Ga0070670_100052940
253 Ga0070680_100002233
254 Ga0070682_100027163
255 Ga0068868_100017409
256 Ga0070660_100009860
257 Ga0070660_100075957
258 Ga0070660_100143930
259 Ga0070660_100152069
260 Ga0070687_100024955
261 Ga0070661_100009459
262 Ga0070661_100067537
263 Ga0070671_100001635
264 Ga0070674_100010504
265 Ga0070659_100006278
266 Ga0070659_100066137
267 Ga0070659_100105388
268 Ga0070667_100167991
269 Ga0070667_100221646
270 Ga0070678_100002008
271 Ga0070662_100019061
272 Ga0070662_100025106
273 Ga0070662_100133603
274 Ga0070681_10042136
275 Ga0070681_10126995
276 Ga0070681_10140739
277 Ga0068867_100008251
278 Ga0070679_100081275
279 Ga0068853_100069290
280 Ga0068853_100072677
281 Ga0070672_100001947
282 Ga0070686_100055674
283 Ga0070665_100112360
284 Ga0070665_100157765
285 Ga0070664_100010325
286 Ga0070664_100023667
287 Ga0070664_100097455
288 Ga0068856_100289710
289 Ga0068856_100441858
290 Ga0068852_100002322
291 Ga0068852_100066667
292 Ga0068852_100150184
293 Ga0068859_100235970
294 Ga0068859_100278924
295 Ga0068859_100346698
296 Ga0068864_100009628
297 Ga0068851_10004570
298 Ga0068863_100023273
299 Ga0068863_100139137
300 Ga0068858_100021978
301 Ga0068862_100022826
302 Ga0068862_100063461
303 Ga0097621_100007632
304 Ga0068871_100051345
305 Ga0097620_100007546
306 Ga0097620_100235978
307 Ga0097620_100278904
308 Ga0097620_100346672
309 Ga0105240_10033964
310 Ga0105240_10037873
311 Ga0105245_10004618
312 Ga0105247_10069889
313 Ga0105243_10086089
314 Ga0105248_10014596
315 Ga0105238_10012907
316 Ga0105238_10114345
317 Ga0105249_10449157
318 Ga0105239_10243949
319 Ga0157373_10003341
320 Ga0157373_10004400
321 Ga0157373_10084956
322 Ga0157373_10091414
323 Ga0157371_10097137
324 Ga0157370_10108565
325 Ga0157369_10306302
326 Ga0157374_10039861
327 Ga0157374_10260261
328 Ga0157372_10152136
329 Ga0157375_10002761
330 Ga0157375_10347092
331 Ga0163163_10123175
332 Ga0157376_10105995
333 Ga0207656_10009308
334 Ga0207710_10038325
335 Ga0207680_10043485
336 Ga0207647_10000847
337 Ga0207705_10002166
338 Ga0207705_10006319
339 Ga0207705_10006745
340 Ga0207705_10020677
341 Ga0207705_10032761
342 Ga0207705_10041886
343 Ga0207705_10064721
344 Ga0207707_10055886
345 Ga0207707_10163056
346 Ga0207695_10197165
347 Ga0207660_10003204
348 Ga0207657_10000763
349 Ga0207657_10001850
350 Ga0207657_10003997
351 Ga0207657_10004553
352 Ga0207657_10028180
353 Ga0207657_10085258
354 Ga0207649_10008235
355 Ga0207649_10033807
356 Ga0207652_10088748
357 Ga0207652_10132004
358 Ga0207652_10166568
359 Ga0207681_10054905
360 Ga0207644_10000938
361 Ga0207644_10090091
362 Ga0207690_10010079
363 Ga0207690_10042325
364 Ga0207690_10100587
365 Ga0207706_10005540
366 Ga0207706_10005579
367 Ga0207706_10080130
368 Ga0207706_10122728
369 Ga0207709_10161027
370 Ga0207669_10027124
371 Ga0207669_10075830
372 Ga0207691_10161392
373 Ga0207711_10001440
374 Ga0207711_10002565
375 Ga0207711_10013027
376 Ga0207661_10087972
377 Ga0207679_10019459
378 Ga0207679_10059715
379 Ga0207679_10256162
380 Ga0207667_10010120
381 Ga0207667_10106716
382 Ga0207658_10019318
383 Ga0207658_10147857
384 Ga0207658_10154662
385 Ga0207677_10007214
386 Ga0207703_10002376
387 Ga0207703_10004143
388 Ga0207639_10111468
389 Ga0207678_10004587
390 Ga0207678_10005331
391 Ga0207678_10007195
392 Ga0207702_10121110
393 Ga0207641_10016435
394 Ga0207641_10074813
395 Ga0207641_10145830
396 Ga0207648_10015127
397 Ga0207675_100044231
398 Ga0207683_10001310
399 Ga0207698_10002083
400 Ga0207698_10008877
401 Ga0207698_10123450
402 Ga0268266_10305038
403 Ga0268265_10013938
404 Ga0307408_100014112
405 Ga0307405_10000836
406 Ga0307405_10006113
407 Ga0307405_10045900
408 Ga0307413_10005558
409 Ga0307413_10020721
410 Ga0307413_10039022
411 Ga0307413_10064772
412 Ga0307410_10001973
413 Ga0307410_10003822
414 Ga0307410_10014781
415 Ga0307410_10051752
416 Ga0307406_10002502
417 Ga0307406_10077556
418 Ga0307406_10094016
419 Ga0307407_10009455
420 Ga0307412_10008726
421 Ga0307412_10041469
422 Ga0307409_100010125
423 Ga0307409_100023054
424 Ga0307416_100020644
425 Ga0307416_100175441
426 Ga0307416_100358879
427 Ga0307414_10018471
428 Ga0307414_10029475
429 Ga0307414_10053761
430 Ga0307414_10156230
431 Ga0307411_10008797
432 Ga0307411_10135026
433 Ga0307411_10172109
434 Ga0307411_10184083
435 Ga0307415_100006054
436 Ga0307415_100010408
437 Ga0307415_100134356
438 Ga0373954_0016138
439 Ga0373931_0104747
440 Ga0395899_0002935
441 Ga0395899_0036682
442 Ga0395899_0045055
443 Ga0395899_0158274
444 Ga0395899_0222582
445 Ga0395900_0035231
446 Ga0395900_0041781
447 Ga0395900_0092971
448 Ga0395900_0107024
449 Ga0395900_0179471
450 Ga0395900_0197463
451 Ga0395900_0223139
452 Ga0395900_0305097
453 Ga0395898_0023912
454 Ga0395898_0027324
455 Ga0395898_0160040
456 Ga0395898_0262174
457 Ga0395898_0378782
458 Ga0395905_0021899
459 Ga0395905_0032192
460 Ga0395905_0033176
461 Ga0395905_0051334
462 Ga0395905_0137630
463 Ga0395905_0204759
464 Ga0395901_0073350
465 Ga0395901_0073641
466 Ga0395901_0105568
467 Ga0395901_0108819
468 Ga0395901_0126074
469 Ga0439445_0000524
470 Ga0439448_0010469
471 Ga0466961_0152201
472 Ga0466971_0087237
473 Ga0466970_0051952
474 Ga0466957_0004838
475 Ga0466958_0000625
476 Ga0466967_0238133
477 Ga0495668_0029392
478 Ga0496100_0026069
479 Ga0496101_0008901
480 Ga0496105_0177981
481 Ga0496107_0035149
482 Ga0496109_0069058
483 Ga0496111_0008001
484 Ga0496112_0004651
485 Ga0496112_0077719
486 Ga0496113_0002096
487 Ga0496114_0260810
488 Ga0496115_0002466
489 Ga0501225_0034117
490 Ga0500658_0000115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

51

89

0.95

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

48

120

0.86

PF01266

DAO

FAD dependent oxidoreductase

48

396

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1k-assembly2.cif.gz_C crystal structure of synechocystis arogenate dehydrogenase 0.9873 13 41
8jyt-assembly2.cif.gz_D-2 ancestral imine reducatase n560 0.9831 11 41
7o1i-assembly1.cif.gz_A-2 structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a mutant 0.9821 12 42
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.98 13 41
8jyt-assembly2.cif.gz_B ancestral imine reducatase n560 0.9737 12 43
ID Description Score Start End Superfamily
af_P9WFZ3_1_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 1.005 13 41 3.40.50.720
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9946 13 41 3.40.50.720
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.994 12 41 3.50.50.60
af_Q2FYG1_1_188_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9916 12 40 3.40.50.720
1djnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9914 11 41 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A143PUH6-F1-model_v4 Monomeric sarcosine oxidase (EC 1.5.3.1) 0.9787 11 381 GO:0008115
GO:0050660
AF-A0A1Q8AAP1-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9755 20 339 GO:0008115
GO:0050660
AF-A0A2V9BBR0-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9718 15 383 GO:0008115
GO:0050660
AF-A0A2V9JLF7-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9713 90 384 GO:0008115
GO:0050660
AF-A0A1Q7LN24-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9706 75 381 GO:0008115
GO:0050660

Map